easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

ereptus

arsissemusque

wedset

iuvavimus

netherstone

distending

reene

flagitavistis

parallepipedous

waiving

precorrect

lobotomize

hogherd

radical

aggero

delafose

flagitavero

combines


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: iactantaque
cipher variations:
jbduboubrvf kcevcpvcswg ldfwdqwdtxh megxerxeuyi nfhyfsyfvzj
ogizgtzgwak phjahuahxbl qikbivbiycm rjlcjwcjzdn skmdkxdkaeo
tlnelyelbfp umofmzfmcgq vnpgnagndhr woqhobhoeis xpripcipfjt
yqsjqdjqgku zrtkrekrhlv asulsflsimw btvmtgmtjnx cuwnuhnukoy
dvxoviovlpz ewypwjpwmqa fxzqxkqxnrb gyarylryosc hzbszmszptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: iactantaque
Cipher: rzxgzmgzjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: iactantaque
Cipher: ABAAA AAAAA AAABA BAABA AAAAA ABBAA BAABA AAAAA ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: iactantaque
cipher variations:
jbduboubrvfzbhgbogbxjnpblsbosbdxvfbpeboebjldvbtqboqbpzllbxcbocbvntrbfaboabhpjhbjmbombndr
xbnyboybtrznbrkbokbzfhdbvwbowbftptbziboiblhxkcevcpvcswgacihcphcykoqcmtcptceywgcqfcpfckme
wcurcprcqammcydcpdcwouscgbcpbciqkickncpncoesycozcpzcusaocslcplcagiecwxcpxcguqucajcpjcmiy
ldfwdqwdtxhbdjidqidzlprdnudqudfzxhdrgdqgdlnfxdvsdqsdrbnndzedqedxpvtdhcdqcdjrljdlodqodpft
zdpadqadvtbpdtmdqmdbhjfdxydqydhvrvdbkdqkdnjzmegxerxeuyicekjerjeamqseovervegayiesherhemog
yewtertescooeaferfeyqwueiderdeksmkemperpeqguaeqberbewucqeunernecikgeyzerzeiwsweclerleoka
nfhyfsyfvzjdflkfskfbnrtfpwfswfhbzjftifsifnphzfxufsuftdppfbgfsgfzrxvfjefsefltnlfnqfsqfrhv
bfrcfscfxvdrfvofsofdjlhfzafsafjxtxfdmfsmfplbogizgtzgwakegmlgtlgcosugqxgtxgicakgujgtjgoqi
agyvgtvgueqqgchgthgasywgkfgtfgmuomgorgtrgsiwcgsdgtdgywesgwpgtpgekmigabgtbgkyuygengtngqmc
phjahuahxblfhnmhumhdptvhryhuyhjdblhvkhukhprjbhzwhuwhvfrrhdihuihbtzxhlghughnvpnhpshushtjx
dhtehuehzxfthxqhuqhflnjhbchuchlzvzhfohuohrndqikbivbiycmgionivniequwiszivzikecmiwlivliqsk
ciaxivxiwgssiejivjicuayimhivhiowqoiqtivtiukyeiufivfiayguiyrivrigmokicdivdimawaigpivpisoe
rjlcjwcjzdnhjpojwojfrvxjtajwajlfdnjxmjwmjrtldjbyjwyjxhttjfkjwkjdvbzjnijwijpxrpjrujwujvlz
fjvgjwgjbzhvjzsjwsjhnpljdejwejnbxbjhqjwqjtpfskmdkxdkaeoikqpkxpkgswykubkxbkmgeokynkxnksum
ekczkxzkyiuukglkxlkewcakojkxjkqysqksvkxvkwmagkwhkxhkcaiwkatkxtkioqmkefkxfkocyckirkxrkuqg
tlnelyelbfpjlrqlyqlhtxzlvclyclnhfplzolyoltvnfldalyalzjvvlhmlymlfxdblpklyklrztrltwlywlxnb
hlxilyildbjxlbulyuljprnlfglyglpdzdljslyslvrhumofmzfmcgqkmsrmzrmiuyamwdmzdmoigqmapmzpmuwo
gmebmzbmakwwminmznmgyecmqlmzlmsausmuxmzxmyocimyjmzjmeckymcvmzvmkqsomghmzhmqeaemktmztmwsi
vnpgnagndhrlntsnasnjvzbnxenaenpjhrnbqnaqnvxphnfcnacnblxxnjonaonhzfdnrmnamntbvtnvynaynzpd
jnzknaknfdlzndwnawnlrtpnhinainrfbfnlunaunxtjwoqhobhoeismoutobtokwacoyfobfoqkisocrobrowyq
iogdobdocmyyokpobpoiageosnobnoucwuowzobzoaqekoaloblogemaoexobxomsuqoijobjosgcgomvobvoyuk
xpripcipfjtnpvupcuplxbdpzgpcgprljtpdspcspxzrjphepcepdnzzplqpcqpjbhfptopcopvdxvpxapcapbrf
lpbmpcmphfnbpfypcypntvrpjkpckpthdhpnwpcwpzvlyqsjqdjqgkuoqwvqdvqmyceqahqdhqsmkuqetqdtqyas
kqifqdfqeoaaqmrqdrqkcigqupqdpqweywqybqdbqcsgmqcnqdnqigocqgzqdzqouwsqklqdlquieiqoxqdxqawm
zrtkrekrhlvprxwrewrnzdfrbireirtnlvrfureurzbtlrjgregrfpbbrnsresrldjhrvqreqrxfzxrzcrecrdth
nrdoreorjhpdrharearpvxtrlmremrvjfjrpyreyrbxnasulsflsimwqsyxsfxsoaegscjsfjsuomwsgvsfvsacu
mskhsfhsgqccsotsftsmekiswrsfrsygaysadsfdseuiosepsfpskiqesibsfbsqwyusmnsfnswkgksqzsfzscyo
btvmtgmtjnxrtzytgytpbfhtdktgktvpnxthwtgwtbdvntlitgithrddtputgutnfljtxstgstzhbztbetgetfvj
ptfqtgqtljrftjctgctrxzvtnotgotxlhltratgatdzpcuwnuhnukoysuazuhzuqcgiueluhluwqoyuixuhxucew
oumjuhjuiseeuqvuhvuogmkuytuhtuaicaucfuhfugwkqugruhrumksgukduhdusyawuopuhpuymimusbuhbueaq
dvxoviovlpztvbaviavrdhjvfmvimvxrpzvjyviyvdfxpvnkvikvjtffvrwviwvphnlvzuviuvbjdbvdgvigvhxl
rvhsvisvnlthvlevievtzbxvpqviqvznjnvtcvicvfbrewypwjpwmqauwcbwjbwseikwgnwjnwysqawkzwjzwegy
qwolwjlwkuggwsxwjxwqiomwavwjvwckecwehwjhwiymswitwjtwomuiwmfwjfwuacywqrwjrwaokowudwjdwgcs
fxzqxkqxnrbvxdcxkcxtfjlxhoxkoxztrbxlaxkaxfhzrxpmxkmxlvhhxtyxkyxrjpnxbwxkwxdlfdxfixkixjzn
txjuxkuxpnvjxngxkgxvbdzxrsxksxbplpxvexkexhdtgyarylryoscwyedyldyugkmyipylpyauscymbylbygia
syqnylnymwiiyuzylzyskqoycxylxyemgeygjyljykaouykvylvyqowkyohylhywceaystyltycqmqywfylfyieu
hzbszmszptdxzfezmezvhlnzjqzmqzbvtdznczmczhjbtzrozmoznxjjzvazmaztlrpzdyzmyzfnhfzhkzmkzlbp
vzlwzmwzrpxlzpizmizxdfbztuzmuzdrnrzxgzmgzjfviactantaqueyagfanfawimoakranracwueaodandaikc
uaspanpaoykkawbanbaumsqaezanzagoigailanlamcqwamxanxasqymaqjanjayegcauvanvaesosayhanhakgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: iactantaque
Cipher: vnpgnagndhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: iactantaque
Cipher: 4211314411334411145451

Extended Methods:
Method #1

Plaintext: iactantaque
method variations:
ofhyfsyfvzktlndlxdlaepyqsiqciqfkudvxovhovlpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
i a c t a n t a q u e 
4 1 3 4 1 3 4 1 1 5 5 
2 1 1 4 1 3 4 1 4 4 1 
They are then read out in rows:
4134134115521141341441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: iactantaque
Cipher: dsldvkadsqd

Read more ...
Method #3

Plaintext: iactantaque
method variations:
blqdlsdayyq lqdlsdayyqb qdlsdayyqbl
dlsdayyqblq lsdayyqblqd sdayyqblqdl
dayyqblqdls ayyqblqdlsd yyqblqdlsda
yqblqdlsday qblqdlsdayy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: iactantaque

