easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

indirubin

balminesses

kerystic

cerebratulus

riesner

perchlorinate

malefical

bagration

haloplanktis

veribest

inclinaturque

auremque

sialosyrinx

versare

quantuvis

kamsin

declarabamus

kodaks


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: hoffert
cipher variations:
ipggfsu jqhhgtv kriihuw lsjjivx mtkkjwy
nullkxz ovmmlya pwnnmzb qxoonac ryppobd
szqqpce tarrqdf ubssreg vcttsfh wduutgi
xevvuhj yfwwvik zgxxwjl ahyyxkm bizzyln
cjaazmo dkbbanp elccboq fmddcpr gneedqs

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: hoffert
Cipher: sluuvig

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: hoffert
Cipher: AABBB ABBAB AABAB AABAB AABAA BAAAA BAABA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: hoffert
cipher variations:
ipggfsuwrqqnagktaavisyvkkdqemxuulyqazeetgccdyyjwaqfiirem
ehsszmysjcchukglmmpcwunwwxkijqhhgtvxsrrobhlubbwjtzwllerf
nyvvmzrbaffuhddezzkxbrgjjsfnfittanztkddivlhmnnqdxvoxxylj
kriihuwytsspcimvccxkuaxmmfsgozwwnascbggvieefaalycshkktgo
gjuuboauleejwminooreywpyyzmklsjjivxzuttqdjnwddylvbynngth
paxxobtdchhwjffgbbmzdtilluhphkvvcpbvmffkxnjoppsfzxqzzanl
mtkkjwyavuurekoxeezmwczoohuiqbyypcuediixkgghccnaeujmmviq
ilwwdqcwngglyokpqqtgayraabomnullkxzbwvvsflpyffanxdappivj
rczzqdvfejjylhhiddobfvknnwjrjmxxerdxohhmzplqrruhbzsbbcpn
ovmmlyacxwwtgmqzggboyebqqjwksdaarewgfkkzmiijeepcgwlooxks
knyyfseypiinaqmrssvicatccdqopwnnmzbdyxxuhnrahhcpzfcrrkxl
tebbsfxhgllanjjkffqdhxmppyltlozzgtfzqjjobrnsttwjdbudderp
qxoonacezyyviosbiidqagdsslymufcctgyihmmbokklggreiynqqzmu
mpaahugarkkpcsotuuxkecveefsqryppobdfazzwjptcjjerbhettmzn
vgdduhzjinncpllmhhsfjzorranvnqbbivhbsllqdtpuvvylfdwffgtr
szqqpcegbaaxkqudkkfscifuunaowheeviakjoodqmmniitgkapssbow
orccjwictmmreuqvwwzmgexgghustarrqdfhcbbylrvellgtdjgvvobp
xiffwjblkppernnojjuhlbqttcpxpsddkxjdunnsfvrwxxanhfyhhivt
ubssregidcczmswfmmhuekhwwpcqyjggxkcmlqqfsoopkkvimcruudqy
qteelykevootgwsxyyboigziijwuvcttsfhjeddantxgnnivflixxqdr
zkhhyldnmrrgtppqllwjndsvverzruffmzlfwppuhxtyzzcpjhajjkxv
wduutgikfeebouyhoojwgmjyyresaliizmeonsshuqqrmmxkoetwwfsa
svggnamgxqqviyuzaadqkibkklywxevvuhjlgffcpvzippkxhnkzzsft
bmjjanfpottivrrsnnylpfuxxgtbtwhhobnhyrrwjzvabberljcllmzx
yfwwvikmhggdqwajqqlyiolaatgucnkkbogqpuujwsstoozmqgvyyhuc
uxiipcoizssxkawbccfsmkdmmnayzgxxwjlnihherxbkrrmzjpmbbuhv
dollcphrqvvkxttuppanrhwzzivdvyjjqdpjattylbxcddgtnlennobz
ahyyxkmojiifsyclssnakqnccviwepmmdqisrwwlyuuvqqbosixaajwe
wzkkreqkbuuzmcydeehuomfoopcabizzylnpkjjgtzdmttoblroddwjx
fqnnerjtsxxmzvvwrrcptjybbkxfxallsfrlcvvandzeffivpngppqdb
cjaazmoqlkkhuaenuupcmspeexkygroofskutyynawwxssdqukzcclyg
ybmmtgsmdwwboeafggjwqohqqrecdkbbanprmllivbfovvqdntqffylz
hsppgtlvuzzobxxyttervladdmzhzcnnuhtnexxcpfbghhkxrpirrsfd
elccboqsnmmjwcgpwwreourggzmaitqqhumwvaapcyyzuufswmbeenai
adooviuofyydqgchiilysqjsstgefmddcprtonnkxdhqxxsfpvshhanb
jurrivnxwbbqdzzavvgtxncffobjbeppwjvpgzzerhdijjmztrkttuhf
gneedqsupoolyeiryytgqwtiibockvssjwoyxccreaabwwhuyodggpck
cfqqxkwqhaafsiejkknausluuvighoffertvqppmzfjszzuhrxujjcpd
lwttkxpzyddsfbbcxxivzpehhqdldgrrylxribbgtjfkllobvtmvvwjh

