easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

aegerrimeque

arcturus

cobblerless

limpkin

osteomancy

lectureproof

tedmund

vaccinal

orhonsoy

shapy

grizzliest

wickerman

bedgery

preromantic

diacaustic

redigested

flovilla

northhumberland


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: hoffler
cipher variations:
ipggmfs jqhhngt kriiohu lsjjpiv mtkkqjw
nullrkx ovmmsly pwnntmz qxoouna ryppvob
szqqwpc tarrxqd ubssyre vcttzsf wduuatg
xevvbuh yfwwcvi zgxxdwj ahyyexk bizzfyl
cjaagzm dkbbhan elccibo fmddjcp gneekdq

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: hoffler
Cipher: sluuovi

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: hoffler
Cipher: AABBB ABBAB AABAB AABAB ABABA AABAA BAAAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: hoffler
cipher variations:
ipggmfswrqqinaktaaeviyvkkadqmxuuwlyazeestgcdyykjwqfiigre
ehssczmsjccyhuglmmupcunwwqxkjqhhngtxsrrjoblubbfwjzwllber
nyvvxmzbafftuhdezzlkxrgjjhsffittdantkddzivhmnnvqdvoxxryl
kriiohuytsskpcmvccgxkaxmmcfsozwwynacbgguviefaamlyshkkitg
gjuuebouleeajwinoowrewpyyszmlsjjpivzuttlqdnwddhylbynndgt
paxxzobdchhvwjfgbbnmztilljuhhkvvfcpvmffbkxjoppxsfxqzztan
mtkkqjwavuumreoxeeizmczooehuqbyyapcediiwxkghcconaujmmkvi
ilwwgdqwnggclykpqqytgyraaubonullrkxbwvvnsfpyffjandappfiv
rczzbqdfejjxylhiddpobvknnlwjjmxxherxohhdmzlqrrzuhzsbbvcp
ovmmslycxwwotgqzggkboebqqgjwsdaacregfkkyzmijeeqpcwloomxk
knyyifsypiienamrssaviatccwdqpwnntmzdyxxpuhrahhlcpfcrrhkx
tebbdsfhgllzanjkffrqdxmppnyllozzjgtzqjjfobnsttbwjbuddxer
qxoounaezyyqvisbiimdqgdssilyufccetgihmmaboklggsreynqqozm
mpaakhuarkkgpcotuucxkcveeyfsryppvobfazzrwjtcjjnerhettjmz
vgddfuhjinnbcplmhhtsfzorrpannqbblivbsllhqdpuvvdyldwffzgt
szqqwpcgbaasxkudkkofsifuuknawheegvikjoocdqmniiutgapssqbo
orccmjwctmmireqvwwezmexggahutarrxqdhcbbtylvellpgtjgvvlob
xiffhwjlkppdernojjvuhbqttrcppsddnkxdunnjsfrwxxfanfyhhbiv
ubssyreidccuzmwfmmqhukhwwmpcyjggixkmlqqefsopkkwvicruusdq
qteeolyevooktgsxyygbogziicjwvcttzsfjeddvanxgnnrivlixxnqd
zkhhjylnmrrfgtpqllxwjdsvvterruffpmzfwppluhtyzzhcphajjdkx
wduuatgkfeewboyhoosjwmjyyorealiikzmonssghuqrmmyxketwwufs
svggqnagxqqmviuzaaidqibkkelyxevvbuhlgffxcpzipptkxnkzzpsf
bmjjlanpotthivrsnnzylfuxxvgttwhhrobhyrrnwjvabbjerjcllfmz
yfwwcvimhggydqajqqulyolaaqtgcnkkmboqpuuijwstooazmgvyywhu
uxiispcizssoxkwbcckfskdmmgnazgxxdwjnihhzerbkrrvmzpmbbruh
dollncprqvvjkxtuppbanhwzzxivvyjjtqdjattpylxcddlgtlennhob
ahyyexkojiiafsclsswnaqnccsviepmmodqsrwwklyuvqqcboixaayjw
wzkkurekbuuqzmydeemhumfooipcbizzfylpkjjbgtdmttxobroddtwj
fqnnpertsxxlmzvwrrdcpjybbzkxxallvsflcvvranzeffnivngppjqd
cjaagzmqlkkchuenuuypcspeeuxkgrooqfsutyymnawxssedqkzccaly
ybmmwtgmdwwsboafggojwohqqkredkbbhanrmlldivfovvzqdtqffvyl
hspprgtvuzznobxyttferladdbmzzcnnxuhnexxtcpbghhpkxpirrlsf
elccibosnmmejwgpwwareurggwzmitqqshuwvaaopcyzuugfsmbeecna
adooyviofyyudqchiiqlyqjssmtgfmddjcptonnfkxhqxxbsfvshhxan
jurrtivxwbbpqdzavvhgtncffdobbeppzwjpgzzverdijjrmzrkttnuh
gneekdqupooglyiryyctgwtiiybokvssujwyxccqreabwwihuodggepc
cfqqaxkqhaawfsejkksnasluuovihofflervqpphmzjszzduhxujjzcp
lwttvkxzyddrsfbcxxjivpehhfqddgrrbylribbxgtfklltobtmvvpwj

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: hoffler
Cipher: ubssyre

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: hoffler
Cipher: 32431212135124

Extended Methods:
Method #1

Plaintext: hoffler
method variations:
ntllqkwsyqqvpbxdvvaugciaafzm

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
h o f f l e r 
3 4 1 1 1 5 2 
2 3 2 2 3 1 4 
They are then read out in rows:
34111522322314
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: hoffler
Cipher: savghmq

Read more ...
Method #3

Plaintext: hoffler
method variations:
rcbbxfo cbbxfor bbxforc
bxforcb xforcbb forcbbx
orcbbxf