first 5040 cipher variations(39615626 total)
iactantaque iactantaqeu iactantauqe iactantaueq iactantaeuq iactantaequ iactantqaue iactantqaeu iactantquae iactantquea
iactantqeua iactantqeau iactantuqae iactantuqea iactantuaqe iactantuaeq iactantueaq iactantueqa iactantequa iactanteqau
iactanteuqa iactanteuaq iactanteauq iactanteaqu iactanatque iactanatqeu iactanatuqe iactanatueq iactanateuq iactanatequ
iactanaqtue iactanaqteu iactanaqute iactanaquet iactanaqeut iactanaqetu iactanauqte iactanauqet iactanautqe iactanauteq
iactanauetq iactanaueqt iactanaequt iactanaeqtu iactanaeuqt iactanaeutq iactanaetuq iactanaetqu iactanqatue iactanqateu
iactanqaute iactanqauet iactanqaeut iactanqaetu iactanqtaue iactanqtaeu iactanqtuae iactanqtuea iactanqteua iactanqteau
iactanqutae iactanqutea iactanquate iactanquaet iactanqueat iactanqueta iactanqetua iactanqetau iactanqeuta iactanqeuat
iactanqeaut iactanqeatu iactanuaqte iactanuaqet iactanuatqe iactanuateq iactanuaetq iactanuaeqt iactanuqate iactanuqaet
iactanuqtae iactanuqtea iactanuqeta iactanuqeat iactanutqae iactanutqea iactanutaqe iactanutaeq iactanuteaq iactanuteqa
iactanueqta iactanueqat iactanuetqa iactanuetaq iactanueatq iactanueaqt iactaneaqut iactaneaqtu iactaneauqt iactaneautq
iactaneatuq iactaneatqu iactaneqaut iactaneqatu iactanequat iactanequta iactaneqtua iactaneqtau iactaneuqat iactaneuqta
iactaneuaqt iactaneuatq iactaneutaq iactaneutqa iactanetqua iactanetqau iactanetuqa iactanetuaq iactanetauq iactanetaqu
iactatnaque iactatnaqeu iactatnauqe iactatnaueq iactatnaeuq iactatnaequ iactatnqaue iactatnqaeu iactatnquae iactatnquea
iactatnqeua iactatnqeau iactatnuqae iactatnuqea iactatnuaqe iactatnuaeq iactatnueaq iactatnueqa iactatnequa iactatneqau
iactatneuqa iactatneuaq iactatneauq iactatneaqu iactatanque iactatanqeu iactatanuqe iactatanueq iactataneuq iactatanequ
iactataqnue iactataqneu iactataqune iactataquen iactataqeun iactataqenu iactatauqne iactatauqen iactataunqe iactatauneq
iactatauenq iactataueqn iactataequn iactataeqnu iactataeuqn iactataeunq iactataenuq iactataenqu iactatqanue iactatqaneu
iactatqaune iactatqauen iactatqaeun iactatqaenu iactatqnaue iactatqnaeu iactatqnuae iactatqnuea iactatqneua iactatqneau
iactatqunae iactatqunea iactatquane iactatquaen iactatquean iactatquena iactatqenua iactatqenau iactatqeuna iactatqeuan
iactatqeaun iactatqeanu iactatuaqne iactatuaqen iactatuanqe iactatuaneq iactatuaenq iactatuaeqn iactatuqane iactatuqaen
iactatuqnae iactatuqnea iactatuqena iactatuqean iactatunqae iactatunqea iactatunaqe iactatunaeq iactatuneaq iactatuneqa
iactatueqna iactatueqan iactatuenqa iactatuenaq iactatueanq iactatueaqn iactateaqun iactateaqnu iactateauqn iactateaunq
iactateanuq iactateanqu iactateqaun iactateqanu iactatequan iactatequna iactateqnua iactateqnau iactateuqan iactateuqna
iactateuaqn iactateuanq iactateunaq iactateunqa iactatenqua iactatenqau iactatenuqa iactatenuaq iactatenauq iactatenaqu
iactaatnque iactaatnqeu iactaatnuqe iactaatnueq iactaatneuq iactaatnequ iactaatqnue iactaatqneu iactaatqune iactaatquen
iactaatqeun iactaatqenu iactaatuqne iactaatuqen iactaatunqe iactaatuneq iactaatuenq iactaatueqn iactaatequn iactaateqnu
iactaateuqn iactaateunq iactaatenuq iactaatenqu iactaantque iactaantqeu iactaantuqe iactaantueq iactaanteuq iactaantequ
iactaanqtue iactaanqteu iactaanqute iactaanquet iactaanqeut iactaanqetu iactaanuqte iactaanuqet iactaanutqe iactaanuteq
iactaanuetq iactaanueqt iactaanequt iactaaneqtu iactaaneuqt iactaaneutq iactaanetuq iactaanetqu iactaaqntue iactaaqnteu
iactaaqnute iactaaqnuet iactaaqneut iactaaqnetu iactaaqtnue iactaaqtneu iactaaqtune iactaaqtuen iactaaqteun iactaaqtenu
iactaaqutne iactaaquten iactaaqunte iactaaqunet iactaaquent iactaaquetn iactaaqetun iactaaqetnu iactaaqeutn iactaaqeunt
iactaaqenut iactaaqentu iactaaunqte iactaaunqet iactaauntqe iactaaunteq iactaaunetq iactaauneqt iactaauqnte iactaauqnet
iactaauqtne iactaauqten iactaauqetn iactaauqent iactaautqne iactaautqen iactaautnqe iactaautneq iactaautenq iactaauteqn
iactaaueqtn iactaaueqnt iactaauetqn iactaauetnq iactaauentq iactaauenqt iactaaenqut iactaaenqtu iactaaenuqt iactaaenutq
iactaaentuq iactaaentqu iactaaeqnut iactaaeqntu iactaaequnt iactaaequtn iactaaeqtun iactaaeqtnu iactaaeuqnt iactaaeuqtn
iactaaeunqt iactaaeuntq iactaaeutnq iactaaeutqn iactaaetqun iactaaetqnu iactaaetuqn iactaaetunq iactaaetnuq iactaaetnqu
iactaqtanue iactaqtaneu iactaqtaune iactaqtauen iactaqtaeun iactaqtaenu iactaqtnaue iactaqtnaeu iactaqtnuae iactaqtnuea
iactaqtneua iactaqtneau iactaqtunae iactaqtunea iactaqtuane iactaqtuaen iactaqtuean iactaqtuena iactaqtenua iactaqtenau
iactaqteuna iactaqteuan iactaqteaun iactaqteanu iactaqatnue iactaqatneu iactaqatune iactaqatuen iactaqateun iactaqatenu
iactaqantue iactaqanteu iactaqanute iactaqanuet iactaqaneut iactaqanetu iactaqaunte iactaqaunet iactaqautne iactaqauten
iactaqauetn iactaqauent iactaqaenut iactaqaentu iactaqaeunt iactaqaeutn iactaqaetun iactaqaetnu iactaqnatue iactaqnateu
iactaqnaute iactaqnauet iactaqnaeut iactaqnaetu iactaqntaue iactaqntaeu iactaqntuae iactaqntuea iactaqnteua iactaqnteau
iactaqnutae iactaqnutea iactaqnuate iactaqnuaet iactaqnueat iactaqnueta iactaqnetua iactaqnetau iactaqneuta iactaqneuat
iactaqneaut iactaqneatu iactaquante iactaquanet iactaquatne iactaquaten iactaquaetn iactaquaent iactaqunate iactaqunaet
iactaquntae iactaquntea iactaquneta iactaquneat iactaqutnae iactaqutnea iactaqutane iactaqutaen iactaqutean iactaqutena
iactaquenta iactaquenat iactaquetna iactaquetan iactaqueatn iactaqueant iactaqeanut iactaqeantu iactaqeaunt iactaqeautn
iactaqeatun iactaqeatnu iactaqenaut iactaqenatu iactaqenuat iactaqenuta iactaqentua iactaqentau iactaqeunat iactaqeunta
iactaqeuant iactaqeuatn iactaqeutan iactaqeutna iactaqetnua iactaqetnau iactaqetuna iactaqetuan iactaqetaun iactaqetanu
iactautaqne iactautaqen iactautanqe iactautaneq iactautaenq iactautaeqn iactautqane iactautqaen iactautqnae iactautqnea
iactautqena iactautqean iactautnqae iactautnqea iactautnaqe iactautnaeq iactautneaq iactautneqa iactauteqna iactauteqan
iactautenqa iactautenaq iactauteanq iactauteaqn iactauatqne iactauatqen iactauatnqe iactauatneq iactauatenq iactauateqn
iactauaqtne iactauaqten iactauaqnte iactauaqnet iactauaqent iactauaqetn iactauanqte iactauanqet iactauantqe iactauanteq
iactauanetq iactauaneqt iactauaeqnt iactauaeqtn iactauaenqt iactauaentq iactauaetnq iactauaetqn iactauqatne iactauqaten
iactauqante iactauqanet iactauqaent iactauqaetn iactauqtane iactauqtaen iactauqtnae iactauqtnea iactauqtena iactauqtean
iactauqntae iactauqntea iactauqnate iactauqnaet iactauqneat iactauqneta iactauqetna iactauqetan iactauqenta iactauqenat
iactauqeant iactauqeatn iactaunaqte iactaunaqet iactaunatqe iactaunateq iactaunaetq iactaunaeqt iactaunqate iactaunqaet
iactaunqtae iactaunqtea iactaunqeta iactaunqeat iactauntqae iactauntqea iactauntaqe iactauntaeq iactaunteaq iactaunteqa
iactauneqta iactauneqat iactaunetqa iactaunetaq iactauneatq iactauneaqt iactaueaqnt iactaueaqtn iactaueanqt iactaueantq
iactaueatnq iactaueatqn iactaueqant iactaueqatn iactaueqnat iactaueqnta iactaueqtna iactaueqtan iactauenqat iactauenqta
iactauenaqt iactauenatq iactauentaq iactauentqa iactauetqna iactauetqan iactauetnqa iactauetnaq iactauetanq iactauetaqn
iactaetaqun iactaetaqnu iactaetauqn iactaetaunq iactaetanuq iactaetanqu iactaetqaun iactaetqanu iactaetquan iactaetquna
iactaetqnua iactaetqnau iactaetuqan iactaetuqna iactaetuaqn iactaetuanq iactaetunaq iactaetunqa iactaetnqua iactaetnqau
iactaetnuqa iactaetnuaq iactaetnauq iactaetnaqu iactaeatqun iactaeatqnu iactaeatuqn iactaeatunq iactaeatnuq iactaeatnqu
iactaeaqtun iactaeaqtnu iactaeaqutn iactaeaqunt iactaeaqnut iactaeaqntu iactaeauqtn iactaeauqnt iactaeautqn iactaeautnq
iactaeauntq iactaeaunqt iactaeanqut iactaeanqtu iactaeanuqt iactaeanutq iactaeantuq iactaeantqu iactaeqatun iactaeqatnu
iactaeqautn iactaeqaunt iactaeqanut iactaeqantu iactaeqtaun iactaeqtanu iactaeqtuan iactaeqtuna iactaeqtnua iactaeqtnau
iactaequtan iactaequtna iactaequatn iactaequant iactaequnat iactaequnta iactaeqntua iactaeqntau iactaeqnuta iactaeqnuat
iactaeqnaut iactaeqnatu iactaeuaqtn iactaeuaqnt iactaeuatqn iactaeuatnq iactaeuantq iactaeuanqt iactaeuqatn iactaeuqant
iactaeuqtan iactaeuqtna iactaeuqnta iactaeuqnat iactaeutqan iactaeutqna iactaeutaqn iactaeutanq iactaeutnaq iactaeutnqa
iactaeunqta iactaeunqat iactaeuntqa iactaeuntaq iactaeunatq iactaeunaqt iactaenaqut iactaenaqtu iactaenauqt iactaenautq
iactaenatuq iactaenatqu iactaenqaut iactaenqatu iactaenquat iactaenquta iactaenqtua iactaenqtau iactaenuqat iactaenuqta
iactaenuaqt iactaenuatq iactaenutaq iactaenutqa iactaentqua iactaentqau iactaentuqa iactaentuaq iactaentauq iactaentaqu
