easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

incumbens

distrainer

hormotila

pluralistically

perforata

nothingness

propagableness

schmall

hypnotically

pontabisque

unmalicious

dapped

marshalment

demihuman

aistest

aument

undertimed

pareto


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: imberque
cipher variations:
jncfsrvf kodgtswg lpehutxh mqfivuyi nrgjwvzj
oshkxwak ptilyxbl qujmzycm rvknazdn swlobaeo
txmpcbfp uynqdcgq vzoredhr wapsfeis xbqtgfjt
ycruhgku zdsvihlv aetwjimw bfuxkjnx cgvylkoy
dhwzmlpz eixanmqa fjybonrb gkzcposc hladqptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: imberque
Cipher: rnyvijfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: imberque
Cipher: ABAAA ABABB AAAAB AABAA BAAAA ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: imberque
cipher variations:
jncfsrvfzlenaxjnpjgvidxvfhidqjldvfklypzlldmtgvntrzqjwhpjhxsrendr
xvuzmtrzntwhuzfhdrypcftptpaxklhxkodgtswgamfobykoqkhwjeywgijerkme
wglmzqammenuhwousarkxiqkiytsfoesywvanusaouxivagieszqdguquqbylmiy
lpehutxhbngpczlprlixkfzxhjkfslnfxhmnarbnnfovixpvtbslyjrljzutgpft
zxwbovtbpvyjwbhjftarehvrvrczmnjzmqfivuyicohqdamqsmjylgayiklgtmog
yinobscoogpwjyqwuctmzksmkavuhqguayxcpwucqwzkxcikgubsfiwswsdanoka
nrgjwvzjdpirebnrtnkzmhbzjlmhunphzjopctdpphqxkzrxvdunaltnlbwvirhv
bzydqxvdrxalydjlhvctgjxtxteboplboshkxwakeqjsfcosuolanicakmnivoqi
akpqdueqqirylasywevobmuomcxwjsiwcazerywesybmzekmiwduhkyuyufcpqmc
ptilyxblfrktgdptvpmbojdblnojwprjblqrevfrrjszmbtzxfwpcnvpndyxktjx
dbafszxftzcnaflnjxevilzvzvgdqrndqujmzycmgsluhequwqncpkecmopkxqsk
cmrsfwgssktancuaygxqdowqoezylukyecbgtayguadobgmokyfwjmawawhersoe
rvknazdnhtmvifrvxrodqlfdnpqlyrtldnstgxhttlubodvbzhyrepxrpfazmvlz
fdchubzhvbepchnplzgxknbxbxifstpfswlobaeoiunwjgswyspermgeoqrmzsum
eotuhyiuumvcpewcaizsfqysqgbanwmagedivcaiwcfqdioqmahylocycyjgtuqg
txmpcbfpjvoxkhtxztqfsnhfprsnatvnfpuvizjvvnwdqfxdbjatgrztrhcboxnb
hfejwdbjxdgrejprnbizmpdzdzkhuvrhuynqdcgqkwpyliuyaurgtoigqstobuwo
gqvwjakwwoxergyeckbuhsausidcpyocigfkxeckyehsfkqsocjanqeaealivwsi
vzoredhrlxqzmjvzbvshupjhrtupcvxphrwxkblxxpyfshzfdlcvitbvtjedqzpd
jhglyfdlzfitglrtpdkborfbfbmjwxtjwapsfeismyrankwacwtivqkisuvqdwyq
isxylcmyyqzgtiagemdwjucwukferaqekihmzgemagjuhmsuqelcpsgcgcnkxyuk
xbqtgfjtnzsbolxbdxujwrljtvwrexzrjtyzmdnzzrahujbhfnexkvdxvlgfsbrf
ljinahfnbhkvintvrfmdqthdhdolyzvlycruhgkuoatcpmyceyvkxsmkuwxsfyas
kuzaneoaasbivkcigofylweywmhgtcsgmkjobigocilwjouwsgneruieiepmzawm
zdsvihlvpbudqnzdfzwlytnlvxytgzbtlvabofpbbtcjwldjhpgzmxfzxnihudth
nlkpcjhpdjmxkpvxthofsvjfjfqnabxnaetwjimwqcveroaegaxmzuomwyzuhacu
mwbcpgqccudkxmekiqhanygayojiveuiomlqdkiqeknylqwyuipgtwkgkgrobcyo
bfuxkjnxrdwfspbfhbynavpnxzavibdvnxcdqhrddvelynfljribozhbzpkjwfvj
pnmreljrflozmrxzvjqhuxlhlhspcdzpcgvylkoysexgtqcgiczobwqoyabwjcew
oyderiseewfmzogmksjcpaicaqlkxgwkqonsfmksgmpansyawkrivymimitqdeaq
dhwzmlpztfyhurdhjdapcxrpzbcxkdfxpzefsjtffxgnaphnltkdqbjdbrmlyhxl
rpotgnlthnqbotzbxlsjwznjnjurefbreixanmqaugzivseikebqdysqacdylegy
qafgtkuggyhobqiomulerckecsnmziymsqpuhomuiorcpuacymtkxaokokvsfgcs
fjybonrbvhajwtfjlfcreztrbdezmfhzrbghulvhhzipcrjpnvmfsdlfdtonajzn
trqvipnvjpsdqvbdznulybplplwtghdtgkzcposcwibkxugkmgdsfauscefangia
schivmwiiajqdskqowngtemgeupobkaousrwjqowkqterwceaovmzcqmqmxuhieu
hladqptdxjclyvhlnhetgbvtdfgbohjbtdijwnxjjbkretlrpxohufnhfvqpclbp
vtsxkrpxlrufsxdfbpwnadrnrnyvijfvimberqueykdmzwimoifuhcwueghcpikc
uejkxoykkclsfumsqypivgoigwrqdmcqwutylsqymsvgtyegcqxobesosozwjkgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: imberque
Cipher: vzoredhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: imberque
Cipher: 4223215124145451

Extended Methods:
Method #1

Plaintext: imberque
method variations:
orgkwvzktwmpbaepybrugfkudgwzmlpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
i m b e r q u e 
4 2 2 5 2 1 5 5 
2 3 1 1 4 4 4 1 
They are then read out in rows:
4225215523114441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: imberque
Cipher: iwbzmatd

Read more ...
Method #3

Plaintext: imberque
method variations:
ghvfdyyq hvfdyyqg vfdyyqgh
fdyyqghv dyyqghvf yyqghvfd
yqghvfdy qghvfdyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: imberque