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: hoffert
Cipher: ubssreg

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: hoffert
Cipher: 32431212512444

Extended Methods:
Method #1

Plaintext: hoffert
method variations:
ntllkwysyqqpbdxdvvugiciaazmo

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
h o f f e r t 
3 4 1 1 5 2 4 
2 3 2 2 1 4 4 
They are then read out in rows:
34115242322144
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: hoffert
Cipher: sakihbt

Read more ...
Method #3

Plaintext: hoffert
method variations:
rcbwfto cbwftor bwftorc
wftorcb ftorcbw torcbwf
orcbwft

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: hoffert

all 5040 cipher variations:
hoffert hoffetr hoffret hoffrte hofftre hoffter hofefrt hofeftr hoferft hofertf hofetrf
hofetfr hofreft hofretf hofrfet hofrfte hofrtfe hofrtef hofterf hoftefr hoftref hoftrfe
hoftfre hoftfer hoffert hoffetr hoffret hoffrte hofftre hoffter hofefrt hofeftr hoferft
hofertf hofetrf hofetfr hofreft hofretf hofrfet hofrfte hofrtfe hofrtef hofterf hoftefr
hoftref hoftrfe hoftfre hoftfer hoeffrt hoefftr hoefrft hoefrtf hoeftrf hoeftfr hoeffrt
hoefftr hoefrft hoefrtf hoeftrf hoeftfr hoerfft hoerftf hoerfft hoerftf hoertff hoertff
hoetfrf hoetffr hoetrff hoetrff hoetfrf hoetffr horfeft horfetf horffet horffte horftfe
horftef horefft horeftf horefft horeftf horetff horetff horfeft horfetf horffet horffte
horftfe horftef horteff horteff hortfef hortffe hortffe hortfef hotferf hotfefr hotfref
hotfrfe hotffre hotffer hotefrf hoteffr hoterff hoterff hotefrf hoteffr hotreff hotreff
hotrfef hotrffe hotrffe hotrfef hotferf hotfefr hotfref hotfrfe hotffre hotffer hfofert
hfofetr hfofret hfofrte hfoftre hfofter hfoefrt hfoeftr hfoerft hfoertf hfoetrf hfoetfr
hforeft hforetf hforfet hforfte hfortfe hfortef hfoterf hfotefr hfotref hfotrfe hfotfre
hfotfer hffoert hffoetr hfforet hfforte hffotre hffoter hffeort hffeotr hfferot hfferto
hffetro hffetor hffreot hffreto hffroet hffrote hffrtoe hffrteo hfftero hffteor hfftreo
hfftroe hfftore hfftoer hfefort hfefotr hfefrot hfefrto hfeftro hfeftor hfeofrt hfeoftr
hfeorft hfeortf hfeotrf hfeotfr hferoft hferotf hferfot hferfto hfertfo hfertof hfetorf
hfetofr hfetrof hfetrfo hfetfro hfetfor hfrfeot hfrfeto hfrfoet hfrfote hfrftoe hfrfteo
hfrefot hfrefto hfreoft hfreotf hfretof hfretfo hfroeft hfroetf hfrofet hfrofte hfrotfe
hfrotef hfrteof hfrtefo hfrtoef hfrtofe hfrtfoe hfrtfeo hftfero hftfeor hftfreo hftfroe
hftfore hftfoer hftefro hftefor hfterfo hfterof hfteorf hfteofr hftrefo hftreof hftrfeo
hftrfoe hftrofe hftroef hftoerf hftoefr hftoref hftorfe hftofre hftofer hffoert hffoetr
hfforet hfforte hffotre hffoter hffeort hffeotr hfferot hfferto hffetro hffetor hffreot
hffreto hffroet hffrote hffrtoe hffrteo hfftero hffteor hfftreo hfftroe hfftore hfftoer
hfofert hfofetr hfofret hfofrte hfoftre hfofter hfoefrt hfoeftr hfoerft hfoertf hfoetrf
hfoetfr hforeft hforetf hforfet hforfte hfortfe hfortef hfoterf hfotefr hfotref hfotrfe