iactnataque iactnataqeu iactnatauqe iactnataueq iactnataeuq iactnataequ iactnatqaue iactnatqaeu iactnatquae iactnatquea
iactnatqeua iactnatqeau iactnatuqae iactnatuqea iactnatuaqe iactnatuaeq iactnatueaq iactnatueqa iactnatequa iactnateqau
iactnateuqa iactnateuaq iactnateauq iactnateaqu iactnaatque iactnaatqeu iactnaatuqe iactnaatueq iactnaateuq iactnaatequ
iactnaaqtue iactnaaqteu iactnaaqute iactnaaquet iactnaaqeut iactnaaqetu iactnaauqte iactnaauqet iactnaautqe iactnaauteq
iactnaauetq iactnaaueqt iactnaaequt iactnaaeqtu iactnaaeuqt iactnaaeutq iactnaaetuq iactnaaetqu iactnaqatue iactnaqateu
iactnaqaute iactnaqauet iactnaqaeut iactnaqaetu iactnaqtaue iactnaqtaeu iactnaqtuae iactnaqtuea iactnaqteua iactnaqteau
iactnaqutae iactnaqutea iactnaquate iactnaquaet iactnaqueat iactnaqueta iactnaqetua iactnaqetau iactnaqeuta iactnaqeuat
iactnaqeaut iactnaqeatu iactnauaqte iactnauaqet iactnauatqe iactnauateq iactnauaetq iactnauaeqt iactnauqate iactnauqaet
iactnauqtae iactnauqtea iactnauqeta iactnauqeat iactnautqae iactnautqea iactnautaqe iactnautaeq iactnauteaq iactnauteqa
iactnaueqta iactnaueqat iactnauetqa iactnauetaq iactnaueatq iactnaueaqt iactnaeaqut iactnaeaqtu iactnaeauqt iactnaeautq
iactnaeatuq iactnaeatqu iactnaeqaut iactnaeqatu iactnaequat iactnaequta iactnaeqtua iactnaeqtau iactnaeuqat iactnaeuqta
iactnaeuaqt iactnaeuatq iactnaeutaq iactnaeutqa iactnaetqua iactnaetqau iactnaetuqa iactnaetuaq iactnaetauq iactnaetaqu
iactntaaque iactntaaqeu iactntaauqe iactntaaueq iactntaaeuq iactntaaequ iactntaqaue iactntaqaeu iactntaquae iactntaquea
iactntaqeua iactntaqeau iactntauqae iactntauqea iactntauaqe iactntauaeq iactntaueaq iactntaueqa iactntaequa iactntaeqau
iactntaeuqa iactntaeuaq iactntaeauq iactntaeaqu iactntaaque iactntaaqeu iactntaauqe iactntaaueq iactntaaeuq iactntaaequ
iactntaqaue iactntaqaeu iactntaquae iactntaquea iactntaqeua iactntaqeau iactntauqae iactntauqea iactntauaqe iactntauaeq
iactntaueaq iactntaueqa iactntaequa iactntaeqau iactntaeuqa iactntaeuaq iactntaeauq iactntaeaqu iactntqaaue iactntqaaeu
iactntqauae iactntqauea iactntqaeua iactntqaeau iactntqaaue iactntqaaeu iactntqauae iactntqauea iactntqaeua iactntqaeau
iactntquaae iactntquaea iactntquaae iactntquaea iactntqueaa iactntqueaa iactntqeaua iactntqeaau iactntqeuaa iactntqeuaa
iactntqeaua iactntqeaau iactntuaqae iactntuaqea iactntuaaqe iactntuaaeq iactntuaeaq iactntuaeqa iactntuqaae iactntuqaea
iactntuqaae iactntuqaea iactntuqeaa iactntuqeaa iactntuaqae iactntuaqea iactntuaaqe iactntuaaeq iactntuaeaq iactntuaeqa
iactntueqaa iactntueqaa iactntueaqa iactntueaaq iactntueaaq iactntueaqa iactnteaqua iactnteaqau iactnteauqa iactnteauaq
iactnteaauq iactnteaaqu iactnteqaua iactnteqaau iactntequaa iactntequaa iactnteqaua iactnteqaau iactnteuqaa iactnteuqaa
iactnteuaqa iactnteuaaq iactnteuaaq iactnteuaqa iactnteaqua iactnteaqau iactnteauqa iactnteauaq iactnteaauq iactnteaaqu
iactnataque iactnataqeu iactnatauqe iactnataueq iactnataeuq iactnataequ iactnatqaue iactnatqaeu iactnatquae iactnatquea
iactnatqeua iactnatqeau iactnatuqae iactnatuqea iactnatuaqe iactnatuaeq iactnatueaq iactnatueqa iactnatequa iactnateqau
iactnateuqa iactnateuaq iactnateauq iactnateaqu iactnaatque iactnaatqeu iactnaatuqe iactnaatueq iactnaateuq iactnaatequ
iactnaaqtue iactnaaqteu iactnaaqute iactnaaquet iactnaaqeut iactnaaqetu iactnaauqte iactnaauqet iactnaautqe iactnaauteq
iactnaauetq iactnaaueqt iactnaaequt iactnaaeqtu iactnaaeuqt iactnaaeutq iactnaaetuq iactnaaetqu iactnaqatue iactnaqateu
iactnaqaute iactnaqauet iactnaqaeut iactnaqaetu iactnaqtaue iactnaqtaeu iactnaqtuae iactnaqtuea iactnaqteua iactnaqteau
iactnaqutae iactnaqutea iactnaquate iactnaquaet iactnaqueat iactnaqueta iactnaqetua iactnaqetau iactnaqeuta iactnaqeuat
iactnaqeaut iactnaqeatu iactnauaqte iactnauaqet iactnauatqe iactnauateq iactnauaetq iactnauaeqt iactnauqate iactnauqaet
iactnauqtae iactnauqtea iactnauqeta iactnauqeat iactnautqae iactnautqea iactnautaqe iactnautaeq iactnauteaq iactnauteqa
iactnaueqta iactnaueqat iactnauetqa iactnauetaq iactnaueatq iactnaueaqt iactnaeaqut iactnaeaqtu iactnaeauqt iactnaeautq
iactnaeatuq iactnaeatqu iactnaeqaut iactnaeqatu iactnaequat iactnaequta iactnaeqtua iactnaeqtau iactnaeuqat iactnaeuqta
iactnaeuaqt iactnaeuatq iactnaeutaq iactnaeutqa iactnaetqua iactnaetqau iactnaetuqa iactnaetuaq iactnaetauq iactnaetaqu
iactnqtaaue iactnqtaaeu iactnqtauae iactnqtauea iactnqtaeua iactnqtaeau iactnqtaaue iactnqtaaeu iactnqtauae iactnqtauea
iactnqtaeua iactnqtaeau iactnqtuaae iactnqtuaea iactnqtuaae iactnqtuaea iactnqtueaa iactnqtueaa iactnqteaua iactnqteaau
iactnqteuaa iactnqteuaa iactnqteaua iactnqteaau iactnqataue iactnqataeu iactnqatuae iactnqatuea iactnqateua iactnqateau
iactnqaatue iactnqaateu iactnqaaute iactnqaauet iactnqaaeut iactnqaaetu iactnqauate iactnqauaet iactnqautae iactnqautea
iactnqaueta iactnqaueat iactnqaeaut iactnqaeatu iactnqaeuat iactnqaeuta iactnqaetua iactnqaetau iactnqaatue iactnqaateu
iactnqaaute iactnqaauet iactnqaaeut iactnqaaetu iactnqataue iactnqataeu iactnqatuae iactnqatuea iactnqateua iactnqateau
iactnqautae iactnqautea iactnqauate iactnqauaet iactnqaueat iactnqaueta iactnqaetua iactnqaetau iactnqaeuta iactnqaeuat
iactnqaeaut iactnqaeatu iactnquaate iactnquaaet iactnquatae iactnquatea iactnquaeta iactnquaeat iactnquaate iactnquaaet
iactnquatae iactnquatea iactnquaeta iactnquaeat iactnqutaae iactnqutaea iactnqutaae iactnqutaea iactnquteaa iactnquteaa
iactnqueata iactnqueaat iactnquetaa iactnquetaa iactnqueata iactnqueaat iactnqeaaut iactnqeaatu iactnqeauat iactnqeauta
iactnqeatua iactnqeatau iactnqeaaut iactnqeaatu iactnqeauat iactnqeauta iactnqeatua iactnqeatau iactnqeuaat iactnqeuata
iactnqeuaat iactnqeuata iactnqeutaa iactnqeutaa iactnqetaua iactnqetaau iactnqetuaa iactnqetuaa iactnqetaua iactnqetaau
iactnutaqae iactnutaqea iactnutaaqe iactnutaaeq iactnutaeaq iactnutaeqa iactnutqaae iactnutqaea iactnutqaae iactnutqaea
iactnutqeaa iactnutqeaa iactnutaqae iactnutaqea iactnutaaqe iactnutaaeq iactnutaeaq iactnutaeqa iactnuteqaa iactnuteqaa
iactnuteaqa iactnuteaaq iactnuteaaq iactnuteaqa iactnuatqae iactnuatqea iactnuataqe iactnuataeq iactnuateaq iactnuateqa
iactnuaqtae iactnuaqtea iactnuaqate iactnuaqaet iactnuaqeat iactnuaqeta iactnuaaqte iactnuaaqet iactnuaatqe iactnuaateq
iactnuaaetq iactnuaaeqt iactnuaeqat iactnuaeqta iactnuaeaqt iactnuaeatq iactnuaetaq iactnuaetqa iactnuqatae iactnuqatea
iactnuqaate iactnuqaaet iactnuqaeat iactnuqaeta iactnuqtaae iactnuqtaea iactnuqtaae iactnuqtaea iactnuqteaa iactnuqteaa
iactnuqatae iactnuqatea iactnuqaate iactnuqaaet iactnuqaeat iactnuqaeta iactnuqetaa iactnuqetaa iactnuqeata iactnuqeaat
iactnuqeaat iactnuqeata iactnuaaqte iactnuaaqet iactnuaatqe iactnuaateq iactnuaaetq iactnuaaeqt iactnuaqate iactnuaqaet
iactnuaqtae iactnuaqtea iactnuaqeta iactnuaqeat iactnuatqae iactnuatqea iactnuataqe iactnuataeq iactnuateaq iactnuateqa
iactnuaeqta iactnuaeqat iactnuaetqa iactnuaetaq iactnuaeatq iactnuaeaqt iactnueaqat iactnueaqta iactnueaaqt iactnueaatq
iactnueataq iactnueatqa iactnueqaat iactnueqata iactnueqaat iactnueqata iactnueqtaa iactnueqtaa iactnueaqat iactnueaqta
iactnueaaqt iactnueaatq iactnueataq iactnueatqa iactnuetqaa iactnuetqaa iactnuetaqa iactnuetaaq iactnuetaaq iactnuetaqa
iactnetaqua iactnetaqau iactnetauqa iactnetauaq iactnetaauq iactnetaaqu iactnetqaua iactnetqaau iactnetquaa iactnetquaa
iactnetqaua iactnetqaau iactnetuqaa iactnetuqaa iactnetuaqa iactnetuaaq iactnetuaaq iactnetuaqa iactnetaqua iactnetaqau
iactnetauqa iactnetauaq iactnetaauq iactnetaaqu iactneatqua iactneatqau iactneatuqa iactneatuaq iactneatauq iactneataqu
iactneaqtua iactneaqtau iactneaquta iactneaquat iactneaqaut iactneaqatu iactneauqta iactneauqat iactneautqa iactneautaq
iactneauatq iactneauaqt iactneaaqut iactneaaqtu iactneaauqt iactneaautq iactneaatuq iactneaatqu iactneqatua iactneqatau
iactneqauta iactneqauat iactneqaaut iactneqaatu iactneqtaua iactneqtaau iactneqtuaa iactneqtuaa iactneqtaua iactneqtaau
iactnequtaa iactnequtaa iactnequata iactnequaat iactnequaat iactnequata iactneqatua iactneqatau iactneqauta iactneqauat
iactneqaaut iactneqaatu iactneuaqta iactneuaqat iactneuatqa iactneuataq iactneuaatq iactneuaaqt iactneuqata iactneuqaat
iactneuqtaa iactneuqtaa iactneuqata iactneuqaat iactneutqaa iactneutqaa iactneutaqa iactneutaaq iactneutaaq iactneutaqa
iactneuaqta iactneuaqat iactneuatqa iactneuataq iactneuaatq iactneuaaqt iactneaaqut iactneaaqtu iactneaauqt iactneaautq
iactneaatuq iactneaatqu iactneaqaut iactneaqatu iactneaquat iactneaquta iactneaqtua iactneaqtau iactneauqat iactneauqta
iactneauaqt iactneauatq iactneautaq iactneautqa iactneatqua iactneatqau iactneatuqa iactneatuaq iactneatauq iactneataqu