first 5040 cipher variations(40320 total)
imberque imberqeu imberuqe imberueq imbereuq imberequ imbeqrue imbeqreu imbequre imbequer imbeqeur
imbeqeru imbeuqre imbeuqer imbeurqe imbeureq imbeuerq imbeueqr imbeequr imbeeqru imbeeuqr imbeeurq
imbeeruq imbeerqu imbreque imbreqeu imbreuqe imbreueq imbreeuq imbreequ imbrqeue imbrqeeu imbrquee
imbrquee imbrqeue imbrqeeu imbruqee imbruqee imbrueqe imbrueeq imbrueeq imbrueqe imbreque imbreqeu
imbreuqe imbreueq imbreeuq imbreequ imbqreue imbqreeu imbqruee imbqruee imbqreue imbqreeu imbqerue
imbqereu imbqeure imbqeuer imbqeeur imbqeeru imbquere imbqueer imbquree imbquree imbquere imbqueer
imbqeeur imbqeeru imbqeuer imbqeure imbqerue imbqereu imburqee imburqee imbureqe imbureeq imbureeq
imbureqe imbuqree imbuqree imbuqere imbuqeer imbuqeer imbuqere imbueqre imbueqer imbuerqe imbuereq
imbueerq imbueeqr imbueqer imbueqre imbueeqr imbueerq imbuereq imbuerqe imberque imberqeu imberuqe
imberueq imbereuq imberequ imbeqrue imbeqreu imbequre imbequer imbeqeur imbeqeru imbeuqre imbeuqer
imbeurqe imbeureq imbeuerq imbeueqr imbeequr imbeeqru imbeeuqr imbeeurq imbeeruq imbeerqu imebrque
imebrqeu imebruqe imebrueq imebreuq imebrequ imebqrue imebqreu imebqure imebquer imebqeur imebqeru
imebuqre imebuqer imeburqe imebureq imebuerq imebueqr imebequr imebeqru imebeuqr imebeurq imeberuq
imeberqu imerbque imerbqeu imerbuqe imerbueq imerbeuq imerbequ imerqbue imerqbeu imerqube imerqueb
imerqeub imerqebu imeruqbe imeruqeb imerubqe imerubeq imeruebq imerueqb imerequb imereqbu imereuqb
imereubq imerebuq imerebqu imeqrbue imeqrbeu imeqrube imeqrueb imeqreub imeqrebu imeqbrue imeqbreu
imeqbure imeqbuer imeqbeur imeqberu imequbre imequber imequrbe imequreb imequerb imequebr imeqebur
imeqebru imeqeubr imeqeurb imeqerub imeqerbu imeurqbe imeurqeb imeurbqe imeurbeq imeurebq imeureqb
imeuqrbe imeuqreb imeuqbre imeuqber imeuqebr imeuqerb imeubqre imeubqer imeubrqe imeubreq imeuberq
imeubeqr imeueqbr imeueqrb imeuebqr imeuebrq imeuerbq imeuerqb imeerqub imeerqbu imeeruqb imeerubq
imeerbuq imeerbqu imeeqrub imeeqrbu imeequrb imeequbr imeeqbur imeeqbru imeeuqrb imeeuqbr imeeurqb
imeeurbq imeeubrq imeeubqr imeebqur imeebqru imeebuqr imeeburq imeebruq imeebrqu imrebque imrebqeu
imrebuqe imrebueq imrebeuq imrebequ imreqbue imreqbeu imreqube imrequeb imreqeub imreqebu imreuqbe
imreuqeb imreubqe imreubeq imreuebq imreueqb imreequb imreeqbu imreeuqb imreeubq imreebuq imreebqu
imrbeque imrbeqeu imrbeuqe imrbeueq imrbeeuq imrbeequ imrbqeue imrbqeeu imrbquee imrbquee imrbqeue
imrbqeeu imrbuqee imrbuqee imrbueqe imrbueeq imrbueeq imrbueqe imrbeque imrbeqeu imrbeuqe imrbeueq
imrbeeuq imrbeequ imrqbeue imrqbeeu imrqbuee imrqbuee imrqbeue imrqbeeu imrqebue imrqebeu imrqeube
imrqeueb imrqeeub imrqeebu imrquebe imrqueeb imrqubee imrqubee imrquebe imrqueeb imrqeeub imrqeebu
imrqeueb imrqeube imrqebue imrqebeu imrubqee imrubqee imrubeqe imrubeeq imrubeeq imrubeqe imruqbee
imruqbee imruqebe imruqeeb imruqeeb imruqebe imrueqbe imrueqeb imruebqe imruebeq imrueebq imrueeqb
imrueqeb imrueqbe imrueeqb imrueebq imruebeq imruebqe imrebque imrebqeu imrebuqe imrebueq imrebeuq
imrebequ imreqbue imreqbeu imreqube imrequeb imreqeub imreqebu imreuqbe imreuqeb imreubqe imreubeq
imreuebq imreueqb imreequb imreeqbu imreeuqb imreeubq imreebuq imreebqu imqerbue imqerbeu imqerube
imqerueb imqereub imqerebu imqebrue imqebreu imqebure imqebuer imqebeur imqeberu imqeubre imqeuber
imqeurbe imqeureb imqeuerb imqeuebr imqeebur imqeebru imqeeubr imqeeurb imqeerub imqeerbu imqrebue
imqrebeu imqreube imqreueb imqreeub imqreebu imqrbeue imqrbeeu imqrbuee imqrbuee imqrbeue imqrbeeu
imqrubee imqrubee imqruebe imqrueeb imqrueeb imqruebe imqrebue imqrebeu imqreube imqreueb imqreeub
imqreebu imqbreue imqbreeu imqbruee imqbruee imqbreue imqbreeu imqberue imqbereu imqbeure imqbeuer
imqbeeur imqbeeru imqbuere imqbueer imqburee imqburee imqbuere imqbueer imqbeeur imqbeeru imqbeuer
imqbeure imqberue imqbereu imqurbee imqurbee imqurebe imqureeb imqureeb imqurebe imqubree imqubree
imqubere imqubeer imqubeer imqubere imquebre imqueber imquerbe imquereb imqueerb imqueebr imqueber
imquebre imqueebr imqueerb imquereb imquerbe imqerbue imqerbeu imqerube imqerueb imqereub imqerebu
imqebrue imqebreu imqebure imqebuer imqebeur imqeberu imqeubre imqeuber imqeurbe imqeureb imqeuerb
imqeuebr imqeebur imqeebru imqeeubr imqeeurb imqeerub imqeerbu imuerqbe imuerqeb imuerbqe imuerbeq
imuerebq imuereqb imueqrbe imueqreb imueqbre imueqber imueqebr imueqerb imuebqre imuebqer imuebrqe
imuebreq imueberq imuebeqr imueeqbr imueeqrb imueebqr imueebrq imueerbq imueerqb imureqbe imureqeb
imurebqe imurebeq imureebq imureeqb imurqebe imurqeeb imurqbee imurqbee imurqebe imurqeeb imurbqee
imurbqee imurbeqe imurbeeq imurbeeq imurbeqe imureqbe imureqeb imurebqe imurebeq imureebq imureeqb
imuqrebe imuqreeb imuqrbee imuqrbee imuqrebe imuqreeb imuqerbe imuqereb imuqebre imuqeber imuqeebr
imuqeerb imuqbere imuqbeer imuqbree imuqbree imuqbere imuqbeer imuqeebr imuqeerb imuqeber imuqebre
imuqerbe imuqereb imubrqee imubrqee imubreqe imubreeq imubreeq imubreqe imubqree imubqree imubqere
imubqeer imubqeer imubqere imubeqre imubeqer imuberqe imubereq imubeerq imubeeqr imubeqer imubeqre
imubeeqr imubeerq imubereq imuberqe imuerqbe imuerqeb imuerbqe imuerbeq imuerebq imuereqb imueqrbe
imueqreb imueqbre imueqber imueqebr imueqerb imuebqre imuebqer imuebrqe imuebreq imueberq imuebeqr
imueeqbr imueeqrb imueebqr imueebrq imueerbq imueerqb imeerqub imeerqbu imeeruqb imeerubq imeerbuq
imeerbqu imeeqrub imeeqrbu imeequrb imeequbr imeeqbur imeeqbru imeeuqrb imeeuqbr imeeurqb imeeurbq
imeeubrq imeeubqr imeebqur imeebqru imeebuqr imeeburq imeebruq imeebrqu imerequb imereqbu imereuqb
imereubq imerebuq imerebqu imerqeub imerqebu imerqueb imerqube imerqbue imerqbeu imeruqeb imeruqbe
imerueqb imeruebq imerubeq imerubqe imerbque imerbqeu imerbuqe imerbueq imerbeuq imerbequ imeqreub
imeqrebu imeqrueb imeqrube imeqrbue imeqrbeu imeqerub imeqerbu imeqeurb imeqeubr imeqebur imeqebru
imequerb imequebr imequreb imequrbe imequbre imequber imeqbeur imeqberu imeqbuer imeqbure imeqbrue
imeqbreu imeurqeb imeurqbe imeureqb imeurebq imeurbeq imeurbqe imeuqreb imeuqrbe imeuqerb imeuqebr
imeuqber imeuqbre imeueqrb imeueqbr imeuerqb imeuerbq imeuebrq imeuebqr imeubqer imeubqre imeubeqr
imeuberq imeubreq imeubrqe imebrque imebrqeu imebruqe imebrueq imebreuq imebrequ imebqrue imebqreu
imebqure imebquer imebqeur imebqeru imebuqre imebuqer imeburqe imebureq imebuerq imebueqr imebequr