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: hoffler

all 5040 cipher variations:
hoffler hofflre hoffelr hofferl hoffrel hoffrle hoflfer hoflfre hoflefr hoflerf hoflref
hoflrfe hofelfr hofelrf hofeflr hofefrl hoferfl hoferlf hofrlef hofrlfe hofrelf hofrefl
hofrfel hofrfle hoffler hofflre hoffelr hofferl hoffrel hoffrle hoflfer hoflfre hoflefr
hoflerf hoflref hoflrfe hofelfr hofelrf hofeflr hofefrl hoferfl hoferlf hofrlef hofrlfe
hofrelf hofrefl hofrfel hofrfle holffer holffre holfefr holferf holfref holfrfe holffer
holffre holfefr holferf holfref holfrfe holeffr holefrf holeffr holefrf holerff holerff
holrfef holrffe holreff holreff holrfef holrffe hoeflfr hoeflrf hoefflr hoeffrl hoefrfl
hoefrlf hoelffr hoelfrf hoelffr hoelfrf hoelrff hoelrff hoeflfr hoeflrf hoefflr hoeffrl
hoefrfl hoefrlf hoerlff hoerlff hoerflf hoerffl hoerffl hoerflf horflef horflfe horfelf
horfefl horffel horffle horlfef horlffe horleff horleff horlfef horlffe horelff horelff
horeflf horeffl horeffl horeflf horflef horflfe horfelf horfefl horffel horffle hfofler
hfoflre hfofelr hfoferl hfofrel hfofrle hfolfer hfolfre hfolefr hfolerf hfolref hfolrfe
hfoelfr hfoelrf hfoeflr hfoefrl hfoerfl hfoerlf hforlef hforlfe hforelf hforefl hforfel
hforfle hffoler hffolre hffoelr hffoerl hfforel hfforle hffloer hfflore hffleor hfflero
hfflreo hfflroe hffelor hffelro hffeolr hffeorl hfferol hfferlo hffrleo hffrloe hffrelo
hffreol hffroel hffrole hflfoer hflfore hflfeor hflfero hflfreo hflfroe hflofer hflofre
hfloefr hfloerf hfloref hflorfe hfleofr hfleorf hflefor hflefro hflerfo hflerof hflroef
hflrofe hflreof hflrefo hflrfeo hflrfoe hfeflor hfeflro hfefolr hfeforl hfefrol hfefrlo
hfelfor hfelfro hfelofr hfelorf hfelrof hfelrfo hfeolfr hfeolrf hfeoflr hfeofrl hfeorfl
hfeorlf hferlof hferlfo hferolf hferofl hferfol hferflo hfrfleo hfrfloe hfrfelo hfrfeol
hfrfoel hfrfole hfrlfeo hfrlfoe hfrlefo hfrleof hfrloef hfrlofe hfrelfo hfrelof hfreflo
hfrefol hfreofl hfreolf hfrolef hfrolfe hfroelf hfroefl hfrofel hfrofle hffoler hffolre
hffoelr hffoerl hfforel hfforle hffloer hfflore hffleor hfflero hfflreo hfflroe hffelor
hffelro hffeolr hffeorl hfferol hfferlo hffrleo hffrloe hffrelo hffreol hffroel hffrole
hfofler hfoflre hfofelr hfoferl hfofrel hfofrle hfolfer hfolfre hfolefr hfolerf hfolref
hfolrfe hfoelfr hfoelrf hfoeflr hfoefrl hfoerfl hfoerlf hforlef hforlfe hforelf hforefl
hforfel hforfle hflofer hflofre hfloefr hfloerf hfloref hflorfe hflfoer hflfore hflfeor
hflfero hflfreo hflfroe hflefor hflefro hfleofr hfleorf hflerof hflerfo hflrfeo hflrfoe
hflrefo hflreof hflroef hflrofe hfeolfr hfeolrf hfeoflr hfeofrl hfeorfl hfeorlf hfelofr
hfelorf hfelfor hfelfro hfelrfo hfelrof hfeflor hfeflro hfefolr hfeforl hfefrol hfefrlo
hferlfo hferlof hferflo hferfol hferofl hferolf hfrolef hfrolfe hfroelf hfroefl hfrofel
hfrofle hfrloef hfrlofe hfrleof hfrlefo hfrlfeo hfrlfoe hfrelof hfrelfo hfreolf hfreofl
hfrefol hfreflo hfrfleo hfrfloe hfrfelo hfrfeol hfrfoel hfrfole hlffoer hlffore hlffeor
hlffero hlffreo hlffroe hlfofer hlfofre hlfoefr hlfoerf hlforef hlforfe hlfeofr hlfeorf
hlfefor hlfefro hlferfo hlferof hlfroef hlfrofe hlfreof hlfrefo hlfrfeo hlfrfoe hlffoer
hlffore hlffeor hlffero hlffreo hlffroe hlfofer hlfofre hlfoefr hlfoerf hlforef hlforfe
hlfeofr hlfeorf hlfefor hlfefro hlferfo hlferof hlfroef hlfrofe hlfreof hlfrefo hlfrfeo
hlfrfoe hloffer hloffre hlofefr hloferf hlofref hlofrfe hloffer hloffre hlofefr hloferf
hlofref hlofrfe hloeffr hloefrf hloeffr hloefrf hloerff hloerff hlorfef hlorffe hloreff
hloreff hlorfef hlorffe hlefofr hleforf hleffor hleffro hlefrfo hlefrof hleoffr hleofrf
hleoffr hleofrf hleorff hleorff hlefofr hleforf hleffor hleffro hlefrfo hlefrof hleroff
hleroff hlerfof hlerffo hlerffo hlerfof hlrfoef hlrfofe hlrfeof hlrfefo hlrffeo hlrffoe
hlrofef hlroffe hlroeff hlroeff hlrofef hlroffe hlreoff hlreoff hlrefof hlreffo hlreffo
hlrefof hlrfoef hlrfofe hlrfeof hlrfefo hlrffeo hlrffoe hefflor hefflro heffolr hefforl
heffrol heffrlo heflfor heflfro heflofr heflorf heflrof heflrfo hefolfr hefolrf hefoflr
hefofrl heforfl heforlf hefrlof hefrlfo hefrolf hefrofl hefrfol hefrflo hefflor hefflro
heffolr hefforl heffrol heffrlo heflfor heflfro heflofr heflorf heflrof heflrfo hefolfr
hefolrf hefoflr hefofrl heforfl heforlf hefrlof hefrlfo hefrolf hefrofl hefrfol hefrflo
helffor helffro helfofr helforf helfrof helfrfo helffor helffro helfofr helforf helfrof
helfrfo heloffr helofrf heloffr helofrf helorff helorff helrfof helrffo helroff helroff
helrfof helrffo heoflfr heoflrf heofflr heoffrl heofrfl heofrlf heolffr heolfrf heolffr
heolfrf heolrff heolrff heoflfr heoflrf heofflr heoffrl heofrfl heofrlf heorlff heorlff
heorflf heorffl heorffl heorflf herflof herflfo herfolf herfofl herffol herfflo herlfof
herlffo herloff herloff herlfof herlffo herolff herolff heroflf heroffl heroffl heroflf
herflof herflfo herfolf herfofl herffol herfflo hrffleo hrffloe hrffelo hrffeol hrffoel
hrffole hrflfeo hrflfoe hrflefo hrfleof hrfloef hrflofe hrfelfo hrfelof hrfeflo hrfefol
hrfeofl hrfeolf hrfolef hrfolfe hrfoelf hrfoefl hrfofel hrfofle hrffleo hrffloe hrffelo
hrffeol hrffoel hrffole hrflfeo hrflfoe hrflefo hrfleof hrfloef hrflofe hrfelfo hrfelof
hrfeflo hrfefol hrfeofl hrfeolf hrfolef hrfolfe hrfoelf hrfoefl hrfofel hrfofle hrlffeo
hrlffoe hrlfefo hrlfeof hrlfoef hrlfofe hrlffeo hrlffoe hrlfefo hrlfeof hrlfoef hrlfofe
hrleffo hrlefof hrleffo hrlefof hrleoff hrleoff hrlofef hrloffe hrloeff hrloeff hrlofef
hrloffe hreflfo hreflof hrefflo hreffol hrefofl hrefolf hrelffo hrelfof hrelffo hrelfof
hreloff hreloff hreflfo hreflof hrefflo hreffol hrefofl hrefolf hreolff hreolff hreoflf
hreoffl hreoffl hreoflf hroflef hroflfe hrofelf hrofefl hroffel hroffle hrolfef hrolffe
hroleff hroleff hrolfef hrolffe hroelff hroelff hroeflf hroeffl hroeffl hroeflf hroflef