iacttnaaque iacttnaaqeu iacttnaauqe iacttnaaueq iacttnaaeuq iacttnaaequ iacttnaqaue iacttnaqaeu iacttnaquae iacttnaquea
iacttnaqeua iacttnaqeau iacttnauqae iacttnauqea iacttnauaqe iacttnauaeq iacttnaueaq iacttnaueqa iacttnaequa iacttnaeqau
iacttnaeuqa iacttnaeuaq iacttnaeauq iacttnaeaqu iacttnaaque iacttnaaqeu iacttnaauqe iacttnaaueq iacttnaaeuq iacttnaaequ
iacttnaqaue iacttnaqaeu iacttnaquae iacttnaquea iacttnaqeua iacttnaqeau iacttnauqae iacttnauqea iacttnauaqe iacttnauaeq
iacttnaueaq iacttnaueqa iacttnaequa iacttnaeqau iacttnaeuqa iacttnaeuaq iacttnaeauq iacttnaeaqu iacttnqaaue iacttnqaaeu
iacttnqauae iacttnqauea iacttnqaeua iacttnqaeau iacttnqaaue iacttnqaaeu iacttnqauae iacttnqauea iacttnqaeua iacttnqaeau
iacttnquaae iacttnquaea iacttnquaae iacttnquaea iacttnqueaa iacttnqueaa iacttnqeaua iacttnqeaau iacttnqeuaa iacttnqeuaa
iacttnqeaua iacttnqeaau iacttnuaqae iacttnuaqea iacttnuaaqe iacttnuaaeq iacttnuaeaq iacttnuaeqa iacttnuqaae iacttnuqaea
iacttnuqaae iacttnuqaea iacttnuqeaa iacttnuqeaa iacttnuaqae iacttnuaqea iacttnuaaqe iacttnuaaeq iacttnuaeaq iacttnuaeqa
iacttnueqaa iacttnueqaa iacttnueaqa iacttnueaaq iacttnueaaq iacttnueaqa iacttneaqua iacttneaqau iacttneauqa iacttneauaq
iacttneaauq iacttneaaqu iacttneqaua iacttneqaau iacttnequaa iacttnequaa iacttneqaua iacttneqaau iacttneuqaa iacttneuqaa
iacttneuaqa iacttneuaaq iacttneuaaq iacttneuaqa iacttneaqua iacttneaqau iacttneauqa iacttneauaq iacttneaauq iacttneaaqu
iacttanaque iacttanaqeu iacttanauqe iacttanaueq iacttanaeuq iacttanaequ iacttanqaue iacttanqaeu iacttanquae iacttanquea
iacttanqeua iacttanqeau iacttanuqae iacttanuqea iacttanuaqe iacttanuaeq iacttanueaq iacttanueqa iacttanequa iacttaneqau
iacttaneuqa iacttaneuaq iacttaneauq iacttaneaqu iacttaanque iacttaanqeu iacttaanuqe iacttaanueq iacttaaneuq iacttaanequ
iacttaaqnue iacttaaqneu iacttaaqune iacttaaquen iacttaaqeun iacttaaqenu iacttaauqne iacttaauqen iacttaaunqe iacttaauneq
iacttaauenq iacttaaueqn iacttaaequn iacttaaeqnu iacttaaeuqn iacttaaeunq iacttaaenuq iacttaaenqu iacttaqanue iacttaqaneu
iacttaqaune iacttaqauen iacttaqaeun iacttaqaenu iacttaqnaue iacttaqnaeu iacttaqnuae iacttaqnuea iacttaqneua iacttaqneau
iacttaqunae iacttaqunea iacttaquane iacttaquaen iacttaquean iacttaquena iacttaqenua iacttaqenau iacttaqeuna iacttaqeuan
iacttaqeaun iacttaqeanu iacttauaqne iacttauaqen iacttauanqe iacttauaneq iacttauaenq iacttauaeqn iacttauqane iacttauqaen
iacttauqnae iacttauqnea iacttauqena iacttauqean iacttaunqae iacttaunqea iacttaunaqe iacttaunaeq iacttauneaq iacttauneqa
iacttaueqna iacttaueqan iacttauenqa iacttauenaq iacttaueanq iacttaueaqn iacttaeaqun iacttaeaqnu iacttaeauqn iacttaeaunq
iacttaeanuq iacttaeanqu iacttaeqaun iacttaeqanu iacttaequan iacttaequna iacttaeqnua iacttaeqnau iacttaeuqan iacttaeuqna
iacttaeuaqn iacttaeuanq iacttaeunaq iacttaeunqa iacttaenqua iacttaenqau iacttaenuqa iacttaenuaq iacttaenauq iacttaenaqu
iacttaanque iacttaanqeu iacttaanuqe iacttaanueq iacttaaneuq iacttaanequ iacttaaqnue iacttaaqneu iacttaaqune iacttaaquen
iacttaaqeun iacttaaqenu iacttaauqne iacttaauqen iacttaaunqe iacttaauneq iacttaauenq iacttaaueqn iacttaaequn iacttaaeqnu
iacttaaeuqn iacttaaeunq iacttaaenuq iacttaaenqu iacttanaque iacttanaqeu iacttanauqe iacttanaueq iacttanaeuq iacttanaequ
iacttanqaue iacttanqaeu iacttanquae iacttanquea iacttanqeua iacttanqeau iacttanuqae iacttanuqea iacttanuaqe iacttanuaeq
iacttanueaq iacttanueqa iacttanequa iacttaneqau iacttaneuqa iacttaneuaq iacttaneauq iacttaneaqu iacttaqnaue iacttaqnaeu
iacttaqnuae iacttaqnuea iacttaqneua iacttaqneau iacttaqanue iacttaqaneu iacttaqaune iacttaqauen iacttaqaeun iacttaqaenu
iacttaquane iacttaquaen iacttaqunae iacttaqunea iacttaquena iacttaquean iacttaqeaun iacttaqeanu iacttaqeuan iacttaqeuna
iacttaqenua iacttaqenau iacttaunqae iacttaunqea iacttaunaqe iacttaunaeq iacttauneaq iacttauneqa iacttauqnae iacttauqnea
iacttauqane iacttauqaen iacttauqean iacttauqena iacttauaqne iacttauaqen iacttauanqe iacttauaneq iacttauaenq iacttauaeqn
iacttaueqan iacttaueqna iacttaueaqn iacttaueanq iacttauenaq iacttauenqa iacttaenqua iacttaenqau iacttaenuqa iacttaenuaq
iacttaenauq iacttaenaqu iacttaeqnua iacttaeqnau iacttaequna iacttaequan iacttaeqaun iacttaeqanu iacttaeuqna iacttaeuqan
iacttaeunqa iacttaeunaq iacttaeuanq iacttaeuaqn iacttaeaqun iacttaeaqnu iacttaeauqn iacttaeaunq iacttaeanuq iacttaeanqu
iacttqaanue iacttqaaneu iacttqaaune iacttqaauen iacttqaaeun iacttqaaenu iacttqanaue iacttqanaeu iacttqanuae iacttqanuea
iacttqaneua iacttqaneau iacttqaunae iacttqaunea iacttqauane iacttqauaen iacttqauean iacttqauena iacttqaenua iacttqaenau
iacttqaeuna iacttqaeuan iacttqaeaun iacttqaeanu iacttqaanue iacttqaaneu iacttqaaune iacttqaauen iacttqaaeun iacttqaaenu
iacttqanaue iacttqanaeu iacttqanuae iacttqanuea iacttqaneua iacttqaneau iacttqaunae iacttqaunea iacttqauane iacttqauaen
iacttqauean iacttqauena iacttqaenua iacttqaenau iacttqaeuna iacttqaeuan iacttqaeaun iacttqaeanu iacttqnaaue iacttqnaaeu
iacttqnauae iacttqnauea iacttqnaeua iacttqnaeau iacttqnaaue iacttqnaaeu iacttqnauae iacttqnauea iacttqnaeua iacttqnaeau
iacttqnuaae iacttqnuaea iacttqnuaae iacttqnuaea iacttqnueaa iacttqnueaa iacttqneaua iacttqneaau iacttqneuaa iacttqneuaa
iacttqneaua iacttqneaau iacttquanae iacttquanea iacttquaane iacttquaaen iacttquaean iacttquaena iacttqunaae iacttqunaea
iacttqunaae iacttqunaea iacttquneaa iacttquneaa iacttquanae iacttquanea iacttquaane iacttquaaen iacttquaean iacttquaena
iacttquenaa iacttquenaa iacttqueana iacttqueaan iacttqueaan iacttqueana iacttqeanua iacttqeanau iacttqeauna iacttqeauan
iacttqeaaun iacttqeaanu iacttqenaua iacttqenaau iacttqenuaa iacttqenuaa iacttqenaua iacttqenaau iacttqeunaa iacttqeunaa
iacttqeuana iacttqeuaan iacttqeuaan iacttqeuana iacttqeanua iacttqeanau iacttqeauna iacttqeauan iacttqeaaun iacttqeaanu
iacttuaaqne iacttuaaqen iacttuaanqe iacttuaaneq iacttuaaenq iacttuaaeqn iacttuaqane iacttuaqaen iacttuaqnae iacttuaqnea
iacttuaqena iacttuaqean iacttuanqae iacttuanqea iacttuanaqe iacttuanaeq iacttuaneaq iacttuaneqa iacttuaeqna iacttuaeqan
iacttuaenqa iacttuaenaq iacttuaeanq iacttuaeaqn iacttuaaqne iacttuaaqen iacttuaanqe iacttuaaneq iacttuaaenq iacttuaaeqn
iacttuaqane iacttuaqaen iacttuaqnae iacttuaqnea iacttuaqena iacttuaqean iacttuanqae iacttuanqea iacttuanaqe iacttuanaeq
iacttuaneaq iacttuaneqa iacttuaeqna iacttuaeqan iacttuaenqa iacttuaenaq iacttuaeanq iacttuaeaqn iacttuqaane iacttuqaaen
iacttuqanae iacttuqanea iacttuqaena iacttuqaean iacttuqaane iacttuqaaen iacttuqanae iacttuqanea iacttuqaena iacttuqaean
iacttuqnaae iacttuqnaea iacttuqnaae iacttuqnaea iacttuqneaa iacttuqneaa iacttuqeana iacttuqeaan iacttuqenaa iacttuqenaa
iacttuqeana iacttuqeaan iacttunaqae iacttunaqea iacttunaaqe iacttunaaeq iacttunaeaq iacttunaeqa iacttunqaae iacttunqaea
iacttunqaae iacttunqaea iacttunqeaa iacttunqeaa iacttunaqae iacttunaqea iacttunaaqe iacttunaaeq iacttunaeaq iacttunaeqa
iacttuneqaa iacttuneqaa iacttuneaqa iacttuneaaq iacttuneaaq iacttuneaqa iacttueaqna iacttueaqan iacttueanqa iacttueanaq
iacttueaanq iacttueaaqn iacttueqana iacttueqaan iacttueqnaa iacttueqnaa iacttueqana iacttueqaan iacttuenqaa iacttuenqaa
iacttuenaqa iacttuenaaq iacttuenaaq iacttuenaqa iacttueaqna iacttueaqan iacttueanqa iacttueanaq iacttueaanq iacttueaaqn
iactteaaqun iactteaaqnu iactteaauqn iactteaaunq iactteaanuq iactteaanqu iactteaqaun iactteaqanu iactteaquan iactteaquna
iactteaqnua iactteaqnau iactteauqan iactteauqna iactteauaqn iactteauanq iactteaunaq iactteaunqa iactteanqua iactteanqau
iactteanuqa iactteanuaq iactteanauq iactteanaqu iactteaaqun iactteaaqnu iactteaauqn iactteaaunq iactteaanuq iactteaanqu
iactteaqaun iactteaqanu iactteaquan iactteaquna iactteaqnua iactteaqnau iactteauqan iactteauqna iactteauaqn iactteauanq
iactteaunaq iactteaunqa iactteanqua iactteanqau iactteanuqa iactteanuaq iactteanauq iactteanaqu iactteqaaun iactteqaanu
iactteqauan iactteqauna iactteqanua iactteqanau iactteqaaun iactteqaanu iactteqauan iactteqauna iactteqanua iactteqanau
iacttequaan iacttequana iacttequaan iacttequana iacttequnaa iacttequnaa iactteqnaua iactteqnaau iactteqnuaa iactteqnuaa
iactteqnaua iactteqnaau iactteuaqan iactteuaqna iactteuaaqn iactteuaanq iactteuanaq iactteuanqa iactteuqaan iactteuqana
iactteuqaan iactteuqana iactteuqnaa iactteuqnaa iactteuaqan iactteuaqna iactteuaaqn iactteuaanq iactteuanaq iactteuanqa
iactteunqaa iactteunqaa iactteunaqa iactteunaaq iactteunaaq iactteunaqa iacttenaqua iacttenaqau iacttenauqa iacttenauaq
iacttenaauq iacttenaaqu iacttenqaua iacttenqaau iacttenquaa iacttenquaa iacttenqaua iacttenqaau iacttenuqaa iacttenuqaa
iacttenuaqa iacttenuaaq iacttenuaaq iacttenuaqa iacttenaqua iacttenaqau iacttenauqa iacttenauaq iacttenaauq iacttenaaqu