imebeqru imebeuqr imebeurq imeberuq imeberqu ibmerque ibmerqeu ibmeruqe ibmerueq ibmereuq ibmerequ
ibmeqrue ibmeqreu ibmequre ibmequer ibmeqeur ibmeqeru ibmeuqre ibmeuqer ibmeurqe ibmeureq ibmeuerq
ibmeueqr ibmeequr ibmeeqru ibmeeuqr ibmeeurq ibmeeruq ibmeerqu ibmreque ibmreqeu ibmreuqe ibmreueq
ibmreeuq ibmreequ ibmrqeue ibmrqeeu ibmrquee ibmrquee ibmrqeue ibmrqeeu ibmruqee ibmruqee ibmrueqe
ibmrueeq ibmrueeq ibmrueqe ibmreque ibmreqeu ibmreuqe ibmreueq ibmreeuq ibmreequ ibmqreue ibmqreeu
ibmqruee ibmqruee ibmqreue ibmqreeu ibmqerue ibmqereu ibmqeure ibmqeuer ibmqeeur ibmqeeru ibmquere
ibmqueer ibmquree ibmquree ibmquere ibmqueer ibmqeeur ibmqeeru ibmqeuer ibmqeure ibmqerue ibmqereu
ibmurqee ibmurqee ibmureqe ibmureeq ibmureeq ibmureqe ibmuqree ibmuqree ibmuqere ibmuqeer ibmuqeer
ibmuqere ibmueqre ibmueqer ibmuerqe ibmuereq ibmueerq ibmueeqr ibmueqer ibmueqre ibmueeqr ibmueerq
ibmuereq ibmuerqe ibmerque ibmerqeu ibmeruqe ibmerueq ibmereuq ibmerequ ibmeqrue ibmeqreu ibmequre
ibmequer ibmeqeur ibmeqeru ibmeuqre ibmeuqer ibmeurqe ibmeureq ibmeuerq ibmeueqr ibmeequr ibmeeqru
ibmeeuqr ibmeeurq ibmeeruq ibmeerqu ibemrque ibemrqeu ibemruqe ibemrueq ibemreuq ibemrequ ibemqrue
ibemqreu ibemqure ibemquer ibemqeur ibemqeru ibemuqre ibemuqer ibemurqe ibemureq ibemuerq ibemueqr
ibemequr ibemeqru ibemeuqr ibemeurq ibemeruq ibemerqu ibermque ibermqeu ibermuqe ibermueq ibermeuq
ibermequ iberqmue iberqmeu iberqume iberquem iberqeum iberqemu iberuqme iberuqem iberumqe iberumeq
iberuemq iberueqm iberequm ibereqmu ibereuqm ibereumq iberemuq iberemqu ibeqrmue ibeqrmeu ibeqrume
ibeqruem ibeqreum ibeqremu ibeqmrue ibeqmreu ibeqmure ibeqmuer ibeqmeur ibeqmeru ibequmre ibequmer
ibequrme ibequrem ibequerm ibequemr ibeqemur ibeqemru ibeqeumr ibeqeurm ibeqerum ibeqermu ibeurqme
ibeurqem ibeurmqe ibeurmeq ibeuremq ibeureqm ibeuqrme ibeuqrem ibeuqmre ibeuqmer ibeuqemr ibeuqerm
ibeumqre ibeumqer ibeumrqe ibeumreq ibeumerq ibeumeqr ibeueqmr ibeueqrm ibeuemqr ibeuemrq ibeuermq
ibeuerqm ibeerqum ibeerqmu ibeeruqm ibeerumq ibeermuq ibeermqu ibeeqrum ibeeqrmu ibeequrm ibeequmr
ibeeqmur ibeeqmru ibeeuqrm ibeeuqmr ibeeurqm ibeeurmq ibeeumrq ibeeumqr ibeemqur ibeemqru ibeemuqr
ibeemurq ibeemruq ibeemrqu ibremque ibremqeu ibremuqe ibremueq ibremeuq ibremequ ibreqmue ibreqmeu
ibrequme ibrequem ibreqeum ibreqemu ibreuqme ibreuqem ibreumqe ibreumeq ibreuemq ibreueqm ibreequm
ibreeqmu ibreeuqm ibreeumq ibreemuq ibreemqu ibrmeque ibrmeqeu ibrmeuqe ibrmeueq ibrmeeuq ibrmeequ
ibrmqeue ibrmqeeu ibrmquee ibrmquee ibrmqeue ibrmqeeu ibrmuqee ibrmuqee ibrmueqe ibrmueeq ibrmueeq
ibrmueqe ibrmeque ibrmeqeu ibrmeuqe ibrmeueq ibrmeeuq ibrmeequ ibrqmeue ibrqmeeu ibrqmuee ibrqmuee
ibrqmeue ibrqmeeu ibrqemue ibrqemeu ibrqeume ibrqeuem ibrqeeum ibrqeemu ibrqueme ibrqueem ibrqumee
ibrqumee ibrqueme ibrqueem ibrqeeum ibrqeemu ibrqeuem ibrqeume ibrqemue ibrqemeu ibrumqee ibrumqee
ibrumeqe ibrumeeq ibrumeeq ibrumeqe ibruqmee ibruqmee ibruqeme ibruqeem ibruqeem ibruqeme ibrueqme
ibrueqem ibruemqe ibruemeq ibrueemq ibrueeqm ibrueqem ibrueqme ibrueeqm ibrueemq ibruemeq ibruemqe
ibremque ibremqeu ibremuqe ibremueq ibremeuq ibremequ ibreqmue ibreqmeu ibrequme ibrequem ibreqeum
ibreqemu ibreuqme ibreuqem ibreumqe ibreumeq ibreuemq ibreueqm ibreequm ibreeqmu ibreeuqm ibreeumq
ibreemuq ibreemqu ibqermue ibqermeu ibqerume ibqeruem ibqereum ibqeremu ibqemrue ibqemreu ibqemure
ibqemuer ibqemeur ibqemeru ibqeumre ibqeumer ibqeurme ibqeurem ibqeuerm ibqeuemr ibqeemur ibqeemru
ibqeeumr ibqeeurm ibqeerum ibqeermu ibqremue ibqremeu ibqreume ibqreuem ibqreeum ibqreemu ibqrmeue
ibqrmeeu ibqrmuee ibqrmuee ibqrmeue ibqrmeeu ibqrumee ibqrumee ibqrueme ibqrueem ibqrueem ibqrueme
ibqremue ibqremeu ibqreume ibqreuem ibqreeum ibqreemu ibqmreue ibqmreeu ibqmruee ibqmruee ibqmreue
ibqmreeu ibqmerue ibqmereu ibqmeure ibqmeuer ibqmeeur ibqmeeru ibqmuere ibqmueer ibqmuree ibqmuree
ibqmuere ibqmueer ibqmeeur ibqmeeru ibqmeuer ibqmeure ibqmerue ibqmereu ibqurmee ibqurmee ibqureme
ibqureem ibqureem ibqureme ibqumree ibqumree ibqumere ibqumeer ibqumeer ibqumere ibquemre ibquemer
ibquerme ibquerem ibqueerm ibqueemr ibquemer ibquemre ibqueemr ibqueerm ibquerem ibquerme ibqermue
ibqermeu ibqerume ibqeruem ibqereum ibqeremu ibqemrue ibqemreu ibqemure ibqemuer ibqemeur ibqemeru
ibqeumre ibqeumer ibqeurme ibqeurem ibqeuerm ibqeuemr ibqeemur ibqeemru ibqeeumr ibqeeurm ibqeerum
ibqeermu ibuerqme ibuerqem ibuermqe ibuermeq ibueremq ibuereqm ibueqrme ibueqrem ibueqmre ibueqmer
ibueqemr ibueqerm ibuemqre ibuemqer ibuemrqe ibuemreq ibuemerq ibuemeqr ibueeqmr ibueeqrm ibueemqr
ibueemrq ibueermq ibueerqm ibureqme ibureqem iburemqe iburemeq ibureemq ibureeqm iburqeme iburqeem
iburqmee iburqmee iburqeme iburqeem iburmqee iburmqee iburmeqe iburmeeq iburmeeq iburmeqe ibureqme
ibureqem iburemqe iburemeq ibureemq ibureeqm ibuqreme ibuqreem ibuqrmee ibuqrmee ibuqreme ibuqreem
ibuqerme ibuqerem ibuqemre ibuqemer ibuqeemr ibuqeerm ibuqmere ibuqmeer ibuqmree ibuqmree ibuqmere
ibuqmeer ibuqeemr ibuqeerm ibuqemer ibuqemre ibuqerme ibuqerem ibumrqee ibumrqee ibumreqe ibumreeq
ibumreeq ibumreqe ibumqree ibumqree ibumqere ibumqeer ibumqeer ibumqere ibumeqre ibumeqer ibumerqe
ibumereq ibumeerq ibumeeqr ibumeqer ibumeqre ibumeeqr ibumeerq ibumereq ibumerqe ibuerqme ibuerqem
ibuermqe ibuermeq ibueremq ibuereqm ibueqrme ibueqrem ibueqmre ibueqmer ibueqemr ibueqerm ibuemqre
ibuemqer ibuemrqe ibuemreq ibuemerq ibuemeqr ibueeqmr ibueeqrm ibueemqr ibueemrq ibueermq ibueerqm
ibeerqum ibeerqmu ibeeruqm ibeerumq ibeermuq ibeermqu ibeeqrum ibeeqrmu ibeequrm ibeequmr ibeeqmur
ibeeqmru ibeeuqrm ibeeuqmr ibeeurqm ibeeurmq ibeeumrq ibeeumqr ibeemqur ibeemqru ibeemuqr ibeemurq
ibeemruq ibeemrqu iberequm ibereqmu ibereuqm ibereumq iberemuq iberemqu iberqeum iberqemu iberquem
iberqume iberqmue iberqmeu iberuqem iberuqme iberueqm iberuemq iberumeq iberumqe ibermque ibermqeu
ibermuqe ibermueq ibermeuq ibermequ ibeqreum ibeqremu ibeqruem ibeqrume ibeqrmue ibeqrmeu ibeqerum
ibeqermu ibeqeurm ibeqeumr ibeqemur ibeqemru ibequerm ibequemr ibequrem ibequrme ibequmre ibequmer
ibeqmeur ibeqmeru ibeqmuer ibeqmure ibeqmrue ibeqmreu ibeurqem ibeurqme ibeureqm ibeuremq ibeurmeq
ibeurmqe ibeuqrem ibeuqrme ibeuqerm ibeuqemr ibeuqmer ibeuqmre ibeueqrm ibeueqmr ibeuerqm ibeuermq
ibeuemrq ibeuemqr ibeumqer ibeumqre ibeumeqr ibeumerq ibeumreq ibeumrqe ibemrque ibemrqeu ibemruqe
ibemrueq ibemreuq ibemrequ ibemqrue ibemqreu ibemqure ibemquer ibemqeur ibemqeru ibemuqre ibemuqer
ibemurqe ibemureq ibemuerq ibemueqr ibemequr ibemeqru ibemeuqr ibemeurq ibemeruq ibemerqu iebmrque