hfotfre hfotfer hfeofrt hfeoftr hfeorft hfeortf hfeotrf hfeotfr hfefort hfefotr hfefrot
hfefrto hfeftro hfeftor hferfot hferfto hferoft hferotf hfertof hfertfo hfetfro hfetfor
hfetrfo hfetrof hfetorf hfetofr hfroeft hfroetf hfrofet hfrofte hfrotfe hfrotef hfreoft
hfreotf hfrefot hfrefto hfretfo hfretof hfrfeot hfrfeto hfrfoet hfrfote hfrftoe hfrfteo
hfrtefo hfrteof hfrtfeo hfrtfoe hfrtofe hfrtoef hftoerf hftoefr hftoref hftorfe hftofre
hftofer hfteorf hfteofr hfterof hfterfo hftefro hftefor hftreof hftrefo hftroef hftrofe
hftrfoe hftrfeo hftfero hftfeor hftfreo hftfroe hftfore hftfoer heffort heffotr heffrot
heffrto hefftro hefftor hefofrt hefoftr heforft hefortf hefotrf hefotfr hefroft hefrotf
hefrfot hefrfto hefrtfo hefrtof heftorf heftofr heftrof heftrfo heftfro heftfor heffort
heffotr heffrot heffrto hefftro hefftor hefofrt hefoftr heforft hefortf hefotrf hefotfr
hefroft hefrotf hefrfot hefrfto hefrtfo hefrtof heftorf heftofr heftrof heftrfo heftfro
heftfor heoffrt heofftr heofrft heofrtf heoftrf heoftfr heoffrt heofftr heofrft heofrtf
heoftrf heoftfr heorfft heorftf heorfft heorftf heortff heortff heotfrf heotffr heotrff
heotrff heotfrf heotffr herfoft herfotf herffot herffto herftfo herftof herofft heroftf
herofft heroftf herotff herotff herfoft herfotf herffot herffto herftfo herftof hertoff
hertoff hertfof hertffo hertffo hertfof hetforf hetfofr hetfrof hetfrfo hetffro hetffor
hetofrf hetoffr hetorff hetorff hetofrf hetoffr hetroff hetroff hetrfof hetrffo hetrffo
hetrfof hetforf hetfofr hetfrof hetfrfo hetffro hetffor hrffeot hrffeto hrffoet hrffote
hrfftoe hrffteo hrfefot hrfefto hrfeoft hrfeotf hrfetof hrfetfo hrfoeft hrfoetf hrfofet
hrfofte hrfotfe hrfotef hrfteof hrftefo hrftoef hrftofe hrftfoe hrftfeo hrffeot hrffeto
hrffoet hrffote hrfftoe hrffteo hrfefot hrfefto hrfeoft hrfeotf hrfetof hrfetfo hrfoeft
hrfoetf hrfofet hrfofte hrfotfe hrfotef hrfteof hrftefo hrftoef hrftofe hrftfoe hrftfeo
hreffot hreffto hrefoft hrefotf hreftof hreftfo hreffot hreffto hrefoft hrefotf hreftof
hreftfo hreofft hreoftf hreofft hreoftf hreotff hreotff hretfof hretffo hretoff hretoff
hretfof hretffo hrofeft hrofetf hroffet hroffte hroftfe hroftef hroefft hroeftf hroefft
hroeftf hroetff hroetff hrofeft hrofetf hroffet hroffte hroftfe hroftef hroteff hroteff
hrotfef hrotffe hrotffe hrotfef hrtfeof hrtfefo hrtfoef hrtfofe hrtffoe hrtffeo hrtefof
hrteffo hrteoff hrteoff hrtefof hrteffo hrtoeff hrtoeff hrtofef hrtoffe hrtoffe hrtofef
hrtfeof hrtfefo hrtfoef hrtfofe hrtffoe hrtffeo htffero htffeor htffreo htffroe htffore
htffoer htfefro htfefor htferfo htferof htfeorf htfeofr htfrefo htfreof htfrfeo htfrfoe
htfrofe htfroef htfoerf htfoefr htforef htforfe htfofre htfofer htffero htffeor htffreo
htffroe htffore htffoer htfefro htfefor htferfo htferof htfeorf htfeofr htfrefo htfreof
htfrfeo htfrfoe htfrofe htfroef htfoerf htfoefr htforef htforfe htfofre htfofer hteffro