iactantaque iactantaqeu iactantauqe iactantaueq iactantaeuq iactantaequ iactantqaue iactantqaeu iactantquae iactantquea
iactantqeua iactantqeau iactantuqae iactantuqea iactantuaqe iactantuaeq iactantueaq iactantueqa iactantequa iactanteqau
iactanteuqa iactanteuaq iactanteauq iactanteaqu iactanatque iactanatqeu iactanatuqe iactanatueq iactanateuq iactanatequ
iactanaqtue iactanaqteu iactanaqute iactanaquet iactanaqeut iactanaqetu iactanauqte iactanauqet iactanautqe iactanauteq
iactanauetq iactanaueqt iactanaequt iactanaeqtu iactanaeuqt iactanaeutq iactanaetuq iactanaetqu iactanqatue iactanqateu
iactanqaute iactanqauet iactanqaeut iactanqaetu iactanqtaue iactanqtaeu iactanqtuae iactanqtuea iactanqteua iactanqteau
iactanqutae iactanqutea iactanquate iactanquaet iactanqueat iactanqueta iactanqetua iactanqetau iactanqeuta iactanqeuat
iactanqeaut iactanqeatu iactanuaqte iactanuaqet iactanuatqe iactanuateq iactanuaetq iactanuaeqt iactanuqate iactanuqaet
iactanuqtae iactanuqtea iactanuqeta iactanuqeat iactanutqae iactanutqea iactanutaqe iactanutaeq iactanuteaq iactanuteqa
iactanueqta iactanueqat iactanuetqa iactanuetaq iactanueatq iactanueaqt iactaneaqut iactaneaqtu iactaneauqt iactaneautq
iactaneatuq iactaneatqu iactaneqaut iactaneqatu iactanequat iactanequta iactaneqtua iactaneqtau iactaneuqat iactaneuqta
iactaneuaqt iactaneuatq iactaneutaq iactaneutqa iactanetqua iactanetqau iactanetuqa iactanetuaq iactanetauq iactanetaqu
iactatnaque iactatnaqeu iactatnauqe iactatnaueq iactatnaeuq iactatnaequ iactatnqaue iactatnqaeu iactatnquae iactatnquea
iactatnqeua iactatnqeau iactatnuqae iactatnuqea iactatnuaqe iactatnuaeq iactatnueaq iactatnueqa iactatnequa iactatneqau
iactatneuqa iactatneuaq iactatneauq iactatneaqu iactatanque iactatanqeu iactatanuqe iactatanueq iactataneuq iactatanequ
iactataqnue iactataqneu iactataqune iactataquen iactataqeun iactataqenu iactatauqne iactatauqen iactataunqe iactatauneq
iactatauenq iactataueqn iactataequn iactataeqnu iactataeuqn iactataeunq iactataenuq iactataenqu iactatqanue iactatqaneu
iactatqaune iactatqauen iactatqaeun iactatqaenu iactatqnaue iactatqnaeu iactatqnuae iactatqnuea iactatqneua iactatqneau
iactatqunae iactatqunea iactatquane iactatquaen iactatquean iactatquena iactatqenua iactatqenau iactatqeuna iactatqeuan
iactatqeaun iactatqeanu iactatuaqne iactatuaqen iactatuanqe iactatuaneq iactatuaenq iactatuaeqn iactatuqane iactatuqaen
iactatuqnae iactatuqnea iactatuqena iactatuqean iactatunqae iactatunqea iactatunaqe iactatunaeq iactatuneaq iactatuneqa
iactatueqna iactatueqan iactatuenqa iactatuenaq iactatueanq iactatueaqn iactateaqun iactateaqnu iactateauqn iactateaunq
iactateanuq iactateanqu iactateqaun iactateqanu iactatequan iactatequna iactateqnua iactateqnau iactateuqan iactateuqna
iactateuaqn iactateuanq iactateunaq iactateunqa iactatenqua iactatenqau iactatenuqa iactatenuaq iactatenauq iactatenaqu
iactaatnque iactaatnqeu iactaatnuqe iactaatnueq iactaatneuq iactaatnequ iactaatqnue iactaatqneu iactaatqune iactaatquen
iactaatqeun iactaatqenu iactaatuqne iactaatuqen iactaatunqe iactaatuneq iactaatuenq iactaatueqn iactaatequn iactaateqnu
iactaateuqn iactaateunq iactaatenuq iactaatenqu iactaantque iactaantqeu iactaantuqe iactaantueq iactaanteuq iactaantequ
iactaanqtue iactaanqteu iactaanqute iactaanquet iactaanqeut iactaanqetu iactaanuqte iactaanuqet iactaanutqe iactaanuteq
iactaanuetq iactaanueqt iactaanequt iactaaneqtu iactaaneuqt iactaaneutq iactaanetuq iactaanetqu iactaaqntue iactaaqnteu
iactaaqnute iactaaqnuet iactaaqneut iactaaqnetu iactaaqtnue iactaaqtneu iactaaqtune iactaaqtuen iactaaqteun iactaaqtenu
iactaaqutne iactaaquten iactaaqunte iactaaqunet iactaaquent iactaaquetn iactaaqetun iactaaqetnu iactaaqeutn iactaaqeunt
iactaaqenut iactaaqentu iactaaunqte iactaaunqet iactaauntqe iactaaunteq iactaaunetq iactaauneqt iactaauqnte iactaauqnet
iactaauqtne iactaauqten iactaauqetn iactaauqent iactaautqne iactaautqen iactaautnqe iactaautneq iactaautenq iactaauteqn
iactaaueqtn iactaaueqnt iactaauetqn iactaauetnq iactaauentq iactaauenqt iactaaenqut iactaaenqtu iactaaenuqt iactaaenutq
iactaaentuq iactaaentqu iactaaeqnut iactaaeqntu iactaaequnt iactaaequtn iactaaeqtun iactaaeqtnu iactaaeuqnt iactaaeuqtn
iactaaeunqt iactaaeuntq iactaaeutnq iactaaeutqn iactaaetqun iactaaetqnu iactaaetuqn iactaaetunq iactaaetnuq iactaaetnqu
iactaqtanue iactaqtaneu iactaqtaune iactaqtauen iactaqtaeun iactaqtaenu iactaqtnaue iactaqtnaeu iactaqtnuae iactaqtnuea
iactaqtneua iactaqtneau iactaqtunae iactaqtunea iactaqtuane iactaqtuaen iactaqtuean iactaqtuena iactaqtenua iactaqtenau
iactaqteuna iactaqteuan iactaqteaun iactaqteanu iactaqatnue iactaqatneu iactaqatune iactaqatuen iactaqateun iactaqatenu
iactaqantue iactaqanteu iactaqanute iactaqanuet iactaqaneut iactaqanetu iactaqaunte iactaqaunet iactaqautne iactaqauten
iactaqauetn iactaqauent iactaqaenut iactaqaentu iactaqaeunt iactaqaeutn iactaqaetun iactaqaetnu iactaqnatue iactaqnateu
iactaqnaute iactaqnauet iactaqnaeut iactaqnaetu iactaqntaue iactaqntaeu iactaqntuae iactaqntuea iactaqnteua iactaqnteau
iactaqnutae iactaqnutea iactaqnuate iactaqnuaet iactaqnueat iactaqnueta iactaqnetua iactaqnetau iactaqneuta iactaqneuat
iactaqneaut iactaqneatu iactaquante iactaquanet iactaquatne iactaquaten iactaquaetn iactaquaent iactaqunate iactaqunaet
iactaquntae iactaquntea iactaquneta iactaquneat iactaqutnae iactaqutnea iactaqutane iactaqutaen iactaqutean iactaqutena
iactaquenta iactaquenat iactaquetna iactaquetan iactaqueatn iactaqueant iactaqeanut iactaqeantu iactaqeaunt iactaqeautn
iactaqeatun iactaqeatnu iactaqenaut iactaqenatu iactaqenuat iactaqenuta iactaqentua iactaqentau iactaqeunat iactaqeunta
iactaqeuant iactaqeuatn iactaqeutan iactaqeutna iactaqetnua iactaqetnau iactaqetuna iactaqetuan iactaqetaun iactaqetanu
iactautaqne iactautaqen iactautanqe iactautaneq iactautaenq iactautaeqn iactautqane iactautqaen iactautqnae iactautqnea
iactautqena iactautqean iactautnqae iactautnqea iactautnaqe iactautnaeq iactautneaq iactautneqa iactauteqna iactauteqan
iactautenqa iactautenaq iactauteanq iactauteaqn iactauatqne iactauatqen iactauatnqe iactauatneq iactauatenq iactauateqn
iactauaqtne iactauaqten iactauaqnte iactauaqnet iactauaqent iactauaqetn iactauanqte iactauanqet iactauantqe iactauanteq
iactauanetq iactauaneqt iactauaeqnt iactauaeqtn iactauaenqt iactauaentq iactauaetnq iactauaetqn iactauqatne iactauqaten
iactauqante iactauqanet iactauqaent iactauqaetn iactauqtane iactauqtaen iactauqtnae iactauqtnea iactauqtena iactauqtean
iactauqntae iactauqntea iactauqnate iactauqnaet iactauqneat iactauqneta iactauqetna iactauqetan iactauqenta iactauqenat
iactauqeant iactauqeatn iactaunaqte iactaunaqet iactaunatqe iactaunateq iactaunaetq iactaunaeqt iactaunqate iactaunqaet
iactaunqtae iactaunqtea iactaunqeta iactaunqeat iactauntqae iactauntqea iactauntaqe iactauntaeq iactaunteaq iactaunteqa
iactauneqta iactauneqat iactaunetqa iactaunetaq iactauneatq iactauneaqt iactaueaqnt iactaueaqtn iactaueanqt iactaueantq
iactaueatnq iactaueatqn iactaueqant iactaueqatn iactaueqnat iactaueqnta iactaueqtna iactaueqtan iactauenqat iactauenqta
iactauenaqt iactauenatq iactauentaq iactauentqa iactauetqna iactauetqan iactauetnqa iactauetnaq iactauetanq iactauetaqn
iactaetaqun iactaetaqnu iactaetauqn iactaetaunq iactaetanuq iactaetanqu iactaetqaun iactaetqanu iactaetquan iactaetquna
iactaetqnua iactaetqnau iactaetuqan iactaetuqna iactaetuaqn iactaetuanq iactaetunaq iactaetunqa iactaetnqua iactaetnqau
iactaetnuqa iactaetnuaq iactaetnauq iactaetnaqu iactaeatqun iactaeatqnu iactaeatuqn iactaeatunq iactaeatnuq iactaeatnqu
iactaeaqtun iactaeaqtnu iactaeaqutn iactaeaqunt iactaeaqnut iactaeaqntu iactaeauqtn iactaeauqnt iactaeautqn iactaeautnq
iactaeauntq iactaeaunqt iactaeanqut iactaeanqtu iactaeanuqt iactaeanutq iactaeantuq iactaeantqu iactaeqatun iactaeqatnu
iactaeqautn iactaeqaunt iactaeqanut iactaeqantu iactaeqtaun iactaeqtanu iactaeqtuan iactaeqtuna iactaeqtnua iactaeqtnau
iactaequtan iactaequtna iactaequatn iactaequant iactaequnat iactaequnta iactaeqntua iactaeqntau iactaeqnuta iactaeqnuat
iactaeqnaut iactaeqnatu iactaeuaqtn iactaeuaqnt iactaeuatqn iactaeuatnq iactaeuantq iactaeuanqt iactaeuqatn iactaeuqant
iactaeuqtan iactaeuqtna iactaeuqnta iactaeuqnat iactaeutqan iactaeutqna iactaeutaqn iactaeutanq iactaeutnaq iactaeutnqa
iactaeunqta iactaeunqat iactaeuntqa iactaeuntaq iactaeunatq iactaeunaqt iactaenaqut iactaenaqtu iactaenauqt iactaenautq
iactaenatuq iactaenatqu iactaenqaut iactaenqatu iactaenquat iactaenquta iactaenqtua iactaenqtau iactaenuqat iactaenuqta
iactaenuaqt iactaenuatq iactaenutaq iactaenutqa iactaentqua iactaentqau iactaentuqa iactaentuaq iactaentauq iactaentaqu