iebmrqeu iebmruqe iebmrueq iebmreuq iebmrequ iebmqrue iebmqreu iebmqure iebmquer iebmqeur iebmqeru
iebmuqre iebmuqer iebmurqe iebmureq iebmuerq iebmueqr iebmequr iebmeqru iebmeuqr iebmeurq iebmeruq
iebmerqu iebrmque iebrmqeu iebrmuqe iebrmueq iebrmeuq iebrmequ iebrqmue iebrqmeu iebrqume iebrquem
iebrqeum iebrqemu iebruqme iebruqem iebrumqe iebrumeq iebruemq iebrueqm iebrequm iebreqmu iebreuqm
iebreumq iebremuq iebremqu iebqrmue iebqrmeu iebqrume iebqruem iebqreum iebqremu iebqmrue iebqmreu
iebqmure iebqmuer iebqmeur iebqmeru iebqumre iebqumer iebqurme iebqurem iebquerm iebquemr iebqemur
iebqemru iebqeumr iebqeurm iebqerum iebqermu ieburqme ieburqem ieburmqe ieburmeq ieburemq iebureqm
iebuqrme iebuqrem iebuqmre iebuqmer iebuqemr iebuqerm iebumqre iebumqer iebumrqe iebumreq iebumerq
iebumeqr iebueqmr iebueqrm iebuemqr iebuemrq iebuermq iebuerqm ieberqum ieberqmu ieberuqm ieberumq
iebermuq iebermqu iebeqrum iebeqrmu iebequrm iebequmr iebeqmur iebeqmru iebeuqrm iebeuqmr iebeurqm
iebeurmq iebeumrq iebeumqr iebemqur iebemqru iebemuqr iebemurq iebemruq iebemrqu iembrque iembrqeu
iembruqe iembrueq iembreuq iembrequ iembqrue iembqreu iembqure iembquer iembqeur iembqeru iembuqre
iembuqer iemburqe iembureq iembuerq iembueqr iembequr iembeqru iembeuqr iembeurq iemberuq iemberqu
iemrbque iemrbqeu iemrbuqe iemrbueq iemrbeuq iemrbequ iemrqbue iemrqbeu iemrqube iemrqueb iemrqeub
iemrqebu iemruqbe iemruqeb iemrubqe iemrubeq iemruebq iemrueqb iemrequb iemreqbu iemreuqb iemreubq
iemrebuq iemrebqu iemqrbue iemqrbeu iemqrube iemqrueb iemqreub iemqrebu iemqbrue iemqbreu iemqbure
iemqbuer iemqbeur iemqberu iemqubre iemquber iemqurbe iemqureb iemquerb iemquebr iemqebur iemqebru
iemqeubr iemqeurb iemqerub iemqerbu iemurqbe iemurqeb iemurbqe iemurbeq iemurebq iemureqb iemuqrbe
iemuqreb iemuqbre iemuqber iemuqebr iemuqerb iemubqre iemubqer iemubrqe iemubreq iemuberq iemubeqr
iemueqbr iemueqrb iemuebqr iemuebrq iemuerbq iemuerqb iemerqub iemerqbu iemeruqb iemerubq iemerbuq
iemerbqu iemeqrub iemeqrbu iemequrb iemequbr iemeqbur iemeqbru iemeuqrb iemeuqbr iemeurqb iemeurbq
iemeubrq iemeubqr iemebqur iemebqru iemebuqr iemeburq iemebruq iemebrqu iermbque iermbqeu iermbuqe
iermbueq iermbeuq iermbequ iermqbue iermqbeu iermqube iermqueb iermqeub iermqebu iermuqbe iermuqeb
iermubqe iermubeq iermuebq iermueqb iermequb iermeqbu iermeuqb iermeubq iermebuq iermebqu ierbmque
ierbmqeu ierbmuqe ierbmueq ierbmeuq ierbmequ ierbqmue ierbqmeu ierbqume ierbquem ierbqeum ierbqemu
ierbuqme ierbuqem ierbumqe ierbumeq ierbuemq ierbueqm ierbequm ierbeqmu ierbeuqm ierbeumq ierbemuq
ierbemqu ierqbmue ierqbmeu ierqbume ierqbuem ierqbeum ierqbemu ierqmbue ierqmbeu ierqmube ierqmueb
ierqmeub ierqmebu ierqumbe ierqumeb ierqubme ierqubem ierquebm ierquemb ierqemub ierqembu ierqeumb
ierqeubm ierqebum ierqebmu ierubqme ierubqem ierubmqe ierubmeq ierubemq ierubeqm ieruqbme ieruqbem
ieruqmbe ieruqmeb ieruqemb ieruqebm ierumqbe ierumqeb ierumbqe ierumbeq ierumebq ierumeqb ierueqmb
ierueqbm ieruemqb ieruembq ieruebmq ieruebqm ierebqum ierebqmu ierebuqm ierebumq ierebmuq ierebmqu
iereqbum iereqbmu ierequbm ierequmb iereqmub iereqmbu iereuqbm iereuqmb iereubqm iereubmq iereumbq
iereumqb ieremqub ieremqbu ieremuqb ieremubq ierembuq ierembqu ieqmrbue ieqmrbeu ieqmrube ieqmrueb
ieqmreub ieqmrebu ieqmbrue ieqmbreu ieqmbure ieqmbuer ieqmbeur ieqmberu ieqmubre ieqmuber ieqmurbe
ieqmureb ieqmuerb ieqmuebr ieqmebur ieqmebru ieqmeubr ieqmeurb ieqmerub ieqmerbu ieqrmbue ieqrmbeu
ieqrmube ieqrmueb ieqrmeub ieqrmebu ieqrbmue ieqrbmeu ieqrbume ieqrbuem ieqrbeum ieqrbemu ieqrubme
ieqrubem ieqrumbe ieqrumeb ieqruemb ieqruebm ieqrebum ieqrebmu ieqreubm ieqreumb ieqremub ieqrembu
ieqbrmue ieqbrmeu ieqbrume ieqbruem ieqbreum ieqbremu ieqbmrue ieqbmreu ieqbmure ieqbmuer ieqbmeur
ieqbmeru ieqbumre ieqbumer ieqburme ieqburem ieqbuerm ieqbuemr ieqbemur ieqbemru ieqbeumr ieqbeurm
ieqberum ieqbermu iequrbme iequrbem iequrmbe iequrmeb iequremb iequrebm iequbrme iequbrem iequbmre
iequbmer iequbemr iequberm iequmbre iequmber iequmrbe iequmreb iequmerb iequmebr iequebmr iequebrm
iequembr iequemrb iequermb iequerbm ieqerbum ieqerbmu ieqerubm ieqerumb ieqermub ieqermbu ieqebrum
ieqebrmu ieqeburm ieqebumr ieqebmur ieqebmru ieqeubrm ieqeubmr ieqeurbm ieqeurmb ieqeumrb ieqeumbr
ieqembur ieqembru ieqemubr ieqemurb ieqemrub ieqemrbu ieumrqbe ieumrqeb ieumrbqe ieumrbeq ieumrebq
ieumreqb ieumqrbe ieumqreb ieumqbre ieumqber ieumqebr ieumqerb ieumbqre ieumbqer ieumbrqe ieumbreq
ieumberq ieumbeqr ieumeqbr ieumeqrb ieumebqr ieumebrq ieumerbq ieumerqb ieurmqbe ieurmqeb ieurmbqe
ieurmbeq ieurmebq ieurmeqb ieurqmbe ieurqmeb ieurqbme ieurqbem ieurqebm ieurqemb ieurbqme ieurbqem
ieurbmqe ieurbmeq ieurbemq ieurbeqm ieureqbm ieureqmb ieurebqm ieurebmq ieurembq ieuremqb ieuqrmbe
ieuqrmeb ieuqrbme ieuqrbem ieuqrebm ieuqremb ieuqmrbe ieuqmreb ieuqmbre ieuqmber ieuqmebr ieuqmerb
ieuqbmre ieuqbmer ieuqbrme ieuqbrem ieuqberm ieuqbemr ieuqembr ieuqemrb ieuqebmr ieuqebrm ieuqerbm
ieuqermb ieubrqme ieubrqem ieubrmqe ieubrmeq ieubremq ieubreqm ieubqrme ieubqrem ieubqmre ieubqmer
ieubqemr ieubqerm ieubmqre ieubmqer ieubmrqe ieubmreq ieubmerq ieubmeqr ieubeqmr ieubeqrm ieubemqr
ieubemrq ieubermq ieuberqm ieuerqbm ieuerqmb ieuerbqm ieuerbmq ieuermbq ieuermqb ieueqrbm ieueqrmb
ieueqbrm ieueqbmr ieueqmbr ieueqmrb ieuebqrm ieuebqmr ieuebrqm ieuebrmq ieuebmrq ieuebmqr ieuemqbr
ieuemqrb ieuembqr ieuembrq ieuemrbq ieuemrqb ieemrqub ieemrqbu ieemruqb ieemrubq ieemrbuq ieemrbqu
ieemqrub ieemqrbu ieemqurb ieemqubr ieemqbur ieemqbru ieemuqrb ieemuqbr ieemurqb ieemurbq ieemubrq
ieemubqr ieembqur ieembqru ieembuqr ieemburq ieembruq ieembrqu ieermqub ieermqbu ieermuqb ieermubq
ieermbuq ieermbqu ieerqmub ieerqmbu ieerqumb ieerqubm ieerqbum ieerqbmu ieeruqmb ieeruqbm ieerumqb
ieerumbq ieerubmq ieerubqm ieerbqum ieerbqmu ieerbuqm ieerbumq ieerbmuq ieerbmqu ieeqrmub ieeqrmbu
ieeqrumb ieeqrubm ieeqrbum ieeqrbmu ieeqmrub ieeqmrbu ieeqmurb ieeqmubr ieeqmbur ieeqmbru ieequmrb
ieequmbr ieequrmb ieequrbm ieequbrm ieequbmr ieeqbmur ieeqbmru ieeqbumr ieeqburm ieeqbrum ieeqbrmu
ieeurqmb ieeurqbm ieeurmqb ieeurmbq ieeurbmq ieeurbqm ieeuqrmb ieeuqrbm ieeuqmrb ieeuqmbr ieeuqbmr
ieeuqbrm ieeumqrb ieeumqbr ieeumrqb ieeumrbq ieeumbrq ieeumbqr ieeubqmr ieeubqrm ieeubmqr ieeubmrq
ieeubrmq ieeubrqm ieebrqum ieebrqmu ieebruqm ieebrumq ieebrmuq ieebrmqu ieebqrum ieebqrmu ieebqurm
ieebqumr ieebqmur ieebqmru ieebuqrm ieebuqmr ieeburqm ieeburmq ieebumrq ieebumqr ieebmqur ieebmqru