hroflfe hrofelf hrofefl hroffel hroffle ohffler ohfflre ohffelr ohfferl ohffrel ohffrle
ohflfer ohflfre ohflefr ohflerf ohflref ohflrfe ohfelfr ohfelrf ohfeflr ohfefrl ohferfl
ohferlf ohfrlef ohfrlfe ohfrelf ohfrefl ohfrfel ohfrfle ohffler ohfflre ohffelr ohfferl
ohffrel ohffrle ohflfer ohflfre ohflefr ohflerf ohflref ohflrfe ohfelfr ohfelrf ohfeflr
ohfefrl ohferfl ohferlf ohfrlef ohfrlfe ohfrelf ohfrefl ohfrfel ohfrfle ohlffer ohlffre
ohlfefr ohlferf ohlfref ohlfrfe ohlffer ohlffre ohlfefr ohlferf ohlfref ohlfrfe ohleffr
ohlefrf ohleffr ohlefrf ohlerff ohlerff ohlrfef ohlrffe ohlreff ohlreff ohlrfef ohlrffe
oheflfr oheflrf ohefflr oheffrl ohefrfl ohefrlf ohelffr ohelfrf ohelffr ohelfrf ohelrff
ohelrff oheflfr oheflrf ohefflr oheffrl ohefrfl ohefrlf oherlff oherlff oherflf oherffl
oherffl oherflf ohrflef ohrflfe ohrfelf ohrfefl ohrffel ohrffle ohrlfef ohrlffe ohrleff
ohrleff ohrlfef ohrlffe ohrelff ohrelff ohreflf ohreffl ohreffl ohreflf ohrflef ohrflfe
ohrfelf ohrfefl ohrffel ohrffle ofhfler ofhflre ofhfelr ofhferl ofhfrel ofhfrle ofhlfer
ofhlfre ofhlefr ofhlerf ofhlref ofhlrfe ofhelfr ofhelrf ofheflr ofhefrl ofherfl ofherlf
ofhrlef ofhrlfe ofhrelf ofhrefl ofhrfel ofhrfle offhler offhlre offhelr offherl offhrel
offhrle offlher offlhre offlehr offlerh offlreh offlrhe offelhr offelrh offehlr offehrl
offerhl offerlh offrleh offrlhe offrelh offrehl offrhel offrhle oflfher oflfhre oflfehr
oflferh oflfreh oflfrhe oflhfer oflhfre oflhefr oflherf oflhref oflhrfe oflehfr oflehrf
oflefhr oflefrh oflerfh oflerhf oflrhef oflrhfe oflrehf oflrefh oflrfeh oflrfhe ofeflhr
ofeflrh ofefhlr ofefhrl ofefrhl ofefrlh ofelfhr ofelfrh ofelhfr ofelhrf ofelrhf ofelrfh
ofehlfr ofehlrf ofehflr ofehfrl ofehrfl ofehrlf oferlhf oferlfh oferhlf oferhfl oferfhl
oferflh ofrfleh ofrflhe ofrfelh ofrfehl ofrfhel ofrfhle ofrlfeh ofrlfhe ofrlefh ofrlehf
ofrlhef ofrlhfe ofrelfh ofrelhf ofreflh ofrefhl ofrehfl ofrehlf ofrhlef ofrhlfe ofrhelf
ofrhefl ofrhfel ofrhfle offhler offhlre offhelr offherl offhrel offhrle offlher offlhre
offlehr offlerh offlreh offlrhe offelhr offelrh offehlr offehrl offerhl offerlh offrleh
offrlhe offrelh offrehl offrhel offrhle ofhfler ofhflre ofhfelr ofhferl ofhfrel ofhfrle
ofhlfer ofhlfre ofhlefr ofhlerf ofhlref ofhlrfe ofhelfr ofhelrf ofheflr ofhefrl ofherfl
ofherlf ofhrlef ofhrlfe ofhrelf ofhrefl ofhrfel ofhrfle oflhfer oflhfre oflhefr oflherf
oflhref oflhrfe oflfher oflfhre oflfehr oflferh oflfreh oflfrhe oflefhr oflefrh oflehfr
oflehrf oflerhf oflerfh oflrfeh oflrfhe oflrefh oflrehf oflrhef oflrhfe ofehlfr ofehlrf
ofehflr ofehfrl ofehrfl ofehrlf ofelhfr ofelhrf ofelfhr ofelfrh ofelrfh ofelrhf ofeflhr
ofeflrh ofefhlr ofefhrl ofefrhl ofefrlh oferlfh oferlhf oferflh oferfhl oferhfl oferhlf
ofrhlef ofrhlfe ofrhelf ofrhefl ofrhfel ofrhfle ofrlhef ofrlhfe ofrlehf ofrlefh ofrlfeh
ofrlfhe ofrelhf ofrelfh ofrehlf ofrehfl ofrefhl ofreflh ofrfleh ofrflhe ofrfelh ofrfehl
ofrfhel ofrfhle olffher olffhre olffehr olfferh olffreh olffrhe olfhfer olfhfre olfhefr
olfherf olfhref olfhrfe olfehfr olfehrf olfefhr olfefrh olferfh olferhf olfrhef olfrhfe
olfrehf olfrefh olfrfeh olfrfhe olffher olffhre olffehr olfferh olffreh olffrhe olfhfer
olfhfre olfhefr olfherf olfhref olfhrfe olfehfr olfehrf olfefhr olfefrh olferfh olferhf
olfrhef olfrhfe olfrehf olfrefh olfrfeh olfrfhe olhffer olhffre olhfefr olhferf olhfref
olhfrfe olhffer olhffre olhfefr olhferf olhfref olhfrfe olheffr olhefrf olheffr olhefrf
olherff olherff olhrfef olhrffe olhreff olhreff olhrfef olhrffe olefhfr olefhrf oleffhr
oleffrh olefrfh olefrhf olehffr olehfrf olehffr olehfrf olehrff olehrff olefhfr olefhrf
oleffhr oleffrh olefrfh olefrhf olerhff olerhff olerfhf olerffh olerffh olerfhf olrfhef
olrfhfe olrfehf olrfefh olrffeh olrffhe olrhfef olrhffe olrheff olrheff olrhfef olrhffe
olrehff olrehff olrefhf olreffh olreffh olrefhf olrfhef olrfhfe olrfehf olrfefh olrffeh
olrffhe oefflhr oefflrh oeffhlr oeffhrl oeffrhl oeffrlh oeflfhr oeflfrh oeflhfr oeflhrf
oeflrhf oeflrfh oefhlfr oefhlrf oefhflr oefhfrl oefhrfl oefhrlf oefrlhf oefrlfh oefrhlf
oefrhfl oefrfhl oefrflh oefflhr oefflrh oeffhlr oeffhrl oeffrhl oeffrlh oeflfhr oeflfrh
oeflhfr oeflhrf oeflrhf oeflrfh oefhlfr oefhlrf oefhflr oefhfrl oefhrfl oefhrlf oefrlhf
oefrlfh oefrhlf oefrhfl oefrfhl oefrflh oelffhr oelffrh oelfhfr oelfhrf oelfrhf oelfrfh
oelffhr oelffrh oelfhfr oelfhrf oelfrhf oelfrfh oelhffr oelhfrf oelhffr oelhfrf oelhrff
oelhrff oelrfhf oelrffh oelrhff oelrhff oelrfhf oelrffh oehflfr oehflrf oehfflr oehffrl
oehfrfl oehfrlf oehlffr oehlfrf oehlffr oehlfrf oehlrff oehlrff oehflfr oehflrf oehfflr
oehffrl oehfrfl oehfrlf oehrlff oehrlff oehrflf oehrffl oehrffl oehrflf oerflhf oerflfh
oerfhlf oerfhfl oerffhl oerfflh oerlfhf oerlffh oerlhff oerlhff oerlfhf oerlffh oerhlff
oerhlff oerhflf oerhffl oerhffl oerhflf oerflhf oerflfh oerfhlf oerfhfl oerffhl oerfflh
orffleh orfflhe orffelh orffehl orffhel orffhle orflfeh orflfhe orflefh orflehf orflhef
orflhfe orfelfh orfelhf orfeflh orfefhl orfehfl orfehlf orfhlef orfhlfe orfhelf orfhefl
orfhfel orfhfle orffleh orfflhe orffelh orffehl orffhel orffhle orflfeh orflfhe orflefh
orflehf orflhef orflhfe orfelfh orfelhf orfeflh orfefhl orfehfl orfehlf orfhlef orfhlfe
orfhelf orfhefl orfhfel orfhfle orlffeh orlffhe orlfefh orlfehf orlfhef orlfhfe orlffeh
orlffhe orlfefh orlfehf orlfhef orlfhfe orleffh orlefhf orleffh orlefhf orlehff orlehff
orlhfef orlhffe orlheff orlheff orlhfef orlhffe oreflfh oreflhf orefflh oreffhl orefhfl
orefhlf orelffh orelfhf orelffh orelfhf orelhff orelhff oreflfh oreflhf orefflh oreffhl
orefhfl orefhlf orehlff orehlff orehflf orehffl orehffl orehflf orhflef orhflfe orhfelf
orhfefl orhffel orhffle orhlfef orhlffe orhleff orhleff orhlfef orhlffe orhelff orhelff