hteffor htefrfo htefrof hteforf htefofr hteffro hteffor htefrfo htefrof hteforf htefofr
hterffo hterfof hterffo hterfof hteroff hteroff hteofrf hteoffr hteorff hteorff hteofrf
hteoffr htrfefo htrfeof htrffeo htrffoe htrfofe htrfoef htreffo htrefof htreffo htrefof
htreoff htreoff htrfefo htrfeof htrffeo htrffoe htrfofe htrfoef htroeff htroeff htrofef
htroffe htroffe htrofef htoferf htofefr htofref htofrfe htoffre htoffer htoefrf htoeffr
htoerff htoerff htoefrf htoeffr htoreff htoreff htorfef htorffe htorffe htorfef htoferf
htofefr htofref htofrfe htoffre htoffer ohffert ohffetr ohffret ohffrte ohfftre ohffter
ohfefrt ohfeftr ohferft ohfertf ohfetrf ohfetfr ohfreft ohfretf ohfrfet ohfrfte ohfrtfe
ohfrtef ohfterf ohftefr ohftref ohftrfe ohftfre ohftfer ohffert ohffetr ohffret ohffrte
ohfftre ohffter ohfefrt ohfeftr ohferft ohfertf ohfetrf ohfetfr ohfreft ohfretf ohfrfet
ohfrfte ohfrtfe ohfrtef ohfterf ohftefr ohftref ohftrfe ohftfre ohftfer oheffrt ohefftr
ohefrft ohefrtf oheftrf oheftfr oheffrt ohefftr ohefrft ohefrtf oheftrf oheftfr oherfft
oherftf oherfft oherftf ohertff ohertff ohetfrf ohetffr ohetrff ohetrff ohetfrf ohetffr
ohrfeft ohrfetf ohrffet ohrffte ohrftfe ohrftef ohrefft ohreftf ohrefft ohreftf ohretff
ohretff ohrfeft ohrfetf ohrffet ohrffte ohrftfe ohrftef ohrteff ohrteff ohrtfef ohrtffe
ohrtffe ohrtfef ohtferf ohtfefr ohtfref ohtfrfe ohtffre ohtffer ohtefrf ohteffr ohterff
ohterff ohtefrf ohteffr ohtreff ohtreff ohtrfef ohtrffe ohtrffe ohtrfef ohtferf ohtfefr
ohtfref ohtfrfe ohtffre ohtffer ofhfert ofhfetr ofhfret ofhfrte ofhftre ofhfter ofhefrt
ofheftr ofherft ofhertf ofhetrf ofhetfr ofhreft ofhretf ofhrfet ofhrfte ofhrtfe ofhrtef
ofhterf ofhtefr ofhtref ofhtrfe ofhtfre ofhtfer offhert offhetr offhret offhrte offhtre
offhter offehrt offehtr offerht offerth offetrh offethr offreht offreth offrhet offrhte
offrthe offrteh offterh offtehr offtreh offtrhe offthre offther ofefhrt ofefhtr ofefrht
ofefrth ofeftrh ofefthr ofehfrt ofehftr ofehrft ofehrtf ofehtrf ofehtfr oferhft oferhtf
oferfht oferfth ofertfh oferthf ofethrf ofethfr ofetrhf ofetrfh ofetfrh ofetfhr ofrfeht
ofrfeth ofrfhet ofrfhte ofrfthe ofrfteh ofrefht ofrefth ofrehft ofrehtf ofrethf ofretfh
ofrheft ofrhetf ofrhfet ofrhfte ofrhtfe ofrhtef ofrtehf ofrtefh ofrthef ofrthfe ofrtfhe
ofrtfeh oftferh oftfehr oftfreh oftfrhe oftfhre oftfher oftefrh oftefhr ofterfh ofterhf
oftehrf oftehfr oftrefh oftrehf oftrfeh oftrfhe oftrhfe oftrhef oftherf ofthefr ofthref
ofthrfe ofthfre ofthfer offhert offhetr offhret offhrte offhtre offhter offehrt offehtr
offerht offerth offetrh offethr offreht offreth offrhet offrhte offrthe offrteh offterh
offtehr offtreh offtrhe offthre offther ofhfert ofhfetr ofhfret ofhfrte ofhftre ofhfter
ofhefrt ofheftr ofherft ofhertf ofhetrf ofhetfr ofhreft ofhretf ofhrfet ofhrfte ofhrtfe
ofhrtef ofhterf ofhtefr ofhtref ofhtrfe ofhtfre ofhtfer ofehfrt ofehftr ofehrft ofehrtf
ofehtrf ofehtfr ofefhrt ofefhtr ofefrht ofefrth ofeftrh ofefthr oferfht oferfth oferhft