ieebmuqr ieebmurq ieebmruq ieebmrqu irbemque irbemqeu irbemuqe irbemueq irbemeuq irbemequ irbeqmue
irbeqmeu irbequme irbequem irbeqeum irbeqemu irbeuqme irbeuqem irbeumqe irbeumeq irbeuemq irbeueqm
irbeequm irbeeqmu irbeeuqm irbeeumq irbeemuq irbeemqu irbmeque irbmeqeu irbmeuqe irbmeueq irbmeeuq
irbmeequ irbmqeue irbmqeeu irbmquee irbmquee irbmqeue irbmqeeu irbmuqee irbmuqee irbmueqe irbmueeq
irbmueeq irbmueqe irbmeque irbmeqeu irbmeuqe irbmeueq irbmeeuq irbmeequ irbqmeue irbqmeeu irbqmuee
irbqmuee irbqmeue irbqmeeu irbqemue irbqemeu irbqeume irbqeuem irbqeeum irbqeemu irbqueme irbqueem
irbqumee irbqumee irbqueme irbqueem irbqeeum irbqeemu irbqeuem irbqeume irbqemue irbqemeu irbumqee
irbumqee irbumeqe irbumeeq irbumeeq irbumeqe irbuqmee irbuqmee irbuqeme irbuqeem irbuqeem irbuqeme
irbueqme irbueqem irbuemqe irbuemeq irbueemq irbueeqm irbueqem irbueqme irbueeqm irbueemq irbuemeq
irbuemqe irbemque irbemqeu irbemuqe irbemueq irbemeuq irbemequ irbeqmue irbeqmeu irbequme irbequem
irbeqeum irbeqemu irbeuqme irbeuqem irbeumqe irbeumeq irbeuemq irbeueqm irbeequm irbeeqmu irbeeuqm
irbeeumq irbeemuq irbeemqu irebmque irebmqeu irebmuqe irebmueq irebmeuq irebmequ irebqmue irebqmeu
irebqume irebquem irebqeum irebqemu irebuqme irebuqem irebumqe irebumeq irebuemq irebueqm irebequm
irebeqmu irebeuqm irebeumq irebemuq irebemqu irembque irembqeu irembuqe irembueq irembeuq irembequ
iremqbue iremqbeu iremqube iremqueb iremqeub iremqebu iremuqbe iremuqeb iremubqe iremubeq iremuebq
iremueqb iremequb iremeqbu iremeuqb iremeubq iremebuq iremebqu ireqmbue ireqmbeu ireqmube ireqmueb
ireqmeub ireqmebu ireqbmue ireqbmeu ireqbume ireqbuem ireqbeum ireqbemu irequbme irequbem irequmbe
irequmeb irequemb irequebm ireqebum ireqebmu ireqeubm ireqeumb ireqemub ireqembu ireumqbe ireumqeb
ireumbqe ireumbeq ireumebq ireumeqb ireuqmbe ireuqmeb ireuqbme ireuqbem ireuqebm ireuqemb ireubqme
ireubqem ireubmqe ireubmeq ireubemq ireubeqm ireueqbm ireueqmb ireuebqm ireuebmq ireuembq ireuemqb
ireemqub ireemqbu ireemuqb ireemubq ireembuq ireembqu ireeqmub ireeqmbu ireequmb ireequbm ireeqbum
ireeqbmu ireeuqmb ireeuqbm ireeumqb ireeumbq ireeubmq ireeubqm ireebqum ireebqmu ireebuqm ireebumq
ireebmuq ireebmqu irmebque irmebqeu irmebuqe irmebueq irmebeuq irmebequ irmeqbue irmeqbeu irmeqube
irmequeb irmeqeub irmeqebu irmeuqbe irmeuqeb irmeubqe irmeubeq irmeuebq irmeueqb irmeequb irmeeqbu
irmeeuqb irmeeubq irmeebuq irmeebqu irmbeque irmbeqeu irmbeuqe irmbeueq irmbeeuq irmbeequ irmbqeue
irmbqeeu irmbquee irmbquee irmbqeue irmbqeeu irmbuqee irmbuqee irmbueqe irmbueeq irmbueeq irmbueqe
irmbeque irmbeqeu irmbeuqe irmbeueq irmbeeuq irmbeequ irmqbeue irmqbeeu irmqbuee irmqbuee irmqbeue
irmqbeeu irmqebue irmqebeu irmqeube irmqeueb irmqeeub irmqeebu irmquebe irmqueeb irmqubee irmqubee
irmquebe irmqueeb irmqeeub irmqeebu irmqeueb irmqeube irmqebue irmqebeu irmubqee irmubqee irmubeqe
irmubeeq irmubeeq irmubeqe irmuqbee irmuqbee irmuqebe irmuqeeb irmuqeeb irmuqebe irmueqbe irmueqeb
irmuebqe irmuebeq irmueebq irmueeqb irmueqeb irmueqbe irmueeqb irmueebq irmuebeq irmuebqe irmebque
irmebqeu irmebuqe irmebueq irmebeuq irmebequ irmeqbue irmeqbeu irmeqube irmequeb irmeqeub irmeqebu
irmeuqbe irmeuqeb irmeubqe irmeubeq irmeuebq irmeueqb irmeequb irmeeqbu irmeeuqb irmeeubq irmeebuq
irmeebqu irqembue irqembeu irqemube irqemueb irqemeub irqemebu irqebmue irqebmeu irqebume irqebuem
irqebeum irqebemu irqeubme irqeubem irqeumbe irqeumeb irqeuemb irqeuebm irqeebum irqeebmu irqeeubm
irqeeumb irqeemub irqeembu irqmebue irqmebeu irqmeube irqmeueb irqmeeub irqmeebu irqmbeue irqmbeeu
irqmbuee irqmbuee irqmbeue irqmbeeu irqmubee irqmubee irqmuebe irqmueeb irqmueeb irqmuebe irqmebue
irqmebeu irqmeube irqmeueb irqmeeub irqmeebu irqbmeue irqbmeeu irqbmuee irqbmuee irqbmeue irqbmeeu
irqbemue irqbemeu irqbeume irqbeuem irqbeeum irqbeemu irqbueme irqbueem irqbumee irqbumee irqbueme
irqbueem irqbeeum irqbeemu irqbeuem irqbeume irqbemue irqbemeu irqumbee irqumbee irqumebe irqumeeb
irqumeeb irqumebe irqubmee irqubmee irqubeme irqubeem irqubeem irqubeme irquebme irquebem irquembe
irquemeb irqueemb irqueebm irquebem irquebme irqueebm irqueemb irquemeb irquembe irqembue irqembeu
irqemube irqemueb irqemeub irqemebu irqebmue irqebmeu irqebume irqebuem irqebeum irqebemu irqeubme
irqeubem irqeumbe irqeumeb irqeuemb irqeuebm irqeebum irqeebmu irqeeubm irqeeumb irqeemub irqeembu
iruemqbe iruemqeb iruembqe iruembeq iruemebq iruemeqb irueqmbe irueqmeb irueqbme irueqbem irueqebm
irueqemb iruebqme iruebqem iruebmqe iruebmeq iruebemq iruebeqm irueeqbm irueeqmb irueebqm irueebmq
irueembq irueemqb irumeqbe irumeqeb irumebqe irumebeq irumeebq irumeeqb irumqebe irumqeeb irumqbee
irumqbee irumqebe irumqeeb irumbqee irumbqee irumbeqe irumbeeq irumbeeq irumbeqe irumeqbe irumeqeb
irumebqe irumebeq irumeebq irumeeqb iruqmebe iruqmeeb iruqmbee iruqmbee iruqmebe iruqmeeb iruqembe
iruqemeb iruqebme iruqebem iruqeebm iruqeemb iruqbeme iruqbeem iruqbmee iruqbmee iruqbeme iruqbeem
iruqeebm iruqeemb iruqebem iruqebme iruqembe iruqemeb irubmqee irubmqee irubmeqe irubmeeq irubmeeq
irubmeqe irubqmee irubqmee irubqeme irubqeem irubqeem irubqeme irubeqme irubeqem irubemqe irubemeq
irubeemq irubeeqm irubeqem irubeqme irubeeqm irubeemq irubemeq irubemqe iruemqbe iruemqeb iruembqe
iruembeq iruemebq iruemeqb irueqmbe irueqmeb irueqbme irueqbem irueqebm irueqemb iruebqme iruebqem
iruebmqe iruebmeq iruebemq iruebeqm irueeqbm irueeqmb irueebqm irueebmq irueembq irueemqb ireemqub
ireemqbu ireemuqb ireemubq ireembuq ireembqu ireeqmub ireeqmbu ireequmb ireequbm ireeqbum ireeqbmu
ireeuqmb ireeuqbm ireeumqb ireeumbq ireeubmq ireeubqm ireebqum ireebqmu ireebuqm ireebumq ireebmuq
ireebmqu iremequb iremeqbu iremeuqb iremeubq iremebuq iremebqu iremqeub iremqebu iremqueb iremqube
iremqbue iremqbeu iremuqeb iremuqbe iremueqb iremuebq iremubeq iremubqe irembque irembqeu irembuqe
irembueq irembeuq irembequ ireqmeub ireqmebu ireqmueb ireqmube ireqmbue ireqmbeu ireqemub ireqembu
ireqeumb ireqeubm ireqebum ireqebmu irequemb irequebm irequmeb irequmbe irequbme irequbem ireqbeum
ireqbemu ireqbuem ireqbume ireqbmue ireqbmeu ireumqeb ireumqbe ireumeqb ireumebq ireumbeq ireumbqe
ireuqmeb ireuqmbe ireuqemb ireuqebm ireuqbem ireuqbme ireueqmb ireueqbm ireuemqb ireuembq ireuebmq
ireuebqm ireubqem ireubqme ireubeqm ireubemq ireubmeq ireubmqe irebmque irebmqeu irebmuqe irebmueq
irebmeuq irebmequ irebqmue irebqmeu irebqume irebquem irebqeum irebqemu irebuqme irebuqem irebumqe
irebumeq irebuemq irebueqm irebequm irebeqmu irebeuqm irebeumq irebemuq irebemqu iqbermue iqbermeu