orheflf orheffl orheffl orheflf orhflef orhflfe orhfelf orhfefl orhffel orhffle fohfler
fohflre fohfelr fohferl fohfrel fohfrle fohlfer fohlfre fohlefr fohlerf fohlref fohlrfe
fohelfr fohelrf foheflr fohefrl foherfl foherlf fohrlef fohrlfe fohrelf fohrefl fohrfel
fohrfle fofhler fofhlre fofhelr fofherl fofhrel fofhrle foflher foflhre foflehr foflerh
foflreh foflrhe fofelhr fofelrh fofehlr fofehrl foferhl foferlh fofrleh fofrlhe fofrelh
fofrehl fofrhel fofrhle folfher folfhre folfehr folferh folfreh folfrhe folhfer folhfre
folhefr folherf folhref folhrfe folehfr folehrf folefhr folefrh folerfh folerhf folrhef
folrhfe folrehf folrefh folrfeh folrfhe foeflhr foeflrh foefhlr foefhrl foefrhl foefrlh
foelfhr foelfrh foelhfr foelhrf foelrhf foelrfh foehlfr foehlrf foehflr foehfrl foehrfl
foehrlf foerlhf foerlfh foerhlf foerhfl foerfhl foerflh forfleh forflhe forfelh forfehl
forfhel forfhle forlfeh forlfhe forlefh forlehf forlhef forlhfe forelfh forelhf foreflh
forefhl forehfl forehlf forhlef forhlfe forhelf forhefl forhfel forhfle fhofler fhoflre
fhofelr fhoferl fhofrel fhofrle fholfer fholfre fholefr fholerf fholref fholrfe fhoelfr
fhoelrf fhoeflr fhoefrl fhoerfl fhoerlf fhorlef fhorlfe fhorelf fhorefl fhorfel fhorfle
fhfoler fhfolre fhfoelr fhfoerl fhforel fhforle fhfloer fhflore fhfleor fhflero fhflreo
fhflroe fhfelor fhfelro fhfeolr fhfeorl fhferol fhferlo fhfrleo fhfrloe fhfrelo fhfreol
fhfroel fhfrole fhlfoer fhlfore fhlfeor fhlfero fhlfreo fhlfroe fhlofer fhlofre fhloefr
fhloerf fhloref fhlorfe fhleofr fhleorf fhlefor fhlefro fhlerfo fhlerof fhlroef fhlrofe
fhlreof fhlrefo fhlrfeo fhlrfoe fheflor fheflro fhefolr fheforl fhefrol fhefrlo fhelfor
fhelfro fhelofr fhelorf fhelrof fhelrfo fheolfr fheolrf fheoflr fheofrl fheorfl fheorlf
fherlof fherlfo fherolf fherofl fherfol fherflo fhrfleo fhrfloe fhrfelo fhrfeol fhrfoel
fhrfole fhrlfeo fhrlfoe fhrlefo fhrleof fhrloef fhrlofe fhrelfo fhrelof fhreflo fhrefol
fhreofl fhreolf fhrolef fhrolfe fhroelf fhroefl fhrofel fhrofle ffholer ffholre ffhoelr
ffhoerl ffhorel ffhorle ffhloer ffhlore ffhleor ffhlero ffhlreo ffhlroe ffhelor ffhelro
ffheolr ffheorl ffherol ffherlo ffhrleo ffhrloe ffhrelo ffhreol ffhroel ffhrole ffohler
ffohlre ffohelr ffoherl ffohrel ffohrle ffolher ffolhre ffolehr ffolerh ffolreh ffolrhe
ffoelhr ffoelrh ffoehlr ffoehrl ffoerhl ffoerlh fforleh fforlhe fforelh fforehl fforhel
fforhle ffloher fflohre ffloehr ffloerh ffloreh fflorhe fflhoer fflhore fflheor fflhero
fflhreo fflhroe fflehor fflehro ffleohr ffleorh ffleroh fflerho fflrheo fflrhoe fflreho
fflreoh fflroeh fflrohe ffeolhr ffeolrh ffeohlr ffeohrl ffeorhl ffeorlh ffelohr ffelorh
ffelhor ffelhro ffelrho ffelroh ffehlor ffehlro ffeholr ffehorl ffehrol ffehrlo fferlho
fferloh fferhlo fferhol fferohl fferolh ffroleh ffrolhe ffroelh ffroehl ffrohel ffrohle
ffrloeh ffrlohe ffrleoh ffrleho ffrlheo ffrlhoe ffreloh ffrelho ffreolh ffreohl ffrehol
ffrehlo ffrhleo ffrhloe ffrhelo ffrheol ffrhoel ffrhole flhfoer flhfore flhfeor flhfero
flhfreo flhfroe flhofer flhofre flhoefr flhoerf flhoref flhorfe flheofr flheorf flhefor
flhefro flherfo flherof flhroef flhrofe flhreof flhrefo flhrfeo flhrfoe flfhoer flfhore
flfheor flfhero flfhreo flfhroe flfoher flfohre flfoehr flfoerh flforeh flforhe flfeohr
flfeorh flfehor flfehro flferho flferoh flfroeh flfrohe flfreoh flfreho flfrheo flfrhoe
flofher flofhre flofehr floferh flofreh flofrhe flohfer flohfre flohefr floherf flohref
flohrfe floehfr floehrf floefhr floefrh floerfh floerhf florhef florhfe florehf florefh
florfeh florfhe flefohr fleforh flefhor flefhro flefrho flefroh fleofhr fleofrh fleohfr
fleohrf fleorhf fleorfh flehofr flehorf flehfor flehfro flehrfo flehrof flerohf flerofh
flerhof flerhfo flerfho flerfoh flrfoeh flrfohe flrfeoh flrfeho flrfheo flrfhoe flrofeh
flrofhe flroefh flroehf flrohef flrohfe flreofh flreohf flrefoh flrefho flrehfo flrehof
flrhoef flrhofe flrheof flrhefo flrhfeo flrhfoe fehflor fehflro fehfolr fehforl fehfrol
fehfrlo fehlfor fehlfro fehlofr fehlorf fehlrof fehlrfo feholfr feholrf fehoflr fehofrl
fehorfl fehorlf fehrlof fehrlfo fehrolf fehrofl fehrfol fehrflo fefhlor fefhlro fefholr
fefhorl fefhrol fefhrlo feflhor feflhro feflohr feflorh feflroh feflrho fefolhr fefolrh
fefohlr fefohrl feforhl feforlh fefrloh fefrlho fefrolh fefrohl fefrhol fefrhlo felfhor
felfhro felfohr felforh felfroh felfrho felhfor felhfro felhofr felhorf felhrof felhrfo
felohfr felohrf felofhr felofrh felorfh felorhf felrhof felrhfo felrohf felrofh felrfoh
felrfho feoflhr feoflrh feofhlr feofhrl feofrhl feofrlh feolfhr feolfrh feolhfr feolhrf
feolrhf feolrfh feohlfr feohlrf feohflr feohfrl feohrfl feohrlf feorlhf feorlfh feorhlf
feorhfl feorfhl feorflh ferfloh ferflho ferfolh ferfohl ferfhol ferfhlo ferlfoh ferlfho
ferlofh ferlohf ferlhof ferlhfo ferolfh ferolhf feroflh ferofhl ferohfl ferohlf ferhlof
ferhlfo ferholf ferhofl ferhfol ferhflo frhfleo frhfloe frhfelo frhfeol frhfoel frhfole
frhlfeo frhlfoe frhlefo frhleof frhloef frhlofe frhelfo frhelof frheflo frhefol frheofl
frheolf frholef frholfe frhoelf frhoefl frhofel frhofle frfhleo frfhloe frfhelo frfheol
frfhoel frfhole frflheo frflhoe frfleho frfleoh frfloeh frflohe frfelho frfeloh frfehlo
frfehol frfeohl frfeolh frfoleh frfolhe frfoelh frfoehl frfohel frfohle frlfheo frlfhoe
frlfeho frlfeoh frlfoeh frlfohe frlhfeo frlhfoe frlhefo frlheof frlhoef frlhofe frlehfo
frlehof frlefho frlefoh frleofh frleohf frlohef frlohfe frloehf frloefh frlofeh frlofhe
freflho frefloh frefhlo frefhol frefohl frefolh frelfho frelfoh frelhfo frelhof frelohf
frelofh frehlfo frehlof frehflo frehfol frehofl freholf freolhf freolfh freohlf freohfl
freofhl freoflh frofleh froflhe frofelh frofehl frofhel frofhle frolfeh frolfhe frolefh
frolehf frolhef frolhfe froelfh froelhf froeflh froefhl froehfl froehlf frohlef frohlfe