iactqntaaue iactqntaaeu iactqntauae iactqntauea iactqntaeua iactqntaeau iactqntaaue iactqntaaeu iactqntauae iactqntauea
iactqntaeua iactqntaeau iactqntuaae iactqntuaea iactqntuaae iactqntuaea iactqntueaa iactqntueaa iactqnteaua iactqnteaau
iactqnteuaa iactqnteuaa iactqnteaua iactqnteaau iactqnataue iactqnataeu iactqnatuae iactqnatuea iactqnateua iactqnateau
iactqnaatue iactqnaateu iactqnaaute iactqnaauet iactqnaaeut iactqnaaetu iactqnauate iactqnauaet iactqnautae iactqnautea
iactqnaueta iactqnaueat iactqnaeaut iactqnaeatu iactqnaeuat iactqnaeuta iactqnaetua iactqnaetau iactqnaatue iactqnaateu
iactqnaaute iactqnaauet iactqnaaeut iactqnaaetu iactqnataue iactqnataeu iactqnatuae iactqnatuea iactqnateua iactqnateau
iactqnautae iactqnautea iactqnauate iactqnauaet iactqnaueat iactqnaueta iactqnaetua iactqnaetau iactqnaeuta iactqnaeuat
iactqnaeaut iactqnaeatu iactqnuaate iactqnuaaet iactqnuatae iactqnuatea iactqnuaeta iactqnuaeat iactqnuaate iactqnuaaet
iactqnuatae iactqnuatea iactqnuaeta iactqnuaeat iactqnutaae iactqnutaea iactqnutaae iactqnutaea iactqnuteaa iactqnuteaa
iactqnueata iactqnueaat iactqnuetaa iactqnuetaa iactqnueata iactqnueaat iactqneaaut iactqneaatu iactqneauat iactqneauta
iactqneatua iactqneatau iactqneaaut iactqneaatu iactqneauat iactqneauta iactqneatua iactqneatau iactqneuaat iactqneuata
iactqneuaat iactqneuata iactqneutaa iactqneutaa iactqnetaua iactqnetaau iactqnetuaa iactqnetuaa iactqnetaua iactqnetaau
iactqtnaaue iactqtnaaeu iactqtnauae iactqtnauea iactqtnaeua iactqtnaeau iactqtnaaue iactqtnaaeu iactqtnauae iactqtnauea
iactqtnaeua iactqtnaeau iactqtnuaae iactqtnuaea iactqtnuaae iactqtnuaea iactqtnueaa iactqtnueaa iactqtneaua iactqtneaau
iactqtneuaa iactqtneuaa iactqtneaua iactqtneaau iactqtanaue iactqtanaeu iactqtanuae iactqtanuea iactqtaneua iactqtaneau
iactqtaanue iactqtaaneu iactqtaaune iactqtaauen iactqtaaeun iactqtaaenu iactqtauane iactqtauaen iactqtaunae iactqtaunea
iactqtauena iactqtauean iactqtaeaun iactqtaeanu iactqtaeuan iactqtaeuna iactqtaenua iactqtaenau iactqtaanue iactqtaaneu
iactqtaaune iactqtaauen iactqtaaeun iactqtaaenu iactqtanaue iactqtanaeu iactqtanuae iactqtanuea iactqtaneua iactqtaneau
iactqtaunae iactqtaunea iactqtauane iactqtauaen iactqtauean iactqtauena iactqtaenua iactqtaenau iactqtaeuna iactqtaeuan
iactqtaeaun iactqtaeanu iactqtuaane iactqtuaaen iactqtuanae iactqtuanea iactqtuaena iactqtuaean iactqtuaane iactqtuaaen
iactqtuanae iactqtuanea iactqtuaena iactqtuaean iactqtunaae iactqtunaea iactqtunaae iactqtunaea iactqtuneaa iactqtuneaa
iactqtueana iactqtueaan iactqtuenaa iactqtuenaa iactqtueana iactqtueaan iactqteaaun iactqteaanu iactqteauan iactqteauna
iactqteanua iactqteanau iactqteaaun iactqteaanu iactqteauan iactqteauna iactqteanua iactqteanau iactqteuaan iactqteuana
iactqteuaan iactqteuana iactqteunaa iactqteunaa iactqtenaua iactqtenaau iactqtenuaa iactqtenuaa iactqtenaua iactqtenaau
iactqatnaue iactqatnaeu iactqatnuae iactqatnuea iactqatneua iactqatneau iactqatanue iactqataneu iactqataune iactqatauen
iactqataeun iactqataenu iactqatuane iactqatuaen iactqatunae iactqatunea iactqatuena iactqatuean iactqateaun iactqateanu
iactqateuan iactqateuna iactqatenua iactqatenau iactqantaue iactqantaeu iactqantuae iactqantuea iactqanteua iactqanteau
iactqanatue iactqanateu iactqanaute iactqanauet iactqanaeut iactqanaetu iactqanuate iactqanuaet iactqanutae iactqanutea
iactqanueta iactqanueat iactqaneaut iactqaneatu iactqaneuat iactqaneuta iactqanetua iactqanetau iactqaantue iactqaanteu
iactqaanute iactqaanuet iactqaaneut iactqaanetu iactqaatnue iactqaatneu iactqaatune iactqaatuen iactqaateun iactqaatenu
iactqaautne iactqaauten iactqaaunte iactqaaunet iactqaauent iactqaauetn iactqaaetun iactqaaetnu iactqaaeutn iactqaaeunt
iactqaaenut iactqaaentu iactqaunate iactqaunaet iactqauntae iactqauntea iactqauneta iactqauneat iactqauante iactqauanet
iactqauatne iactqauaten iactqauaetn iactqauaent iactqautane iactqautaen iactqautnae iactqautnea iactqautena iactqautean
iactqaueatn iactqaueant iactqauetan iactqauetna iactqauenta iactqauenat iactqaenaut iactqaenatu iactqaenuat iactqaenuta
iactqaentua iactqaentau iactqaeanut iactqaeantu iactqaeaunt iactqaeautn iactqaeatun iactqaeatnu iactqaeuant iactqaeuatn
iactqaeunat iactqaeunta iactqaeutna iactqaeutan iactqaetaun iactqaetanu iactqaetuan iactqaetuna iactqaetnua iactqaetnau
iactqatanue iactqataneu iactqataune iactqatauen iactqataeun iactqataenu iactqatnaue iactqatnaeu iactqatnuae iactqatnuea
iactqatneua iactqatneau iactqatunae iactqatunea iactqatuane iactqatuaen iactqatuean iactqatuena iactqatenua iactqatenau
iactqateuna iactqateuan iactqateaun iactqateanu iactqaatnue iactqaatneu iactqaatune iactqaatuen iactqaateun iactqaatenu
iactqaantue iactqaanteu iactqaanute iactqaanuet iactqaaneut iactqaanetu iactqaaunte iactqaaunet iactqaautne iactqaauten
iactqaauetn iactqaauent iactqaaenut iactqaaentu iactqaaeunt iactqaaeutn iactqaaetun iactqaaetnu iactqanatue iactqanateu
iactqanaute iactqanauet iactqanaeut iactqanaetu iactqantaue iactqantaeu iactqantuae iactqantuea iactqanteua iactqanteau
iactqanutae iactqanutea iactqanuate iactqanuaet iactqanueat iactqanueta iactqanetua iactqanetau iactqaneuta iactqaneuat
iactqaneaut iactqaneatu iactqauante iactqauanet iactqauatne iactqauaten iactqauaetn iactqauaent iactqaunate iactqaunaet
iactqauntae iactqauntea iactqauneta iactqauneat iactqautnae iactqautnea iactqautane iactqautaen iactqautean iactqautena
iactqauenta iactqauenat iactqauetna iactqauetan iactqaueatn iactqaueant iactqaeanut iactqaeantu iactqaeaunt iactqaeautn
iactqaeatun iactqaeatnu iactqaenaut iactqaenatu iactqaenuat iactqaenuta iactqaentua iactqaentau iactqaeunat iactqaeunta
iactqaeuant iactqaeuatn iactqaeutan iactqaeutna iactqaetnua iactqaetnau iactqaetuna iactqaetuan iactqaetaun iactqaetanu
iactqutaane iactqutaaen iactqutanae iactqutanea iactqutaena iactqutaean iactqutaane iactqutaaen iactqutanae iactqutanea
iactqutaena iactqutaean iactqutnaae iactqutnaea iactqutnaae iactqutnaea iactqutneaa iactqutneaa iactquteana iactquteaan
iactqutenaa iactqutenaa iactquteana iactquteaan iactquatane iactquataen iactquatnae iactquatnea iactquatena iactquatean
iactquaatne iactquaaten iactquaante iactquaanet iactquaaent iactquaaetn iactquanate iactquanaet iactquantae iactquantea
iactquaneta iactquaneat iactquaeant iactquaeatn iactquaenat iactquaenta iactquaetna iactquaetan iactquaatne iactquaaten
iactquaante iactquaanet iactquaaent iactquaaetn iactquatane iactquataen iactquatnae iactquatnea iactquatena iactquatean
iactquantae iactquantea iactquanate iactquanaet iactquaneat iactquaneta iactquaetna iactquaetan iactquaenta iactquaenat
iactquaeant iactquaeatn iactqunaate iactqunaaet iactqunatae iactqunatea iactqunaeta iactqunaeat iactqunaate iactqunaaet
iactqunatae iactqunatea iactqunaeta iactqunaeat iactquntaae iactquntaea iactquntaae iactquntaea iactqunteaa iactqunteaa
iactquneata iactquneaat iactqunetaa iactqunetaa iactquneata iactquneaat iactqueaant iactqueaatn iactqueanat iactqueanta
iactqueatna iactqueatan iactqueaant iactqueaatn iactqueanat iactqueanta iactqueatna iactqueatan iactquenaat iactquenata
iactquenaat iactquenata iactquentaa iactquentaa iactquetana iactquetaan iactquetnaa iactquetnaa iactquetana iactquetaan
iactqetaaun iactqetaanu iactqetauan iactqetauna iactqetanua iactqetanau iactqetaaun iactqetaanu iactqetauan iactqetauna
iactqetanua iactqetanau iactqetuaan iactqetuana iactqetuaan iactqetuana iactqetunaa iactqetunaa iactqetnaua iactqetnaau
iactqetnuaa iactqetnuaa iactqetnaua iactqetnaau iactqeataun iactqeatanu iactqeatuan iactqeatuna iactqeatnua iactqeatnau
iactqeaatun iactqeaatnu iactqeaautn iactqeaaunt iactqeaanut iactqeaantu iactqeauatn iactqeauant iactqeautan iactqeautna
iactqeaunta iactqeaunat iactqeanaut iactqeanatu iactqeanuat iactqeanuta iactqeantua iactqeantau iactqeaatun iactqeaatnu
iactqeaautn iactqeaaunt iactqeaanut iactqeaantu iactqeataun iactqeatanu iactqeatuan iactqeatuna iactqeatnua iactqeatnau
iactqeautan iactqeautna iactqeauatn iactqeauant iactqeaunat iactqeaunta iactqeantua iactqeantau iactqeanuta iactqeanuat
iactqeanaut iactqeanatu iactqeuaatn iactqeuaant iactqeuatan iactqeuatna iactqeuanta iactqeuanat iactqeuaatn iactqeuaant
iactqeuatan iactqeuatna iactqeuanta iactqeuanat iactqeutaan iactqeutana iactqeutaan iactqeutana iactqeutnaa iactqeutnaa
iactqeunata iactqeunaat iactqeuntaa iactqeuntaa iactqeunata iactqeunaat iactqenaaut iactqenaatu iactqenauat iactqenauta
iactqenatua iactqenatau iactqenaaut iactqenaatu iactqenauat iactqenauta iactqenatua iactqenatau iactqenuaat iactqenuata
iactqenuaat iactqenuata iactqenutaa iactqenutaa iactqentaua iactqentaau iactqentuaa iactqentuaa iactqentaua iactqentaau