iqberume iqberuem iqbereum iqberemu iqbemrue iqbemreu iqbemure iqbemuer iqbemeur iqbemeru iqbeumre
iqbeumer iqbeurme iqbeurem iqbeuerm iqbeuemr iqbeemur iqbeemru iqbeeumr iqbeeurm iqbeerum iqbeermu
iqbremue iqbremeu iqbreume iqbreuem iqbreeum iqbreemu iqbrmeue iqbrmeeu iqbrmuee iqbrmuee iqbrmeue
iqbrmeeu iqbrumee iqbrumee iqbrueme iqbrueem iqbrueem iqbrueme iqbremue iqbremeu iqbreume iqbreuem
iqbreeum iqbreemu iqbmreue iqbmreeu iqbmruee iqbmruee iqbmreue iqbmreeu iqbmerue iqbmereu iqbmeure
iqbmeuer iqbmeeur iqbmeeru iqbmuere iqbmueer iqbmuree iqbmuree iqbmuere iqbmueer iqbmeeur iqbmeeru
iqbmeuer iqbmeure iqbmerue iqbmereu iqburmee iqburmee iqbureme iqbureem iqbureem iqbureme iqbumree
iqbumree iqbumere iqbumeer iqbumeer iqbumere iqbuemre iqbuemer iqbuerme iqbuerem iqbueerm iqbueemr
iqbuemer iqbuemre iqbueemr iqbueerm iqbuerem iqbuerme iqbermue iqbermeu iqberume iqberuem iqbereum
iqberemu iqbemrue iqbemreu iqbemure iqbemuer iqbemeur iqbemeru iqbeumre iqbeumer iqbeurme iqbeurem
iqbeuerm iqbeuemr iqbeemur iqbeemru iqbeeumr iqbeeurm iqbeerum iqbeermu iqebrmue iqebrmeu iqebrume
iqebruem iqebreum iqebremu iqebmrue iqebmreu iqebmure iqebmuer iqebmeur iqebmeru iqebumre iqebumer
iqeburme iqeburem iqebuerm iqebuemr iqebemur iqebemru iqebeumr iqebeurm iqeberum iqebermu iqerbmue
iqerbmeu iqerbume iqerbuem iqerbeum iqerbemu iqermbue iqermbeu iqermube iqermueb iqermeub iqermebu
iqerumbe iqerumeb iqerubme iqerubem iqeruebm iqeruemb iqeremub iqerembu iqereumb iqereubm iqerebum
iqerebmu iqemrbue iqemrbeu iqemrube iqemrueb iqemreub iqemrebu iqembrue iqembreu iqembure iqembuer
iqembeur iqemberu iqemubre iqemuber iqemurbe iqemureb iqemuerb iqemuebr iqemebur iqemebru iqemeubr
iqemeurb iqemerub iqemerbu iqeurmbe iqeurmeb iqeurbme iqeurbem iqeurebm iqeuremb iqeumrbe iqeumreb
iqeumbre iqeumber iqeumebr iqeumerb iqeubmre iqeubmer iqeubrme iqeubrem iqeuberm iqeubemr iqeuembr
iqeuemrb iqeuebmr iqeuebrm iqeuerbm iqeuermb iqeermub iqeermbu iqeerumb iqeerubm iqeerbum iqeerbmu
iqeemrub iqeemrbu iqeemurb iqeemubr iqeembur iqeembru iqeeumrb iqeeumbr iqeeurmb iqeeurbm iqeeubrm
iqeeubmr iqeebmur iqeebmru iqeebumr iqeeburm iqeebrum iqeebrmu iqrebmue iqrebmeu iqrebume iqrebuem
iqrebeum iqrebemu iqrembue iqrembeu iqremube iqremueb iqremeub iqremebu iqreumbe iqreumeb iqreubme
iqreubem iqreuebm iqreuemb iqreemub iqreembu iqreeumb iqreeubm iqreebum iqreebmu iqrbemue iqrbemeu
iqrbeume iqrbeuem iqrbeeum iqrbeemu iqrbmeue iqrbmeeu iqrbmuee iqrbmuee iqrbmeue iqrbmeeu iqrbumee
iqrbumee iqrbueme iqrbueem iqrbueem iqrbueme iqrbemue iqrbemeu iqrbeume iqrbeuem iqrbeeum iqrbeemu
iqrmbeue iqrmbeeu iqrmbuee iqrmbuee iqrmbeue iqrmbeeu iqrmebue iqrmebeu iqrmeube iqrmeueb iqrmeeub
iqrmeebu iqrmuebe iqrmueeb iqrmubee iqrmubee iqrmuebe iqrmueeb iqrmeeub iqrmeebu iqrmeueb iqrmeube
iqrmebue iqrmebeu iqrubmee iqrubmee iqrubeme iqrubeem iqrubeem iqrubeme iqrumbee iqrumbee iqrumebe
iqrumeeb iqrumeeb iqrumebe iqruembe iqruemeb iqruebme iqruebem iqrueebm iqrueemb iqruemeb iqruembe
iqrueemb iqrueebm iqruebem iqruebme iqrebmue iqrebmeu iqrebume iqrebuem iqrebeum iqrebemu iqrembue
iqrembeu iqremube iqremueb iqremeub iqremebu iqreumbe iqreumeb iqreubme iqreubem iqreuebm iqreuemb
iqreemub iqreembu iqreeumb iqreeubm iqreebum iqreebmu iqmerbue iqmerbeu iqmerube iqmerueb iqmereub
iqmerebu iqmebrue iqmebreu iqmebure iqmebuer iqmebeur iqmeberu iqmeubre iqmeuber iqmeurbe iqmeureb
iqmeuerb iqmeuebr iqmeebur iqmeebru iqmeeubr iqmeeurb iqmeerub iqmeerbu iqmrebue iqmrebeu iqmreube
iqmreueb iqmreeub iqmreebu iqmrbeue iqmrbeeu iqmrbuee iqmrbuee iqmrbeue iqmrbeeu iqmrubee iqmrubee
iqmruebe iqmrueeb iqmrueeb iqmruebe iqmrebue iqmrebeu iqmreube iqmreueb iqmreeub iqmreebu iqmbreue
iqmbreeu iqmbruee iqmbruee iqmbreue iqmbreeu iqmberue iqmbereu iqmbeure iqmbeuer iqmbeeur iqmbeeru
iqmbuere iqmbueer iqmburee iqmburee iqmbuere iqmbueer iqmbeeur iqmbeeru iqmbeuer iqmbeure iqmberue
iqmbereu iqmurbee iqmurbee iqmurebe iqmureeb iqmureeb iqmurebe iqmubree iqmubree iqmubere iqmubeer
iqmubeer iqmubere iqmuebre iqmueber iqmuerbe iqmuereb iqmueerb iqmueebr iqmueber iqmuebre iqmueebr
iqmueerb iqmuereb iqmuerbe iqmerbue iqmerbeu iqmerube iqmerueb iqmereub iqmerebu iqmebrue iqmebreu
iqmebure iqmebuer iqmebeur iqmeberu iqmeubre iqmeuber iqmeurbe iqmeureb iqmeuerb iqmeuebr iqmeebur
iqmeebru iqmeeubr iqmeeurb iqmeerub iqmeerbu iquermbe iquermeb iquerbme iquerbem iquerebm iqueremb
iquemrbe iquemreb iquembre iquember iquemebr iquemerb iquebmre iquebmer iquebrme iquebrem iqueberm
iquebemr iqueembr iqueemrb iqueebmr iqueebrm iqueerbm iqueermb iqurembe iquremeb iqurebme iqurebem
iqureebm iqureemb iqurmebe iqurmeeb iqurmbee iqurmbee iqurmebe iqurmeeb iqurbmee iqurbmee iqurbeme
iqurbeem iqurbeem iqurbeme iqurembe iquremeb iqurebme iqurebem iqureebm iqureemb iqumrebe iqumreeb
iqumrbee iqumrbee iqumrebe iqumreeb iqumerbe iqumereb iqumebre iqumeber iqumeebr iqumeerb iqumbere
iqumbeer iqumbree iqumbree iqumbere iqumbeer iqumeebr iqumeerb iqumeber iqumebre iqumerbe iqumereb
iqubrmee iqubrmee iqubreme iqubreem iqubreem iqubreme iqubmree iqubmree iqubmere iqubmeer iqubmeer
iqubmere iqubemre iqubemer iquberme iquberem iqubeerm iqubeemr iqubemer iqubemre iqubeemr iqubeerm
iquberem iquberme iquermbe iquermeb iquerbme iquerbem iquerebm iqueremb iquemrbe iquemreb iquembre
iquember iquemebr iquemerb iquebmre iquebmer iquebrme iquebrem iqueberm iquebemr iqueembr iqueemrb
iqueebmr iqueebrm iqueerbm iqueermb iqeermub iqeermbu iqeerumb iqeerubm iqeerbum iqeerbmu iqeemrub
iqeemrbu iqeemurb iqeemubr iqeembur iqeembru iqeeumrb iqeeumbr iqeeurmb iqeeurbm iqeeubrm iqeeubmr
iqeebmur iqeebmru iqeebumr iqeeburm iqeebrum iqeebrmu iqeremub iqerembu iqereumb iqereubm iqerebum
iqerebmu iqermeub iqermebu iqermueb iqermube iqermbue iqermbeu iqerumeb iqerumbe iqeruemb iqeruebm
iqerubem iqerubme iqerbmue iqerbmeu iqerbume iqerbuem iqerbeum iqerbemu iqemreub iqemrebu iqemrueb
iqemrube iqemrbue iqemrbeu iqemerub iqemerbu iqemeurb iqemeubr iqemebur iqemebru iqemuerb iqemuebr
iqemureb iqemurbe iqemubre iqemuber iqembeur iqemberu iqembuer iqembure iqembrue iqembreu iqeurmeb
iqeurmbe iqeuremb iqeurebm iqeurbem iqeurbme iqeumreb iqeumrbe iqeumerb iqeumebr iqeumber iqeumbre
iqeuemrb iqeuembr iqeuermb iqeuerbm iqeuebrm iqeuebmr iqeubmer iqeubmre iqeubemr iqeuberm iqeubrem
iqeubrme iqebrmue iqebrmeu iqebrume iqebruem iqebreum iqebremu iqebmrue iqebmreu iqebmure iqebmuer
iqebmeur iqebmeru iqebumre iqebumer iqeburme iqeburem iqebuerm iqebuemr iqebemur iqebemru iqebeumr
iqebeurm iqeberum iqebermu iuberqme iuberqem iubermqe iubermeq iuberemq iubereqm iubeqrme iubeqrem