frohelf frohefl frohfel frohfle fofhler fofhlre fofhelr fofherl fofhrel fofhrle foflher
foflhre foflehr foflerh foflreh foflrhe fofelhr fofelrh fofehlr fofehrl foferhl foferlh
fofrleh fofrlhe fofrelh fofrehl fofrhel fofrhle fohfler fohflre fohfelr fohferl fohfrel
fohfrle fohlfer fohlfre fohlefr fohlerf fohlref fohlrfe fohelfr fohelrf foheflr fohefrl
foherfl foherlf fohrlef fohrlfe fohrelf fohrefl fohrfel fohrfle folhfer folhfre folhefr
folherf folhref folhrfe folfher folfhre folfehr folferh folfreh folfrhe folefhr folefrh
folehfr folehrf folerhf folerfh folrfeh folrfhe folrefh folrehf folrhef folrhfe foehlfr
foehlrf foehflr foehfrl foehrfl foehrlf foelhfr foelhrf foelfhr foelfrh foelrfh foelrhf
foeflhr foeflrh foefhlr foefhrl foefrhl foefrlh foerlfh foerlhf foerflh foerfhl foerhfl
foerhlf forhlef forhlfe forhelf forhefl forhfel forhfle forlhef forlhfe forlehf forlefh
forlfeh forlfhe forelhf forelfh forehlf forehfl forefhl foreflh forfleh forflhe forfelh
forfehl forfhel forfhle ffohler ffohlre ffohelr ffoherl ffohrel ffohrle ffolher ffolhre
ffolehr ffolerh ffolreh ffolrhe ffoelhr ffoelrh ffoehlr ffoehrl ffoerhl ffoerlh fforleh
fforlhe fforelh fforehl fforhel fforhle ffholer ffholre ffhoelr ffhoerl ffhorel ffhorle
ffhloer ffhlore ffhleor ffhlero ffhlreo ffhlroe ffhelor ffhelro ffheolr ffheorl ffherol
ffherlo ffhrleo ffhrloe ffhrelo ffhreol ffhroel ffhrole fflhoer fflhore fflheor fflhero
fflhreo fflhroe ffloher fflohre ffloehr ffloerh ffloreh fflorhe ffleohr ffleorh fflehor
fflehro fflerho ffleroh fflroeh fflrohe fflreoh fflreho fflrheo fflrhoe ffehlor ffehlro
ffeholr ffehorl ffehrol ffehrlo ffelhor ffelhro ffelohr ffelorh ffelroh ffelrho ffeolhr
ffeolrh ffeohlr ffeohrl ffeorhl ffeorlh fferloh fferlho fferolh fferohl fferhol fferhlo
ffrhleo ffrhloe ffrhelo ffrheol ffrhoel ffrhole ffrlheo ffrlhoe ffrleho ffrleoh ffrloeh
ffrlohe ffrelho ffreloh ffrehlo ffrehol ffreohl ffreolh ffroleh ffrolhe ffroelh ffroehl
ffrohel ffrohle fhfoler fhfolre fhfoelr fhfoerl fhforel fhforle fhfloer fhflore fhfleor
fhflero fhflreo fhflroe fhfelor fhfelro fhfeolr fhfeorl fhferol fhferlo fhfrleo fhfrloe
fhfrelo fhfreol fhfroel fhfrole fhofler fhoflre fhofelr fhoferl fhofrel fhofrle fholfer
fholfre fholefr fholerf fholref fholrfe fhoelfr fhoelrf fhoeflr fhoefrl fhoerfl fhoerlf
fhorlef fhorlfe fhorelf fhorefl fhorfel fhorfle fhlofer fhlofre fhloefr fhloerf fhloref
fhlorfe fhlfoer fhlfore fhlfeor fhlfero fhlfreo fhlfroe fhlefor fhlefro fhleofr fhleorf
fhlerof fhlerfo fhlrfeo fhlrfoe fhlrefo fhlreof fhlroef fhlrofe fheolfr fheolrf fheoflr
fheofrl fheorfl fheorlf fhelofr fhelorf fhelfor fhelfro fhelrfo fhelrof fheflor fheflro
fhefolr fheforl fhefrol fhefrlo fherlfo fherlof fherflo fherfol fherofl fherolf fhrolef
fhrolfe fhroelf fhroefl fhrofel fhrofle fhrloef fhrlofe fhrleof fhrlefo fhrlfeo fhrlfoe
fhrelof fhrelfo fhreolf fhreofl fhrefol fhreflo fhrfleo fhrfloe fhrfelo fhrfeol fhrfoel
fhrfole flfhoer flfhore flfheor flfhero flfhreo flfhroe flfoher flfohre flfoehr flfoerh
flforeh flforhe flfeohr flfeorh flfehor flfehro flferho flferoh flfroeh flfrohe flfreoh
flfreho flfrheo flfrhoe flhfoer flhfore flhfeor flhfero flhfreo flhfroe flhofer flhofre
flhoefr flhoerf flhoref flhorfe flheofr flheorf flhefor flhefro flherfo flherof flhroef
flhrofe flhreof flhrefo flhrfeo flhrfoe flohfer flohfre flohefr floherf flohref flohrfe
flofher flofhre flofehr floferh flofreh flofrhe floefhr floefrh floehfr floehrf floerhf
floerfh florfeh florfhe florefh florehf florhef florhfe flehofr flehorf flehfor flehfro
flehrfo flehrof fleohfr fleohrf fleofhr fleofrh fleorfh fleorhf flefohr fleforh flefhor
flefhro flefrho flefroh flerofh flerohf flerfoh flerfho flerhfo flerhof flrhoef flrhofe
flrheof flrhefo flrhfeo flrhfoe flrohef flrohfe flroehf flroefh flrofeh flrofhe flreohf
flreofh flrehof flrehfo flrefho flrefoh flrfoeh flrfohe flrfeoh flrfeho flrfheo flrfhoe
fefhlor fefhlro fefholr fefhorl fefhrol fefhrlo feflhor feflhro feflohr feflorh feflroh
feflrho fefolhr fefolrh fefohlr fefohrl feforhl feforlh fefrloh fefrlho fefrolh fefrohl
fefrhol fefrhlo fehflor fehflro fehfolr fehforl fehfrol fehfrlo fehlfor fehlfro fehlofr
fehlorf fehlrof fehlrfo feholfr feholrf fehoflr fehofrl fehorfl fehorlf fehrlof fehrlfo
fehrolf fehrofl fehrfol fehrflo felhfor felhfro felhofr felhorf felhrof felhrfo felfhor
felfhro felfohr felforh felfroh felfrho felofhr felofrh felohfr felohrf felorhf felorfh
felrfoh felrfho felrofh felrohf felrhof felrhfo feohlfr feohlrf feohflr feohfrl feohrfl
feohrlf feolhfr feolhrf feolfhr feolfrh feolrfh feolrhf feoflhr feoflrh feofhlr feofhrl
feofrhl feofrlh feorlfh feorlhf feorflh feorfhl feorhfl feorhlf ferhlof ferhlfo ferholf
ferhofl ferhfol ferhflo ferlhof ferlhfo ferlohf ferlofh ferlfoh ferlfho ferolhf ferolfh
ferohlf ferohfl ferofhl feroflh ferfloh ferflho ferfolh ferfohl ferfhol ferfhlo frfhleo
frfhloe frfhelo frfheol frfhoel frfhole frflheo frflhoe frfleho frfleoh frfloeh frflohe
frfelho frfeloh frfehlo frfehol frfeohl frfeolh frfoleh frfolhe frfoelh frfoehl frfohel
frfohle frhfleo frhfloe frhfelo frhfeol frhfoel frhfole frhlfeo frhlfoe frhlefo frhleof
frhloef frhlofe frhelfo frhelof frheflo frhefol frheofl frheolf frholef frholfe frhoelf
frhoefl frhofel frhofle frlhfeo frlhfoe frlhefo frlheof frlhoef frlhofe frlfheo frlfhoe
frlfeho frlfeoh frlfoeh frlfohe frlefho frlefoh frlehfo frlehof frleohf frleofh frlofeh
frlofhe frloefh frloehf frlohef frlohfe frehlfo frehlof frehflo frehfol frehofl freholf
frelhfo frelhof frelfho frelfoh frelofh frelohf freflho frefloh frefhlo frefhol frefohl
frefolh freolfh freolhf freoflh freofhl freohfl freohlf frohlef frohlfe frohelf frohefl
frohfel frohfle frolhef frolhfe frolehf frolefh frolfeh frolfhe froelhf froelfh froehlf
froehfl froefhl froeflh frofleh froflhe frofelh frofehl frofhel frofhle loffher loffhre