iactuntaqae iactuntaqea iactuntaaqe iactuntaaeq iactuntaeaq iactuntaeqa iactuntqaae iactuntqaea iactuntqaae iactuntqaea
iactuntqeaa iactuntqeaa iactuntaqae iactuntaqea iactuntaaqe iactuntaaeq iactuntaeaq iactuntaeqa iactunteqaa iactunteqaa
iactunteaqa iactunteaaq iactunteaaq iactunteaqa iactunatqae iactunatqea iactunataqe iactunataeq iactunateaq iactunateqa
iactunaqtae iactunaqtea iactunaqate iactunaqaet iactunaqeat iactunaqeta iactunaaqte iactunaaqet iactunaatqe iactunaateq
iactunaaetq iactunaaeqt iactunaeqat iactunaeqta iactunaeaqt iactunaeatq iactunaetaq iactunaetqa iactunqatae iactunqatea
iactunqaate iactunqaaet iactunqaeat iactunqaeta iactunqtaae iactunqtaea iactunqtaae iactunqtaea iactunqteaa iactunqteaa
iactunqatae iactunqatea iactunqaate iactunqaaet iactunqaeat iactunqaeta iactunqetaa iactunqetaa iactunqeata iactunqeaat
iactunqeaat iactunqeata iactunaaqte iactunaaqet iactunaatqe iactunaateq iactunaaetq iactunaaeqt iactunaqate iactunaqaet
iactunaqtae iactunaqtea iactunaqeta iactunaqeat iactunatqae iactunatqea iactunataqe iactunataeq iactunateaq iactunateqa
iactunaeqta iactunaeqat iactunaetqa iactunaetaq iactunaeatq iactunaeaqt iactuneaqat iactuneaqta iactuneaaqt iactuneaatq
iactuneataq iactuneatqa iactuneqaat iactuneqata iactuneqaat iactuneqata iactuneqtaa iactuneqtaa iactuneaqat iactuneaqta
iactuneaaqt iactuneaatq iactuneataq iactuneatqa iactunetqaa iactunetqaa iactunetaqa iactunetaaq iactunetaaq iactunetaqa
iactutnaqae iactutnaqea iactutnaaqe iactutnaaeq iactutnaeaq iactutnaeqa iactutnqaae iactutnqaea iactutnqaae iactutnqaea
iactutnqeaa iactutnqeaa iactutnaqae iactutnaqea iactutnaaqe iactutnaaeq iactutnaeaq iactutnaeqa iactutneqaa iactutneqaa
iactutneaqa iactutneaaq iactutneaaq iactutneaqa iactutanqae iactutanqea iactutanaqe iactutanaeq iactutaneaq iactutaneqa
iactutaqnae iactutaqnea iactutaqane iactutaqaen iactutaqean iactutaqena iactutaaqne iactutaaqen iactutaanqe iactutaaneq
iactutaaenq iactutaaeqn iactutaeqan iactutaeqna iactutaeaqn iactutaeanq iactutaenaq iactutaenqa iactutqanae iactutqanea
iactutqaane iactutqaaen iactutqaean iactutqaena iactutqnaae iactutqnaea iactutqnaae iactutqnaea iactutqneaa iactutqneaa
iactutqanae iactutqanea iactutqaane iactutqaaen iactutqaean iactutqaena iactutqenaa iactutqenaa iactutqeana iactutqeaan
iactutqeaan iactutqeana iactutaaqne iactutaaqen iactutaanqe iactutaaneq iactutaaenq iactutaaeqn iactutaqane iactutaqaen
iactutaqnae iactutaqnea iactutaqena iactutaqean iactutanqae iactutanqea iactutanaqe iactutanaeq iactutaneaq iactutaneqa
iactutaeqna iactutaeqan iactutaenqa iactutaenaq iactutaeanq iactutaeaqn iactuteaqan iactuteaqna iactuteaaqn iactuteaanq
iactuteanaq iactuteanqa iactuteqaan iactuteqana iactuteqaan iactuteqana iactuteqnaa iactuteqnaa iactuteaqan iactuteaqna
iactuteaaqn iactuteaanq iactuteanaq iactuteanqa iactutenqaa iactutenqaa iactutenaqa iactutenaaq iactutenaaq iactutenaqa
iactuatnqae iactuatnqea iactuatnaqe iactuatnaeq iactuatneaq iactuatneqa iactuatqnae iactuatqnea iactuatqane iactuatqaen
iactuatqean iactuatqena iactuataqne iactuataqen iactuatanqe iactuataneq iactuataenq iactuataeqn iactuateqan iactuateqna
iactuateaqn iactuateanq iactuatenaq iactuatenqa iactuantqae iactuantqea iactuantaqe iactuantaeq iactuanteaq iactuanteqa
iactuanqtae iactuanqtea iactuanqate iactuanqaet iactuanqeat iactuanqeta iactuanaqte iactuanaqet iactuanatqe iactuanateq
iactuanaetq iactuanaeqt iactuaneqat iactuaneqta iactuaneaqt iactuaneatq iactuanetaq iactuanetqa iactuaqntae iactuaqntea
iactuaqnate iactuaqnaet iactuaqneat iactuaqneta iactuaqtnae iactuaqtnea iactuaqtane iactuaqtaen iactuaqtean iactuaqtena
iactuaqatne iactuaqaten iactuaqante iactuaqanet iactuaqaent iactuaqaetn iactuaqetan iactuaqetna iactuaqeatn iactuaqeant
iactuaqenat iactuaqenta iactuaanqte iactuaanqet iactuaantqe iactuaanteq iactuaanetq iactuaaneqt iactuaaqnte iactuaaqnet
iactuaaqtne iactuaaqten iactuaaqetn iactuaaqent iactuaatqne iactuaatqen iactuaatnqe iactuaatneq iactuaatenq iactuaateqn
iactuaaeqtn iactuaaeqnt iactuaaetqn iactuaaetnq iactuaaentq iactuaaenqt iactuaenqat iactuaenqta iactuaenaqt iactuaenatq
iactuaentaq iactuaentqa iactuaeqnat iactuaeqnta iactuaeqant iactuaeqatn iactuaeqtan iactuaeqtna iactuaeaqnt iactuaeaqtn
iactuaeanqt iactuaeantq iactuaeatnq iactuaeatqn iactuaetqan iactuaetqna iactuaetaqn iactuaetanq iactuaetnaq iactuaetnqa
iactuqtanae iactuqtanea iactuqtaane iactuqtaaen iactuqtaean iactuqtaena iactuqtnaae iactuqtnaea iactuqtnaae iactuqtnaea
iactuqtneaa iactuqtneaa iactuqtanae iactuqtanea iactuqtaane iactuqtaaen iactuqtaean iactuqtaena iactuqtenaa iactuqtenaa
iactuqteana iactuqteaan iactuqteaan iactuqteana iactuqatnae iactuqatnea iactuqatane iactuqataen iactuqatean iactuqatena
iactuqantae iactuqantea iactuqanate iactuqanaet iactuqaneat iactuqaneta iactuqaante iactuqaanet iactuqaatne iactuqaaten
iactuqaaetn iactuqaaent iactuqaenat iactuqaenta iactuqaeant iactuqaeatn iactuqaetan iactuqaetna iactuqnatae iactuqnatea
iactuqnaate iactuqnaaet iactuqnaeat iactuqnaeta iactuqntaae iactuqntaea iactuqntaae iactuqntaea iactuqnteaa iactuqnteaa
iactuqnatae iactuqnatea iactuqnaate iactuqnaaet iactuqnaeat iactuqnaeta iactuqnetaa iactuqnetaa iactuqneata iactuqneaat
iactuqneaat iactuqneata iactuqaante iactuqaanet iactuqaatne iactuqaaten iactuqaaetn iactuqaaent iactuqanate iactuqanaet
iactuqantae iactuqantea iactuqaneta iactuqaneat iactuqatnae iactuqatnea iactuqatane iactuqataen iactuqatean iactuqatena
iactuqaenta iactuqaenat iactuqaetna iactuqaetan iactuqaeatn iactuqaeant iactuqeanat iactuqeanta iactuqeaant iactuqeaatn
iactuqeatan iactuqeatna iactuqenaat iactuqenata iactuqenaat iactuqenata iactuqentaa iactuqentaa iactuqeanat iactuqeanta
iactuqeaant iactuqeaatn iactuqeatan iactuqeatna iactuqetnaa iactuqetnaa iactuqetana iactuqetaan iactuqetaan iactuqetana
iactuataqne iactuataqen iactuatanqe iactuataneq iactuataenq iactuataeqn iactuatqane iactuatqaen iactuatqnae iactuatqnea
iactuatqena iactuatqean iactuatnqae iactuatnqea iactuatnaqe iactuatnaeq iactuatneaq iactuatneqa iactuateqna iactuateqan
iactuatenqa iactuatenaq iactuateanq iactuateaqn iactuaatqne iactuaatqen iactuaatnqe iactuaatneq iactuaatenq iactuaateqn
iactuaaqtne iactuaaqten iactuaaqnte iactuaaqnet iactuaaqent iactuaaqetn iactuaanqte iactuaanqet iactuaantqe iactuaanteq
iactuaanetq iactuaaneqt iactuaaeqnt iactuaaeqtn iactuaaenqt iactuaaentq iactuaaetnq iactuaaetqn iactuaqatne iactuaqaten
iactuaqante iactuaqanet iactuaqaent iactuaqaetn iactuaqtane iactuaqtaen iactuaqtnae iactuaqtnea iactuaqtena iactuaqtean
iactuaqntae iactuaqntea iactuaqnate iactuaqnaet iactuaqneat iactuaqneta iactuaqetna iactuaqetan iactuaqenta iactuaqenat
iactuaqeant iactuaqeatn iactuanaqte iactuanaqet iactuanatqe iactuanateq iactuanaetq iactuanaeqt iactuanqate iactuanqaet
iactuanqtae iactuanqtea iactuanqeta iactuanqeat iactuantqae iactuantqea iactuantaqe iactuantaeq iactuanteaq iactuanteqa
iactuaneqta iactuaneqat iactuanetqa iactuanetaq iactuaneatq iactuaneaqt iactuaeaqnt iactuaeaqtn iactuaeanqt iactuaeantq
iactuaeatnq iactuaeatqn iactuaeqant iactuaeqatn iactuaeqnat iactuaeqnta iactuaeqtna iactuaeqtan iactuaenqat iactuaenqta
iactuaenaqt iactuaenatq iactuaentaq iactuaentqa iactuaetqna iactuaetqan iactuaetnqa iactuaetnaq iactuaetanq iactuaetaqn
iactuetaqan iactuetaqna iactuetaaqn iactuetaanq iactuetanaq iactuetanqa iactuetqaan iactuetqana iactuetqaan iactuetqana
iactuetqnaa iactuetqnaa iactuetaqan iactuetaqna iactuetaaqn iactuetaanq iactuetanaq iactuetanqa iactuetnqaa iactuetnqaa
iactuetnaqa iactuetnaaq iactuetnaaq iactuetnaqa iactueatqan iactueatqna iactueataqn iactueatanq iactueatnaq iactueatnqa
iactueaqtan iactueaqtna iactueaqatn iactueaqant iactueaqnat iactueaqnta iactueaaqtn iactueaaqnt iactueaatqn iactueaatnq
iactueaantq iactueaanqt iactueanqat iactueanqta iactueanaqt iactueanatq iactueantaq iactueantqa iactueqatan iactueqatna
iactueqaatn iactueqaant iactueqanat iactueqanta iactueqtaan iactueqtana iactueqtaan iactueqtana iactueqtnaa iactueqtnaa
iactueqatan iactueqatna iactueqaatn iactueqaant iactueqanat iactueqanta iactueqntaa iactueqntaa iactueqnata iactueqnaat
iactueqnaat iactueqnata iactueaaqtn iactueaaqnt iactueaatqn iactueaatnq iactueaantq iactueaanqt iactueaqatn iactueaqant
iactueaqtan iactueaqtna iactueaqnta iactueaqnat iactueatqan iactueatqna iactueataqn iactueatanq iactueatnaq iactueatnqa
iactueanqta iactueanqat iactueantqa iactueantaq iactueanatq iactueanaqt iactuenaqat iactuenaqta iactuenaaqt iactuenaatq
iactuenataq iactuenatqa iactuenqaat iactuenqata iactuenqaat iactuenqata iactuenqtaa iactuenqtaa iactuenaqat iactuenaqta
iactuenaaqt iactuenaatq iactuenataq iactuenatqa iactuentqaa iactuentqaa iactuentaqa iactuentaaq iactuentaaq iactuentaqa