iubeqmre iubeqmer iubeqemr iubeqerm iubemqre iubemqer iubemrqe iubemreq iubemerq iubemeqr iubeeqmr
iubeeqrm iubeemqr iubeemrq iubeermq iubeerqm iubreqme iubreqem iubremqe iubremeq iubreemq iubreeqm
iubrqeme iubrqeem iubrqmee iubrqmee iubrqeme iubrqeem iubrmqee iubrmqee iubrmeqe iubrmeeq iubrmeeq
iubrmeqe iubreqme iubreqem iubremqe iubremeq iubreemq iubreeqm iubqreme iubqreem iubqrmee iubqrmee
iubqreme iubqreem iubqerme iubqerem iubqemre iubqemer iubqeemr iubqeerm iubqmere iubqmeer iubqmree
iubqmree iubqmere iubqmeer iubqeemr iubqeerm iubqemer iubqemre iubqerme iubqerem iubmrqee iubmrqee
iubmreqe iubmreeq iubmreeq iubmreqe iubmqree iubmqree iubmqere iubmqeer iubmqeer iubmqere iubmeqre
iubmeqer iubmerqe iubmereq iubmeerq iubmeeqr iubmeqer iubmeqre iubmeeqr iubmeerq iubmereq iubmerqe
iuberqme iuberqem iubermqe iubermeq iuberemq iubereqm iubeqrme iubeqrem iubeqmre iubeqmer iubeqemr
iubeqerm iubemqre iubemqer iubemrqe iubemreq iubemerq iubemeqr iubeeqmr iubeeqrm iubeemqr iubeemrq
iubeermq iubeerqm iuebrqme iuebrqem iuebrmqe iuebrmeq iuebremq iuebreqm iuebqrme iuebqrem iuebqmre
iuebqmer iuebqemr iuebqerm iuebmqre iuebmqer iuebmrqe iuebmreq iuebmerq iuebmeqr iuebeqmr iuebeqrm
iuebemqr iuebemrq iuebermq iueberqm iuerbqme iuerbqem iuerbmqe iuerbmeq iuerbemq iuerbeqm iuerqbme
iuerqbem iuerqmbe iuerqmeb iuerqemb iuerqebm iuermqbe iuermqeb iuermbqe iuermbeq iuermebq iuermeqb
iuereqmb iuereqbm iueremqb iuerembq iuerebmq iuerebqm iueqrbme iueqrbem iueqrmbe iueqrmeb iueqremb
iueqrebm iueqbrme iueqbrem iueqbmre iueqbmer iueqbemr iueqberm iueqmbre iueqmber iueqmrbe iueqmreb
iueqmerb iueqmebr iueqebmr iueqebrm iueqembr iueqemrb iueqermb iueqerbm iuemrqbe iuemrqeb iuemrbqe
iuemrbeq iuemrebq iuemreqb iuemqrbe iuemqreb iuemqbre iuemqber iuemqebr iuemqerb iuembqre iuembqer
iuembrqe iuembreq iuemberq iuembeqr iuemeqbr iuemeqrb iuemebqr iuemebrq iuemerbq iuemerqb iueerqmb
iueerqbm iueermqb iueermbq iueerbmq iueerbqm iueeqrmb iueeqrbm iueeqmrb iueeqmbr iueeqbmr iueeqbrm
iueemqrb iueemqbr iueemrqb iueemrbq iueembrq iueembqr iueebqmr iueebqrm iueebmqr iueebmrq iueebrmq
iueebrqm iurebqme iurebqem iurebmqe iurebmeq iurebemq iurebeqm iureqbme iureqbem iureqmbe iureqmeb
iureqemb iureqebm iuremqbe iuremqeb iurembqe iurembeq iuremebq iuremeqb iureeqmb iureeqbm iureemqb
iureembq iureebmq iureebqm iurbeqme iurbeqem iurbemqe iurbemeq iurbeemq iurbeeqm iurbqeme iurbqeem
iurbqmee iurbqmee iurbqeme iurbqeem iurbmqee iurbmqee iurbmeqe iurbmeeq iurbmeeq iurbmeqe iurbeqme
iurbeqem iurbemqe iurbemeq iurbeemq iurbeeqm iurqbeme iurqbeem iurqbmee iurqbmee iurqbeme iurqbeem
iurqebme iurqebem iurqembe iurqemeb iurqeemb iurqeebm iurqmebe iurqmeeb iurqmbee iurqmbee iurqmebe
iurqmeeb iurqeemb iurqeebm iurqemeb iurqembe iurqebme iurqebem iurmbqee iurmbqee iurmbeqe iurmbeeq
iurmbeeq iurmbeqe iurmqbee iurmqbee iurmqebe iurmqeeb iurmqeeb iurmqebe iurmeqbe iurmeqeb iurmebqe
iurmebeq iurmeebq iurmeeqb iurmeqeb iurmeqbe iurmeeqb iurmeebq iurmebeq iurmebqe iurebqme iurebqem
iurebmqe iurebmeq iurebemq iurebeqm iureqbme iureqbem iureqmbe iureqmeb iureqemb iureqebm iuremqbe
iuremqeb iurembqe iurembeq iuremebq iuremeqb iureeqmb iureeqbm iureemqb iureembq iureebmq iureebqm
iuqerbme iuqerbem iuqermbe iuqermeb iuqeremb iuqerebm iuqebrme iuqebrem iuqebmre iuqebmer iuqebemr
iuqeberm iuqembre iuqember iuqemrbe iuqemreb iuqemerb iuqemebr iuqeebmr iuqeebrm iuqeembr iuqeemrb
iuqeermb iuqeerbm iuqrebme iuqrebem iuqrembe iuqremeb iuqreemb iuqreebm iuqrbeme iuqrbeem iuqrbmee
iuqrbmee iuqrbeme iuqrbeem iuqrmbee iuqrmbee iuqrmebe iuqrmeeb iuqrmeeb iuqrmebe iuqrebme iuqrebem
iuqrembe iuqremeb iuqreemb iuqreebm iuqbreme iuqbreem iuqbrmee iuqbrmee iuqbreme iuqbreem iuqberme
iuqberem iuqbemre iuqbemer iuqbeemr iuqbeerm iuqbmere iuqbmeer iuqbmree iuqbmree iuqbmere iuqbmeer
iuqbeemr iuqbeerm iuqbemer iuqbemre iuqberme iuqberem iuqmrbee iuqmrbee iuqmrebe iuqmreeb iuqmreeb
iuqmrebe iuqmbree iuqmbree iuqmbere iuqmbeer iuqmbeer iuqmbere iuqmebre iuqmeber iuqmerbe iuqmereb
iuqmeerb iuqmeebr iuqmeber iuqmebre iuqmeebr iuqmeerb iuqmereb iuqmerbe iuqerbme iuqerbem iuqermbe
iuqermeb iuqeremb iuqerebm iuqebrme iuqebrem iuqebmre iuqebmer iuqebemr iuqeberm iuqembre iuqember
iuqemrbe iuqemreb iuqemerb iuqemebr iuqeebmr iuqeebrm iuqeembr iuqeemrb iuqeermb iuqeerbm iumerqbe
iumerqeb iumerbqe iumerbeq iumerebq iumereqb iumeqrbe iumeqreb iumeqbre iumeqber iumeqebr iumeqerb
iumebqre iumebqer iumebrqe iumebreq iumeberq iumebeqr iumeeqbr iumeeqrb iumeebqr iumeebrq iumeerbq
iumeerqb iumreqbe iumreqeb iumrebqe iumrebeq iumreebq iumreeqb iumrqebe iumrqeeb iumrqbee iumrqbee
iumrqebe iumrqeeb iumrbqee iumrbqee iumrbeqe iumrbeeq iumrbeeq iumrbeqe iumreqbe iumreqeb iumrebqe
iumrebeq iumreebq iumreeqb iumqrebe iumqreeb iumqrbee iumqrbee iumqrebe iumqreeb iumqerbe iumqereb
iumqebre iumqeber iumqeebr iumqeerb iumqbere iumqbeer iumqbree iumqbree iumqbere iumqbeer iumqeebr
iumqeerb iumqeber iumqebre iumqerbe iumqereb iumbrqee iumbrqee iumbreqe iumbreeq iumbreeq iumbreqe
iumbqree iumbqree iumbqere iumbqeer iumbqeer iumbqere iumbeqre iumbeqer iumberqe iumbereq iumbeerq
iumbeeqr iumbeqer iumbeqre iumbeeqr iumbeerq iumbereq iumberqe iumerqbe iumerqeb iumerbqe iumerbeq
iumerebq iumereqb iumeqrbe iumeqreb iumeqbre iumeqber iumeqebr iumeqerb iumebqre iumebqer iumebrqe
iumebreq iumeberq iumebeqr iumeeqbr iumeeqrb iumeebqr iumeebrq iumeerbq iumeerqb iueerqmb iueerqbm
iueermqb iueermbq iueerbmq iueerbqm iueeqrmb iueeqrbm iueeqmrb iueeqmbr iueeqbmr iueeqbrm iueemqrb
iueemqbr iueemrqb iueemrbq iueembrq iueembqr iueebqmr iueebqrm iueebmqr iueebmrq iueebrmq iueebrqm
iuereqmb iuereqbm iueremqb iuerembq iuerebmq iuerebqm iuerqemb iuerqebm iuerqmeb iuerqmbe iuerqbme
iuerqbem iuermqeb iuermqbe iuermeqb iuermebq iuermbeq iuermbqe iuerbqme iuerbqem iuerbmqe iuerbmeq
iuerbemq iuerbeqm iueqremb iueqrebm iueqrmeb iueqrmbe iueqrbme iueqrbem iueqermb iueqerbm iueqemrb
iueqembr iueqebmr iueqebrm iueqmerb iueqmebr iueqmreb iueqmrbe iueqmbre iueqmber iueqbemr iueqberm
iueqbmer iueqbmre iueqbrme iueqbrem iuemrqeb iuemrqbe iuemreqb iuemrebq iuemrbeq iuemrbqe iuemqreb
iuemqrbe iuemqerb iuemqebr iuemqber iuemqbre iuemeqrb iuemeqbr iuemerqb iuemerbq iuemebrq iuemebqr
iuembqer iuembqre iuembeqr iuemberq iuembreq iuembrqe iuebrqme iuebrqem iuebrmqe iuebrmeq iuebremq
iuebreqm iuebqrme iuebqrem iuebqmre iuebqmer iuebqemr iuebqerm iuebmqre iuebmqer iuebmrqe iuebmreq
iuebmerq iuebmeqr iuebeqmr iuebeqrm iuebemqr iuebemrq iuebermq iueberqm ieberqum ieberqmu ieberuqm