loffehr lofferh loffreh loffrhe lofhfer lofhfre lofhefr lofherf lofhref lofhrfe lofehfr
lofehrf lofefhr lofefrh loferfh loferhf lofrhef lofrhfe lofrehf lofrefh lofrfeh lofrfhe
loffher loffhre loffehr lofferh loffreh loffrhe lofhfer lofhfre lofhefr lofherf lofhref
lofhrfe lofehfr lofehrf lofefhr lofefrh loferfh loferhf lofrhef lofrhfe lofrehf lofrefh
lofrfeh lofrfhe lohffer lohffre lohfefr lohferf lohfref lohfrfe lohffer lohffre lohfefr
lohferf lohfref lohfrfe loheffr lohefrf loheffr lohefrf loherff loherff lohrfef lohrffe
lohreff lohreff lohrfef lohrffe loefhfr loefhrf loeffhr loeffrh loefrfh loefrhf loehffr
loehfrf loehffr loehfrf loehrff loehrff loefhfr loefhrf loeffhr loeffrh loefrfh loefrhf
loerhff loerhff loerfhf loerffh loerffh loerfhf lorfhef lorfhfe lorfehf lorfefh lorffeh
lorffhe lorhfef lorhffe lorheff lorheff lorhfef lorhffe lorehff lorehff lorefhf loreffh
loreffh lorefhf lorfhef lorfhfe lorfehf lorfefh lorffeh lorffhe lfofher lfofhre lfofehr
lfoferh lfofreh lfofrhe lfohfer lfohfre lfohefr lfoherf lfohref lfohrfe lfoehfr lfoehrf
lfoefhr lfoefrh lfoerfh lfoerhf lforhef lforhfe lforehf lforefh lforfeh lforfhe lffoher
lffohre lffoehr lffoerh lfforeh lfforhe lffhoer lffhore lffheor lffhero lffhreo lffhroe
lffehor lffehro lffeohr lffeorh lfferoh lfferho lffrheo lffrhoe lffreho lffreoh lffroeh
lffrohe lfhfoer lfhfore lfhfeor lfhfero lfhfreo lfhfroe lfhofer lfhofre lfhoefr lfhoerf
lfhoref lfhorfe lfheofr lfheorf lfhefor lfhefro lfherfo lfherof lfhroef lfhrofe lfhreof
lfhrefo lfhrfeo lfhrfoe lfefhor lfefhro lfefohr lfeforh lfefroh lfefrho lfehfor lfehfro
lfehofr lfehorf lfehrof lfehrfo lfeohfr lfeohrf lfeofhr lfeofrh lfeorfh lfeorhf lferhof
lferhfo lferohf lferofh lferfoh lferfho lfrfheo lfrfhoe lfrfeho lfrfeoh lfrfoeh lfrfohe
lfrhfeo lfrhfoe lfrhefo lfrheof lfrhoef lfrhofe lfrehfo lfrehof lfrefho lfrefoh lfreofh
lfreohf lfrohef lfrohfe lfroehf lfroefh lfrofeh lfrofhe lffoher lffohre lffoehr lffoerh
lfforeh lfforhe lffhoer lffhore lffheor lffhero lffhreo lffhroe lffehor lffehro lffeohr
lffeorh lfferoh lfferho lffrheo lffrhoe lffreho lffreoh lffroeh lffrohe lfofher lfofhre
lfofehr lfoferh lfofreh lfofrhe lfohfer lfohfre lfohefr lfoherf lfohref lfohrfe lfoehfr
lfoehrf lfoefhr lfoefrh lfoerfh lfoerhf lforhef lforhfe lforehf lforefh lforfeh lforfhe
lfhofer lfhofre lfhoefr lfhoerf lfhoref lfhorfe lfhfoer lfhfore lfhfeor lfhfero lfhfreo
lfhfroe lfhefor lfhefro lfheofr lfheorf lfherof lfherfo lfhrfeo lfhrfoe lfhrefo lfhreof
lfhroef lfhrofe lfeohfr lfeohrf lfeofhr lfeofrh lfeorfh lfeorhf lfehofr lfehorf lfehfor
lfehfro lfehrfo lfehrof lfefhor lfefhro lfefohr lfeforh lfefroh lfefrho lferhfo lferhof
lferfho lferfoh lferofh lferohf lfrohef lfrohfe lfroehf lfroefh lfrofeh lfrofhe lfrhoef
lfrhofe lfrheof lfrhefo lfrhfeo lfrhfoe lfrehof lfrehfo lfreohf lfreofh lfrefoh lfrefho
lfrfheo lfrfhoe lfrfeho lfrfeoh lfrfoeh lfrfohe lhffoer lhffore lhffeor lhffero lhffreo
lhffroe lhfofer lhfofre lhfoefr lhfoerf lhforef lhforfe lhfeofr lhfeorf lhfefor lhfefro
lhferfo lhferof lhfroef lhfrofe lhfreof lhfrefo lhfrfeo lhfrfoe lhffoer lhffore lhffeor
lhffero lhffreo lhffroe lhfofer lhfofre lhfoefr lhfoerf lhforef lhforfe lhfeofr lhfeorf
lhfefor lhfefro lhferfo lhferof lhfroef lhfrofe lhfreof lhfrefo lhfrfeo lhfrfoe lhoffer
lhoffre lhofefr lhoferf lhofref lhofrfe lhoffer lhoffre lhofefr lhoferf lhofref lhofrfe
lhoeffr lhoefrf lhoeffr lhoefrf lhoerff lhoerff lhorfef lhorffe lhoreff lhoreff lhorfef
lhorffe lhefofr lheforf lheffor lheffro lhefrfo lhefrof lheoffr lheofrf lheoffr lheofrf
lheorff lheorff lhefofr lheforf lheffor lheffro lhefrfo lhefrof lheroff lheroff lherfof
lherffo lherffo lherfof lhrfoef lhrfofe lhrfeof lhrfefo lhrffeo lhrffoe lhrofef lhroffe
lhroeff lhroeff lhrofef lhroffe lhreoff lhreoff lhrefof lhreffo lhreffo lhrefof lhrfoef
lhrfofe lhrfeof lhrfefo lhrffeo lhrffoe leffhor leffhro leffohr lefforh leffroh leffrho
lefhfor lefhfro lefhofr lefhorf lefhrof lefhrfo lefohfr lefohrf lefofhr lefofrh leforfh
leforhf lefrhof lefrhfo lefrohf lefrofh lefrfoh lefrfho leffhor leffhro leffohr lefforh
leffroh leffrho lefhfor lefhfro lefhofr lefhorf lefhrof lefhrfo lefohfr lefohrf lefofhr
lefofrh leforfh leforhf lefrhof lefrhfo lefrohf lefrofh lefrfoh lefrfho lehffor lehffro
lehfofr lehforf lehfrof lehfrfo lehffor lehffro lehfofr lehforf lehfrof lehfrfo lehoffr
lehofrf lehoffr lehofrf lehorff lehorff lehrfof lehrffo lehroff lehroff lehrfof lehrffo
leofhfr leofhrf leoffhr leoffrh leofrfh leofrhf leohffr leohfrf leohffr leohfrf leohrff
leohrff leofhfr leofhrf leoffhr leoffrh leofrfh leofrhf leorhff leorhff leorfhf leorffh
leorffh leorfhf lerfhof lerfhfo lerfohf lerfofh lerffoh lerffho lerhfof lerhffo lerhoff
lerhoff lerhfof lerhffo lerohff lerohff lerofhf leroffh leroffh lerofhf lerfhof lerfhfo
lerfohf lerfofh lerffoh lerffho lrffheo lrffhoe lrffeho lrffeoh lrffoeh lrffohe lrfhfeo
lrfhfoe lrfhefo lrfheof lrfhoef lrfhofe lrfehfo lrfehof lrfefho lrfefoh lrfeofh lrfeohf
lrfohef lrfohfe lrfoehf lrfoefh lrfofeh lrfofhe lrffheo lrffhoe lrffeho lrffeoh lrffoeh
lrffohe lrfhfeo lrfhfoe lrfhefo lrfheof lrfhoef lrfhofe lrfehfo lrfehof lrfefho lrfefoh
lrfeofh lrfeohf lrfohef lrfohfe lrfoehf lrfoefh lrfofeh lrfofhe lrhffeo lrhffoe lrhfefo
lrhfeof lrhfoef lrhfofe lrhffeo lrhffoe lrhfefo lrhfeof lrhfoef lrhfofe lrheffo lrhefof
lrheffo lrhefof lrheoff lrheoff lrhofef lrhoffe lrhoeff lrhoeff lrhofef lrhoffe lrefhfo
lrefhof lreffho lreffoh lrefofh lrefohf lrehffo lrehfof lrehffo lrehfof lrehoff lrehoff
lrefhfo lrefhof lreffho lreffoh lrefofh lrefohf lreohff lreohff lreofhf lreoffh lreoffh
lreofhf lrofhef lrofhfe lrofehf lrofefh lroffeh lroffhe lrohfef lrohffe lroheff lroheff
lrohfef lrohffe lroehff lroehff lroefhf lroeffh lroeffh lroefhf lrofhef lrofhfe lrofehf