iactentaqua iactentaqau iactentauqa iactentauaq iactentaauq iactentaaqu iactentqaua iactentqaau iactentquaa iactentquaa
iactentqaua iactentqaau iactentuqaa iactentuqaa iactentuaqa iactentuaaq iactentuaaq iactentuaqa iactentaqua iactentaqau
iactentauqa iactentauaq iactentaauq iactentaaqu iactenatqua iactenatqau iactenatuqa iactenatuaq iactenatauq iactenataqu
iactenaqtua iactenaqtau iactenaquta iactenaquat iactenaqaut iactenaqatu iactenauqta iactenauqat iactenautqa iactenautaq
iactenauatq iactenauaqt iactenaaqut iactenaaqtu iactenaauqt iactenaautq iactenaatuq iactenaatqu iactenqatua iactenqatau
iactenqauta iactenqauat iactenqaaut iactenqaatu iactenqtaua iactenqtaau iactenqtuaa iactenqtuaa iactenqtaua iactenqtaau
iactenqutaa iactenqutaa iactenquata iactenquaat iactenquaat iactenquata iactenqatua iactenqatau iactenqauta iactenqauat
iactenqaaut iactenqaatu iactenuaqta iactenuaqat iactenuatqa iactenuataq iactenuaatq iactenuaaqt iactenuqata iactenuqaat
iactenuqtaa iactenuqtaa iactenuqata iactenuqaat iactenutqaa iactenutqaa iactenutaqa iactenutaaq iactenutaaq iactenutaqa
iactenuaqta iactenuaqat iactenuatqa iactenuataq iactenuaatq iactenuaaqt iactenaaqut iactenaaqtu iactenaauqt iactenaautq
iactenaatuq iactenaatqu iactenaqaut iactenaqatu iactenaquat iactenaquta iactenaqtua iactenaqtau iactenauqat iactenauqta
iactenauaqt iactenauatq iactenautaq iactenautqa iactenatqua iactenatqau iactenatuqa iactenatuaq iactenatauq iactenataqu
iactetnaqua iactetnaqau iactetnauqa iactetnauaq iactetnaauq iactetnaaqu iactetnqaua iactetnqaau iactetnquaa iactetnquaa
iactetnqaua iactetnqaau iactetnuqaa iactetnuqaa iactetnuaqa iactetnuaaq iactetnuaaq iactetnuaqa iactetnaqua iactetnaqau
iactetnauqa iactetnauaq iactetnaauq iactetnaaqu iactetanqua iactetanqau iactetanuqa iactetanuaq iactetanauq iactetanaqu
iactetaqnua iactetaqnau iactetaquna iactetaquan iactetaqaun iactetaqanu iactetauqna iactetauqan iactetaunqa iactetaunaq
iactetauanq iactetauaqn iactetaaqun iactetaaqnu iactetaauqn iactetaaunq iactetaanuq iactetaanqu iactetqanua iactetqanau
iactetqauna iactetqauan iactetqaaun iactetqaanu iactetqnaua iactetqnaau iactetqnuaa iactetqnuaa iactetqnaua iactetqnaau
iactetqunaa iactetqunaa iactetquana iactetquaan iactetquaan iactetquana iactetqanua iactetqanau iactetqauna iactetqauan
iactetqaaun iactetqaanu iactetuaqna iactetuaqan iactetuanqa iactetuanaq iactetuaanq iactetuaaqn iactetuqana iactetuqaan
iactetuqnaa iactetuqnaa iactetuqana iactetuqaan iactetunqaa iactetunqaa iactetunaqa iactetunaaq iactetunaaq iactetunaqa
iactetuaqna iactetuaqan iactetuanqa iactetuanaq iactetuaanq iactetuaaqn iactetaaqun iactetaaqnu iactetaauqn iactetaaunq
iactetaanuq iactetaanqu iactetaqaun iactetaqanu iactetaquan iactetaquna iactetaqnua iactetaqnau iactetauqan iactetauqna
iactetauaqn iactetauanq iactetaunaq iactetaunqa iactetanqua iactetanqau iactetanuqa iactetanuaq iactetanauq iactetanaqu
iacteatnqua iacteatnqau iacteatnuqa iacteatnuaq iacteatnauq iacteatnaqu iacteatqnua iacteatqnau iacteatquna iacteatquan
iacteatqaun iacteatqanu iacteatuqna iacteatuqan iacteatunqa iacteatunaq iacteatuanq iacteatuaqn iacteataqun iacteataqnu
iacteatauqn iacteataunq iacteatanuq iacteatanqu iacteantqua iacteantqau iacteantuqa iacteantuaq iacteantauq iacteantaqu
iacteanqtua iacteanqtau iacteanquta iacteanquat iacteanqaut iacteanqatu iacteanuqta iacteanuqat iacteanutqa iacteanutaq
iacteanuatq iacteanuaqt iacteanaqut iacteanaqtu iacteanauqt iacteanautq iacteanatuq iacteanatqu iacteaqntua iacteaqntau
iacteaqnuta iacteaqnuat iacteaqnaut iacteaqnatu iacteaqtnua iacteaqtnau iacteaqtuna iacteaqtuan iacteaqtaun iacteaqtanu
iacteaqutna iacteaqutan iacteaqunta iacteaqunat iacteaquant iacteaquatn iacteaqatun iacteaqatnu iacteaqautn iacteaqaunt
iacteaqanut iacteaqantu iacteaunqta iacteaunqat iacteauntqa iacteauntaq iacteaunatq iacteaunaqt iacteauqnta iacteauqnat
iacteauqtna iacteauqtan iacteauqatn iacteauqant iacteautqna iacteautqan iacteautnqa iacteautnaq iacteautanq iacteautaqn
iacteauaqtn iacteauaqnt iacteauatqn iacteauatnq iacteauantq iacteauanqt iacteaanqut iacteaanqtu iacteaanuqt iacteaanutq
iacteaantuq iacteaantqu iacteaaqnut iacteaaqntu iacteaaqunt iacteaaqutn iacteaaqtun iacteaaqtnu iacteaauqnt iacteaauqtn
iacteaaunqt iacteaauntq iacteaautnq iacteaautqn iacteaatqun iacteaatqnu iacteaatuqn iacteaatunq iacteaatnuq iacteaatnqu
iacteqtanua iacteqtanau iacteqtauna iacteqtauan iacteqtaaun iacteqtaanu iacteqtnaua iacteqtnaau iacteqtnuaa iacteqtnuaa
iacteqtnaua iacteqtnaau iacteqtunaa iacteqtunaa iacteqtuana iacteqtuaan iacteqtuaan iacteqtuana iacteqtanua iacteqtanau
iacteqtauna iacteqtauan iacteqtaaun iacteqtaanu iacteqatnua iacteqatnau iacteqatuna iacteqatuan iacteqataun iacteqatanu
iacteqantua iacteqantau iacteqanuta iacteqanuat iacteqanaut iacteqanatu iacteqaunta iacteqaunat iacteqautna iacteqautan
iacteqauatn iacteqauant iacteqaanut iacteqaantu iacteqaaunt iacteqaautn iacteqaatun iacteqaatnu iacteqnatua iacteqnatau
iacteqnauta iacteqnauat iacteqnaaut iacteqnaatu iacteqntaua iacteqntaau iacteqntuaa iacteqntuaa iacteqntaua iacteqntaau
iacteqnutaa iacteqnutaa iacteqnuata iacteqnuaat iacteqnuaat iacteqnuata iacteqnatua iacteqnatau iacteqnauta iacteqnauat
iacteqnaaut iacteqnaatu iactequanta iactequanat iactequatna iactequatan iactequaatn iactequaant iactequnata iactequnaat
iactequntaa iactequntaa iactequnata iactequnaat iactequtnaa iactequtnaa iactequtana iactequtaan iactequtaan iactequtana
iactequanta iactequanat iactequatna iactequatan iactequaatn iactequaant iacteqaanut iacteqaantu iacteqaaunt iacteqaautn
iacteqaatun iacteqaatnu iacteqanaut iacteqanatu iacteqanuat iacteqanuta iacteqantua iacteqantau iacteqaunat iacteqaunta
iacteqauant iacteqauatn iacteqautan iacteqautna iacteqatnua iacteqatnau iacteqatuna iacteqatuan iacteqataun iacteqatanu
iacteutaqna iacteutaqan iacteutanqa iacteutanaq iacteutaanq iacteutaaqn iacteutqana iacteutqaan iacteutqnaa iacteutqnaa
iacteutqana iacteutqaan iacteutnqaa iacteutnqaa iacteutnaqa iacteutnaaq iacteutnaaq iacteutnaqa iacteutaqna iacteutaqan
iacteutanqa iacteutanaq iacteutaanq iacteutaaqn iacteuatqna iacteuatqan iacteuatnqa iacteuatnaq iacteuatanq iacteuataqn
iacteuaqtna iacteuaqtan iacteuaqnta iacteuaqnat iacteuaqant iacteuaqatn iacteuanqta iacteuanqat iacteuantqa iacteuantaq
iacteuanatq iacteuanaqt iacteuaaqnt iacteuaaqtn iacteuaanqt iacteuaantq iacteuaatnq iacteuaatqn iacteuqatna iacteuqatan
iacteuqanta iacteuqanat iacteuqaant iacteuqaatn iacteuqtana iacteuqtaan iacteuqtnaa iacteuqtnaa iacteuqtana iacteuqtaan
iacteuqntaa iacteuqntaa iacteuqnata iacteuqnaat iacteuqnaat iacteuqnata iacteuqatna iacteuqatan iacteuqanta iacteuqanat
iacteuqaant iacteuqaatn iacteunaqta iacteunaqat iacteunatqa iacteunataq iacteunaatq iacteunaaqt iacteunqata iacteunqaat
iacteunqtaa iacteunqtaa iacteunqata iacteunqaat iacteuntqaa iacteuntqaa iacteuntaqa iacteuntaaq iacteuntaaq iacteuntaqa
iacteunaqta iacteunaqat iacteunatqa iacteunataq iacteunaatq iacteunaaqt iacteuaaqnt iacteuaaqtn iacteuaanqt iacteuaantq
iacteuaatnq iacteuaatqn iacteuaqant iacteuaqatn iacteuaqnat iacteuaqnta iacteuaqtna iacteuaqtan iacteuanqat iacteuanqta
iacteuanaqt iacteuanatq iacteuantaq iacteuantqa iacteuatqna iacteuatqan iacteuatnqa iacteuatnaq iacteuatanq iacteuataqn
iacteataqun iacteataqnu iacteatauqn iacteataunq iacteatanuq iacteatanqu iacteatqaun iacteatqanu iacteatquan iacteatquna
iacteatqnua iacteatqnau iacteatuqan iacteatuqna iacteatuaqn iacteatuanq iacteatunaq iacteatunqa iacteatnqua iacteatnqau
iacteatnuqa iacteatnuaq iacteatnauq iacteatnaqu iacteaatqun iacteaatqnu iacteaatuqn iacteaatunq iacteaatnuq iacteaatnqu
iacteaaqtun iacteaaqtnu iacteaaqutn iacteaaqunt iacteaaqnut iacteaaqntu iacteaauqtn iacteaauqnt iacteaautqn iacteaautnq
iacteaauntq iacteaaunqt iacteaanqut iacteaanqtu iacteaanuqt iacteaanutq iacteaantuq iacteaantqu iacteaqatun iacteaqatnu
iacteaqautn iacteaqaunt iacteaqanut iacteaqantu iacteaqtaun iacteaqtanu iacteaqtuan iacteaqtuna iacteaqtnua iacteaqtnau
iacteaqutan iacteaqutna iacteaquatn iacteaquant iacteaqunat iacteaqunta iacteaqntua iacteaqntau iacteaqnuta iacteaqnuat
iacteaqnaut iacteaqnatu iacteauaqtn iacteauaqnt iacteauatqn iacteauatnq iacteauantq iacteauanqt iacteauqatn iacteauqant
iacteauqtan iacteauqtna iacteauqnta iacteauqnat iacteautqan iacteautqna iacteautaqn iacteautanq iacteautnaq iacteautnqa
iacteaunqta iacteaunqat iacteauntqa iacteauntaq iacteaunatq iacteaunaqt iacteanaqut iacteanaqtu iacteanauqt iacteanautq
iacteanatuq iacteanatqu iacteanqaut iacteanqatu iacteanquat iacteanquta iacteanqtua iacteanqtau iacteanuqat iacteanuqta
iacteanuaqt iacteanuatq iacteanutaq iacteanutqa iacteantqua iacteantqau iacteantuqa iacteantuaq iacteantauq iacteantaqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us