ieberumq iebermuq iebermqu iebeqrum iebeqrmu iebequrm iebequmr iebeqmur iebeqmru iebeuqrm iebeuqmr
iebeurqm iebeurmq iebeumrq iebeumqr iebemqur iebemqru iebemuqr iebemurq iebemruq iebemrqu iebrequm
iebreqmu iebreuqm iebreumq iebremuq iebremqu iebrqeum iebrqemu iebrquem iebrqume iebrqmue iebrqmeu
iebruqem iebruqme iebrueqm iebruemq iebrumeq iebrumqe iebrmque iebrmqeu iebrmuqe iebrmueq iebrmeuq
iebrmequ iebqreum iebqremu iebqruem iebqrume iebqrmue iebqrmeu iebqerum iebqermu iebqeurm iebqeumr
iebqemur iebqemru iebquerm iebquemr iebqurem iebqurme iebqumre iebqumer iebqmeur iebqmeru iebqmuer
iebqmure iebqmrue iebqmreu ieburqem ieburqme iebureqm ieburemq ieburmeq ieburmqe iebuqrem iebuqrme
iebuqerm iebuqemr iebuqmer iebuqmre iebueqrm iebueqmr iebuerqm iebuermq iebuemrq iebuemqr iebumqer
iebumqre iebumeqr iebumerq iebumreq iebumrqe iebmrque iebmrqeu iebmruqe iebmrueq iebmreuq iebmrequ
iebmqrue iebmqreu iebmqure iebmquer iebmqeur iebmqeru iebmuqre iebmuqer iebmurqe iebmureq iebmuerq
iebmueqr iebmequr iebmeqru iebmeuqr iebmeurq iebmeruq iebmerqu ieebrqum ieebrqmu ieebruqm ieebrumq
ieebrmuq ieebrmqu ieebqrum ieebqrmu ieebqurm ieebqumr ieebqmur ieebqmru ieebuqrm ieebuqmr ieeburqm
ieeburmq ieebumrq ieebumqr ieebmqur ieebmqru ieebmuqr ieebmurq ieebmruq ieebmrqu ieerbqum ieerbqmu
ieerbuqm ieerbumq ieerbmuq ieerbmqu ieerqbum ieerqbmu ieerqubm ieerqumb ieerqmub ieerqmbu ieeruqbm
ieeruqmb ieerubqm ieerubmq ieerumbq ieerumqb ieermqub ieermqbu ieermuqb ieermubq ieermbuq ieermbqu
ieeqrbum ieeqrbmu ieeqrubm ieeqrumb ieeqrmub ieeqrmbu ieeqbrum ieeqbrmu ieeqburm ieeqbumr ieeqbmur
ieeqbmru ieequbrm ieequbmr ieequrbm ieequrmb ieequmrb ieequmbr ieeqmbur ieeqmbru ieeqmubr ieeqmurb
ieeqmrub ieeqmrbu ieeurqbm ieeurqmb ieeurbqm ieeurbmq ieeurmbq ieeurmqb ieeuqrbm ieeuqrmb ieeuqbrm
ieeuqbmr ieeuqmbr ieeuqmrb ieeubqrm ieeubqmr ieeubrqm ieeubrmq ieeubmrq ieeubmqr ieeumqbr ieeumqrb
ieeumbqr ieeumbrq ieeumrbq ieeumrqb ieemrqub ieemrqbu ieemruqb ieemrubq ieemrbuq ieemrbqu ieemqrub
ieemqrbu ieemqurb ieemqubr ieemqbur ieemqbru ieemuqrb ieemuqbr ieemurqb ieemurbq ieemubrq ieemubqr
ieembqur ieembqru ieembuqr ieemburq ieembruq ieembrqu ierebqum ierebqmu ierebuqm ierebumq ierebmuq
ierebmqu iereqbum iereqbmu ierequbm ierequmb iereqmub iereqmbu iereuqbm iereuqmb iereubqm iereubmq
iereumbq iereumqb ieremqub ieremqbu ieremuqb ieremubq ierembuq ierembqu ierbequm ierbeqmu ierbeuqm
ierbeumq ierbemuq ierbemqu ierbqeum ierbqemu ierbquem ierbqume ierbqmue ierbqmeu ierbuqem ierbuqme
ierbueqm ierbuemq ierbumeq ierbumqe ierbmque ierbmqeu ierbmuqe ierbmueq ierbmeuq ierbmequ ierqbeum
ierqbemu ierqbuem ierqbume ierqbmue ierqbmeu ierqebum ierqebmu ierqeubm ierqeumb ierqemub ierqembu
ierquebm ierquemb ierqubem ierqubme ierqumbe ierqumeb ierqmeub ierqmebu ierqmueb ierqmube ierqmbue
ierqmbeu ierubqem ierubqme ierubeqm ierubemq ierubmeq ierubmqe ieruqbem ieruqbme ieruqebm ieruqemb
ieruqmeb ieruqmbe ierueqbm ierueqmb ieruebqm ieruebmq ieruembq ieruemqb ierumqeb ierumqbe ierumeqb
ierumebq ierumbeq ierumbqe iermbque iermbqeu iermbuqe iermbueq iermbeuq iermbequ iermqbue iermqbeu
iermqube iermqueb iermqeub iermqebu iermuqbe iermuqeb iermubqe iermubeq iermuebq iermueqb iermequb
iermeqbu iermeuqb iermeubq iermebuq iermebqu ieqerbum ieqerbmu ieqerubm ieqerumb ieqermub ieqermbu
ieqebrum ieqebrmu ieqeburm ieqebumr ieqebmur ieqebmru ieqeubrm ieqeubmr ieqeurbm ieqeurmb ieqeumrb
ieqeumbr ieqembur ieqembru ieqemubr ieqemurb ieqemrub ieqemrbu ieqrebum ieqrebmu ieqreubm ieqreumb
ieqremub ieqrembu ieqrbeum ieqrbemu ieqrbuem ieqrbume ieqrbmue ieqrbmeu ieqrubem ieqrubme ieqruebm
ieqruemb ieqrumeb ieqrumbe ieqrmbue ieqrmbeu ieqrmube ieqrmueb ieqrmeub ieqrmebu ieqbreum ieqbremu
ieqbruem ieqbrume ieqbrmue ieqbrmeu ieqberum ieqbermu ieqbeurm ieqbeumr ieqbemur ieqbemru ieqbuerm
ieqbuemr ieqburem ieqburme ieqbumre ieqbumer ieqbmeur ieqbmeru ieqbmuer ieqbmure ieqbmrue ieqbmreu
iequrbem iequrbme iequrebm iequremb iequrmeb iequrmbe iequbrem iequbrme iequberm iequbemr iequbmer
iequbmre iequebrm iequebmr iequerbm iequermb iequemrb iequembr iequmber iequmbre iequmebr iequmerb
iequmreb iequmrbe ieqmrbue ieqmrbeu ieqmrube ieqmrueb ieqmreub ieqmrebu ieqmbrue ieqmbreu ieqmbure
ieqmbuer ieqmbeur ieqmberu ieqmubre ieqmuber ieqmurbe ieqmureb ieqmuerb ieqmuebr ieqmebur ieqmebru
ieqmeubr ieqmeurb ieqmerub ieqmerbu ieuerqbm ieuerqmb ieuerbqm ieuerbmq ieuermbq ieuermqb ieueqrbm
ieueqrmb ieueqbrm ieueqbmr ieueqmbr ieueqmrb ieuebqrm ieuebqmr ieuebrqm ieuebrmq ieuebmrq ieuebmqr
ieuemqbr ieuemqrb ieuembqr ieuembrq ieuemrbq ieuemrqb ieureqbm ieureqmb ieurebqm ieurebmq ieurembq
ieuremqb ieurqebm ieurqemb ieurqbem ieurqbme ieurqmbe ieurqmeb ieurbqem ieurbqme ieurbeqm ieurbemq
ieurbmeq ieurbmqe ieurmqbe ieurmqeb ieurmbqe ieurmbeq ieurmebq ieurmeqb ieuqrebm ieuqremb ieuqrbem
ieuqrbme ieuqrmbe ieuqrmeb ieuqerbm ieuqermb ieuqebrm ieuqebmr ieuqembr ieuqemrb ieuqberm ieuqbemr
ieuqbrem ieuqbrme ieuqbmre ieuqbmer ieuqmebr ieuqmerb ieuqmber ieuqmbre ieuqmrbe ieuqmreb ieubrqem
ieubrqme ieubreqm ieubremq ieubrmeq ieubrmqe ieubqrem ieubqrme ieubqerm ieubqemr ieubqmer ieubqmre
ieubeqrm ieubeqmr ieuberqm ieubermq ieubemrq ieubemqr ieubmqer ieubmqre ieubmeqr ieubmerq ieubmreq
ieubmrqe ieumrqbe ieumrqeb ieumrbqe ieumrbeq ieumrebq ieumreqb ieumqrbe ieumqreb ieumqbre ieumqber
ieumqebr ieumqerb ieumbqre ieumbqer ieumbrqe ieumbreq ieumberq ieumbeqr ieumeqbr ieumeqrb ieumebqr
ieumebrq ieumerbq ieumerqb iemerqub iemerqbu iemeruqb iemerubq iemerbuq iemerbqu iemeqrub iemeqrbu
iemequrb iemequbr iemeqbur iemeqbru iemeuqrb iemeuqbr iemeurqb iemeurbq iemeubrq iemeubqr iemebqur
iemebqru iemebuqr iemeburq iemebruq iemebrqu iemrequb iemreqbu iemreuqb iemreubq iemrebuq iemrebqu
iemrqeub iemrqebu iemrqueb iemrqube iemrqbue iemrqbeu iemruqeb iemruqbe iemrueqb iemruebq iemrubeq
iemrubqe iemrbque iemrbqeu iemrbuqe iemrbueq iemrbeuq iemrbequ iemqreub iemqrebu iemqrueb iemqrube
iemqrbue iemqrbeu iemqerub iemqerbu iemqeurb iemqeubr iemqebur iemqebru iemquerb iemquebr iemqureb
iemqurbe iemqubre iemquber iemqbeur iemqberu iemqbuer iemqbure iemqbrue iemqbreu iemurqeb iemurqbe
iemureqb iemurebq iemurbeq iemurbqe iemuqreb iemuqrbe iemuqerb iemuqebr iemuqber iemuqbre iemueqrb
iemueqbr iemuerqb iemuerbq iemuebrq iemuebqr iemubqer iemubqre iemubeqr iemuberq iemubreq iemubrqe
iembrque iembrqeu iembruqe iembrueq iembreuq iembrequ iembqrue iembqreu iembqure iembquer iembqeur
iembqeru iembuqre iembuqer iemburqe iembureq iembuerq iembueqr iembequr iembeqru iembeuqr iembeurq
iemberuq iemberqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us