lrofefh lroffeh lroffhe eofflhr eofflrh eoffhlr eoffhrl eoffrhl eoffrlh eoflfhr eoflfrh
eoflhfr eoflhrf eoflrhf eoflrfh eofhlfr eofhlrf eofhflr eofhfrl eofhrfl eofhrlf eofrlhf
eofrlfh eofrhlf eofrhfl eofrfhl eofrflh eofflhr eofflrh eoffhlr eoffhrl eoffrhl eoffrlh
eoflfhr eoflfrh eoflhfr eoflhrf eoflrhf eoflrfh eofhlfr eofhlrf eofhflr eofhfrl eofhrfl
eofhrlf eofrlhf eofrlfh eofrhlf eofrhfl eofrfhl eofrflh eolffhr eolffrh eolfhfr eolfhrf
eolfrhf eolfrfh eolffhr eolffrh eolfhfr eolfhrf eolfrhf eolfrfh eolhffr eolhfrf eolhffr
eolhfrf eolhrff eolhrff eolrfhf eolrffh eolrhff eolrhff eolrfhf eolrffh eohflfr eohflrf
eohfflr eohffrl eohfrfl eohfrlf eohlffr eohlfrf eohlffr eohlfrf eohlrff eohlrff eohflfr
eohflrf eohfflr eohffrl eohfrfl eohfrlf eohrlff eohrlff eohrflf eohrffl eohrffl eohrflf
eorflhf eorflfh eorfhlf eorfhfl eorffhl eorfflh eorlfhf eorlffh eorlhff eorlhff eorlfhf
eorlffh eorhlff eorhlff eorhflf eorhffl eorhffl eorhflf eorflhf eorflfh eorfhlf eorfhfl
eorffhl eorfflh efoflhr efoflrh efofhlr efofhrl efofrhl efofrlh efolfhr efolfrh efolhfr
efolhrf efolrhf efolrfh efohlfr efohlrf efohflr efohfrl efohrfl efohrlf eforlhf eforlfh
eforhlf eforhfl eforfhl eforflh effolhr effolrh effohlr effohrl efforhl efforlh efflohr
efflorh efflhor efflhro efflrho efflroh effhlor effhlro effholr effhorl effhrol effhrlo
effrlho effrloh effrhlo effrhol effrohl effrolh eflfohr eflforh eflfhor eflfhro eflfrho
eflfroh eflofhr eflofrh eflohfr eflohrf eflorhf eflorfh eflhofr eflhorf eflhfor eflhfro
eflhrfo eflhrof eflrohf eflrofh eflrhof eflrhfo eflrfho eflrfoh efhflor efhflro efhfolr
efhforl efhfrol efhfrlo efhlfor efhlfro efhlofr efhlorf efhlrof efhlrfo efholfr efholrf
efhoflr efhofrl efhorfl efhorlf efhrlof efhrlfo efhrolf efhrofl efhrfol efhrflo efrflho
efrfloh efrfhlo efrfhol efrfohl efrfolh efrlfho efrlfoh efrlhfo efrlhof efrlohf efrlofh
efrhlfo efrhlof efrhflo efrhfol efrhofl efrholf efrolhf efrolfh efrohlf efrohfl efrofhl
efroflh effolhr effolrh effohlr effohrl efforhl efforlh efflohr efflorh efflhor efflhro
efflrho efflroh effhlor effhlro effholr effhorl effhrol effhrlo effrlho effrloh effrhlo
effrhol effrohl effrolh efoflhr efoflrh efofhlr efofhrl efofrhl efofrlh efolfhr efolfrh
efolhfr efolhrf efolrhf efolrfh efohlfr efohlrf efohflr efohfrl efohrfl efohrlf eforlhf
eforlfh eforhlf eforhfl eforfhl eforflh eflofhr eflofrh eflohfr eflohrf eflorhf eflorfh
eflfohr eflforh eflfhor eflfhro eflfrho eflfroh eflhfor eflhfro eflhofr eflhorf eflhrof
eflhrfo eflrfho eflrfoh eflrhfo eflrhof eflrohf eflrofh efholfr efholrf efhoflr efhofrl
efhorfl efhorlf efhlofr efhlorf efhlfor efhlfro efhlrfo efhlrof efhflor efhflro efhfolr
efhforl efhfrol efhfrlo efhrlfo efhrlof efhrflo efhrfol efhrofl efhrolf efrolhf efrolfh
efrohlf efrohfl efrofhl efroflh efrlohf efrlofh efrlhof efrlhfo efrlfho efrlfoh efrhlof
efrhlfo efrholf efrhofl efrhfol efrhflo efrflho efrfloh efrfhlo efrfhol efrfohl efrfolh
elffohr elfforh elffhor elffhro elffrho elffroh elfofhr elfofrh elfohfr elfohrf elforhf
elforfh elfhofr elfhorf elfhfor elfhfro elfhrfo elfhrof elfrohf elfrofh elfrhof elfrhfo
elfrfho elfrfoh elffohr elfforh elffhor elffhro elffrho elffroh elfofhr elfofrh elfohfr
elfohrf elforhf elforfh elfhofr elfhorf elfhfor elfhfro elfhrfo elfhrof elfrohf elfrofh
elfrhof elfrhfo elfrfho elfrfoh eloffhr eloffrh elofhfr elofhrf elofrhf elofrfh eloffhr
eloffrh elofhfr elofhrf elofrhf elofrfh elohffr elohfrf elohffr elohfrf elohrff elohrff
elorfhf elorffh elorhff elorhff elorfhf elorffh elhfofr elhforf elhffor elhffro elhfrfo
elhfrof elhoffr elhofrf elhoffr elhofrf elhorff elhorff elhfofr elhforf elhffor elhffro
elhfrfo elhfrof elhroff elhroff elhrfof elhrffo elhrffo elhrfof elrfohf elrfofh elrfhof
elrfhfo elrffho elrffoh elrofhf elroffh elrohff elrohff elrofhf elroffh elrhoff elrhoff
elrhfof elrhffo elrhffo elrhfof elrfohf elrfofh elrfhof elrfhfo elrffho elrffoh ehfflor
ehfflro ehffolr ehfforl ehffrol ehffrlo ehflfor ehflfro ehflofr ehflorf ehflrof ehflrfo
ehfolfr ehfolrf ehfoflr ehfofrl ehforfl ehforlf ehfrlof ehfrlfo ehfrolf ehfrofl ehfrfol
ehfrflo ehfflor ehfflro ehffolr ehfforl ehffrol ehffrlo ehflfor ehflfro ehflofr ehflorf
ehflrof ehflrfo ehfolfr ehfolrf ehfoflr ehfofrl ehforfl ehforlf ehfrlof ehfrlfo ehfrolf
ehfrofl ehfrfol ehfrflo ehlffor ehlffro ehlfofr ehlforf ehlfrof ehlfrfo ehlffor ehlffro
ehlfofr ehlforf ehlfrof ehlfrfo ehloffr ehlofrf ehloffr ehlofrf ehlorff ehlorff ehlrfof
ehlrffo ehlroff ehlroff ehlrfof ehlrffo ehoflfr ehoflrf ehofflr ehoffrl ehofrfl ehofrlf
eholffr eholfrf eholffr eholfrf eholrff eholrff ehoflfr ehoflrf ehofflr ehoffrl ehofrfl
ehofrlf ehorlff ehorlff ehorflf ehorffl ehorffl ehorflf ehrflof ehrflfo ehrfolf ehrfofl
ehrffol ehrfflo ehrlfof ehrlffo ehrloff ehrloff ehrlfof ehrlffo ehrolff ehrolff ehroflf
ehroffl ehroffl ehroflf ehrflof ehrflfo ehrfolf ehrfofl ehrffol ehrfflo erfflho erffloh
erffhlo erffhol erffohl erffolh erflfho erflfoh erflhfo erflhof erflohf erflofh erfhlfo
erfhlof erfhflo erfhfol erfhofl erfholf erfolhf erfolfh erfohlf erfohfl erfofhl erfoflh
erfflho erffloh erffhlo erffhol erffohl erffolh erflfho erflfoh erflhfo erflhof erflohf
erflofh erfhlfo erfhlof erfhflo erfhfol erfhofl erfholf erfolhf erfolfh erfohlf erfohfl
erfofhl erfoflh erlffho erlffoh erlfhfo erlfhof erlfohf erlfofh erlffho erlffoh erlfhfo
erlfhof erlfohf erlfofh erlhffo erlhfof erlhffo erlhfof erlhoff erlhoff erlofhf erloffh
erlohff erlohff erlofhf erloffh erhflfo erhflof erhfflo erhffol erhfofl erhfolf erhlffo
erhlfof erhlffo erhlfof erhloff erhloff erhflfo erhflof erhfflo erhffol erhfofl erhfolf
erholff erholff erhoflf erhoffl erhoffl erhoflf eroflhf eroflfh erofhlf erofhfl eroffhl
erofflh erolfhf erolffh erolhff erolhff erolfhf erolffh erohlff erohlff erohflf erohffl
erohffl erohflf eroflhf eroflfh erofhlf erofhfl eroffhl erofflh roffleh rofflhe roffelh
roffehl roffhel roffhle roflfeh roflfhe roflefh roflehf roflhef roflhfe rofelfh rofelhf
rofeflh rofefhl rofehfl rofehlf rofhlef rofhlfe rofhelf rofhefl rofhfel rofhfle roffleh
rofflhe roffelh roffehl roffhel roffhle roflfeh roflfhe roflefh roflehf roflhef roflhfe
rofelfh rofelhf rofeflh rofefhl rofehfl rofehlf rofhlef rofhlfe rofhelf rofhefl rofhfel
rofhfle rolffeh rolffhe rolfefh rolfehf rolfhef rolfhfe rolffeh rolffhe rolfefh rolfehf
rolfhef rolfhfe roleffh rolefhf roleffh rolefhf rolehff rolehff rolhfef rolhffe rolheff
rolheff rolhfef rolhffe roeflfh roeflhf roefflh roeffhl roefhfl roefhlf roelffh roelfhf
roelffh roelfhf roelhff roelhff roeflfh roeflhf roefflh roeffhl roefhfl roefhlf roehlff
roehlff roehflf roehffl roehffl roehflf rohflef rohflfe rohfelf rohfefl rohffel rohffle
rohlfef rohlffe rohleff rohleff rohlfef rohlffe rohelff rohelff roheflf roheffl roheffl
roheflf rohflef rohflfe rohfelf rohfefl rohffel rohffle rfofleh rfoflhe rfofelh rfofehl
rfofhel rfofhle rfolfeh rfolfhe rfolefh rfolehf rfolhef rfolhfe rfoelfh rfoelhf rfoeflh
rfoefhl rfoehfl rfoehlf rfohlef rfohlfe rfohelf rfohefl rfohfel rfohfle rffoleh rffolhe
rffoelh rffoehl rffohel rffohle rffloeh rfflohe rffleoh rffleho rfflheo rfflhoe rffeloh
rffelho rffeolh rffeohl rffehol rffehlo rffhleo rffhloe rffhelo rffheol rffhoel rffhole
rflfoeh rflfohe rflfeoh rflfeho rflfheo rflfhoe rflofeh rflofhe rfloefh rfloehf rflohef
rflohfe rfleofh rfleohf rflefoh rflefho rflehfo rflehof rflhoef rflhofe rflheof rflhefo
rflhfeo rflhfoe rfefloh rfeflho rfefolh rfefohl rfefhol rfefhlo rfelfoh rfelfho rfelofh
rfelohf rfelhof rfelhfo rfeolfh rfeolhf rfeoflh rfeofhl rfeohfl rfeohlf rfehlof rfehlfo
rfeholf rfehofl rfehfol rfehflo rfhfleo rfhfloe rfhfelo rfhfeol rfhfoel rfhfole rfhlfeo
rfhlfoe rfhlefo rfhleof rfhloef rfhlofe rfhelfo rfhelof rfheflo rfhefol rfheofl rfheolf
rfholef rfholfe rfhoelf rfhoefl rfhofel rfhofle rffoleh rffolhe rffoelh rffoehl rffohel
rffohle rffloeh rfflohe rffleoh rffleho rfflheo rfflhoe rffeloh rffelho rffeolh rffeohl
rffehol rffehlo rffhleo rffhloe rffhelo rffheol rffhoel rffhole rfofleh rfoflhe rfofelh
rfofehl rfofhel rfofhle rfolfeh rfolfhe rfolefh rfolehf rfolhef rfolhfe rfoelfh rfoelhf
rfoeflh rfoefhl rfoehfl rfoehlf rfohlef rfohlfe rfohelf rfohefl rfohfel rfohfle rflofeh
rflofhe rfloefh rfloehf rflohef rflohfe rflfoeh rflfohe rflfeoh rflfeho rflfheo rflfhoe
rflefoh rflefho rfleofh rfleohf rflehof rflehfo rflhfeo rflhfoe rflhefo rflheof rflhoef
rflhofe rfeolfh rfeolhf rfeoflh rfeofhl rfeohfl rfeohlf rfelofh rfelohf rfelfoh rfelfho
rfelhfo rfelhof rfefloh rfeflho rfefolh rfefohl rfefhol rfefhlo rfehlfo rfehlof rfehflo
rfehfol rfehofl rfeholf rfholef rfholfe rfhoelf rfhoefl rfhofel rfhofle rfhloef rfhlofe
rfhleof rfhlefo rfhlfeo rfhlfoe rfhelof rfhelfo rfheolf rfheofl rfhefol rfheflo rfhfleo
rfhfloe rfhfelo rfhfeol rfhfoel rfhfole rlffoeh rlffohe rlffeoh rlffeho rlffheo rlffhoe
rlfofeh rlfofhe rlfoefh rlfoehf rlfohef rlfohfe rlfeofh rlfeohf rlfefoh rlfefho rlfehfo
rlfehof rlfhoef rlfhofe rlfheof rlfhefo rlfhfeo rlfhfoe rlffoeh rlffohe rlffeoh rlffeho
rlffheo rlffhoe rlfofeh rlfofhe rlfoefh rlfoehf rlfohef rlfohfe rlfeofh rlfeohf rlfefoh
rlfefho rlfehfo rlfehof rlfhoef rlfhofe rlfheof rlfhefo rlfhfeo rlfhfoe rloffeh rloffhe
rlofefh rlofehf rlofhef rlofhfe rloffeh rloffhe rlofefh rlofehf rlofhef rlofhfe rloeffh
rloefhf rloeffh rloefhf rloehff rloehff rlohfef rlohffe rloheff rloheff rlohfef rlohffe
rlefofh rlefohf rleffoh rleffho rlefhfo rlefhof rleoffh rleofhf rleoffh rleofhf rleohff
rleohff rlefofh rlefohf rleffoh rleffho rlefhfo rlefhof rlehoff rlehoff rlehfof rlehffo
rlehffo rlehfof rlhfoef rlhfofe rlhfeof rlhfefo rlhffeo rlhffoe rlhofef rlhoffe rlhoeff
rlhoeff rlhofef rlhoffe rlheoff rlheoff rlhefof rlheffo rlheffo rlhefof rlhfoef rlhfofe
rlhfeof rlhfefo rlhffeo rlhffoe reffloh refflho reffolh reffohl reffhol reffhlo reflfoh
reflfho reflofh reflohf reflhof reflhfo refolfh refolhf refoflh refofhl refohfl refohlf
refhlof refhlfo refholf refhofl refhfol refhflo reffloh refflho reffolh reffohl reffhol
reffhlo reflfoh reflfho reflofh reflohf reflhof reflhfo refolfh refolhf refoflh refofhl
refohfl refohlf refhlof refhlfo refholf refhofl refhfol refhflo relffoh relffho relfofh
relfohf relfhof relfhfo relffoh relffho relfofh relfohf relfhof relfhfo reloffh relofhf
reloffh relofhf relohff relohff relhfof relhffo relhoff relhoff relhfof relhffo reoflfh
reoflhf reofflh reoffhl reofhfl reofhlf reolffh reolfhf reolffh reolfhf reolhff reolhff
reoflfh reoflhf reofflh reoffhl reofhfl reofhlf reohlff reohlff reohflf reohffl reohffl
reohflf rehflof rehflfo rehfolf rehfofl rehffol rehfflo rehlfof rehlffo rehloff rehloff
rehlfof rehlffo reholff reholff rehoflf rehoffl rehoffl rehoflf rehflof rehflfo rehfolf
rehfofl rehffol rehfflo rhffleo rhffloe rhffelo rhffeol rhffoel rhffole rhflfeo rhflfoe
rhflefo rhfleof rhfloef rhflofe rhfelfo rhfelof rhfeflo rhfefol rhfeofl rhfeolf rhfolef
rhfolfe rhfoelf rhfoefl rhfofel rhfofle rhffleo rhffloe rhffelo rhffeol rhffoel rhffole
rhflfeo rhflfoe rhflefo rhfleof rhfloef rhflofe rhfelfo rhfelof rhfeflo rhfefol rhfeofl
rhfeolf rhfolef rhfolfe rhfoelf rhfoefl rhfofel rhfofle rhlffeo rhlffoe rhlfefo rhlfeof
rhlfoef rhlfofe rhlffeo rhlffoe rhlfefo rhlfeof rhlfoef rhlfofe rhleffo rhlefof rhleffo
rhlefof rhleoff rhleoff rhlofef rhloffe rhloeff rhloeff rhlofef rhloffe rheflfo rheflof
rhefflo rheffol rhefofl rhefolf rhelffo rhelfof rhelffo rhelfof rheloff rheloff rheflfo
rheflof rhefflo rheffol rhefofl rhefolf rheolff rheolff rheoflf rheoffl rheoffl rheoflf
rhoflef rhoflfe rhofelf rhofefl rhoffel rhoffle rholfef rholffe rholeff rholeff rholfef
rholffe rhoelff rhoelff rhoeflf rhoeffl rhoeffl rhoeflf rhoflef rhoflfe rhofelf rhofefl
rhoffel rhoffle

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us