oferhtf oferthf ofertfh ofetfrh ofetfhr ofetrfh ofetrhf ofethrf ofethfr ofrheft ofrhetf
ofrhfet ofrhfte ofrhtfe ofrhtef ofrehft ofrehtf ofrefht ofrefth ofretfh ofrethf ofrfeht
ofrfeth ofrfhet ofrfhte ofrfthe ofrfteh ofrtefh ofrtehf ofrtfeh ofrtfhe ofrthfe ofrthef
oftherf ofthefr ofthref ofthrfe ofthfre ofthfer oftehrf oftehfr ofterhf ofterfh oftefrh
oftefhr oftrehf oftrefh oftrhef oftrhfe oftrfhe oftrfeh oftferh oftfehr oftfreh oftfrhe
oftfhre oftfher oeffhrt oeffhtr oeffrht oeffrth oefftrh oeffthr oefhfrt oefhftr oefhrft
oefhrtf oefhtrf oefhtfr oefrhft oefrhtf oefrfht oefrfth oefrtfh oefrthf oefthrf oefthfr
oeftrhf oeftrfh oeftfrh oeftfhr oeffhrt oeffhtr oeffrht oeffrth oefftrh oeffthr oefhfrt
oefhftr oefhrft oefhrtf oefhtrf oefhtfr oefrhft oefrhtf oefrfht oefrfth oefrtfh oefrthf
oefthrf oefthfr oeftrhf oeftrfh oeftfrh oeftfhr oehffrt oehfftr oehfrft oehfrtf oehftrf
oehftfr oehffrt oehfftr oehfrft oehfrtf oehftrf oehftfr oehrfft oehrftf oehrfft oehrftf
oehrtff oehrtff oehtfrf oehtffr oehtrff oehtrff oehtfrf oehtffr oerfhft oerfhtf oerffht
oerffth oerftfh oerfthf oerhfft oerhftf oerhfft oerhftf oerhtff oerhtff oerfhft oerfhtf
oerffht oerffth oerftfh oerfthf oerthff oerthff oertfhf oertffh oertffh oertfhf oetfhrf
oetfhfr oetfrhf oetfrfh oetffrh oetffhr oethfrf oethffr oethrff oethrff oethfrf oethffr
oetrhff oetrhff oetrfhf oetrffh oetrffh oetrfhf oetfhrf oetfhfr oetfrhf oetfrfh oetffrh
oetffhr orffeht orffeth orffhet orffhte orffthe orffteh orfefht orfefth orfehft orfehtf
orfethf orfetfh orfheft orfhetf orfhfet orfhfte orfhtfe orfhtef orftehf orftefh orfthef
orfthfe orftfhe orftfeh orffeht orffeth orffhet orffhte orffthe orffteh orfefht orfefth
orfehft orfehtf orfethf orfetfh orfheft orfhetf orfhfet orfhfte orfhtfe orfhtef orftehf
orftefh orfthef orfthfe orftfhe orftfeh oreffht oreffth orefhft orefhtf orefthf oreftfh
oreffht oreffth orefhft orefhtf orefthf oreftfh orehfft orehftf orehfft orehftf orehtff
orehtff oretfhf oretffh orethff orethff oretfhf oretffh orhfeft orhfetf orhffet orhffte
orhftfe orhftef orhefft orheftf orhefft orheftf orhetff orhetff orhfeft orhfetf orhffet
orhffte orhftfe orhftef orhteff orhteff orhtfef orhtffe orhtffe orhtfef ortfehf ortfefh
ortfhef ortfhfe ortffhe ortffeh ortefhf orteffh ortehff ortehff ortefhf orteffh ortheff
ortheff orthfef orthffe orthffe orthfef ortfehf ortfefh ortfhef ortfhfe ortffhe ortffeh
otfferh otffehr otffreh otffrhe otffhre otffher otfefrh otfefhr otferfh otferhf otfehrf
otfehfr otfrefh otfrehf otfrfeh otfrfhe otfrhfe otfrhef otfherf otfhefr otfhref otfhrfe
otfhfre otfhfer otfferh otffehr otffreh otffrhe otffhre otffher otfefrh otfefhr otferfh
otferhf otfehrf otfehfr otfrefh otfrehf otfrfeh otfrfhe otfrhfe otfrhef otfherf otfhefr
otfhref otfhrfe otfhfre otfhfer oteffrh oteffhr otefrfh otefrhf otefhrf otefhfr oteffrh
oteffhr otefrfh otefrhf otefhrf otefhfr oterffh oterfhf oterffh oterfhf oterhff oterhff
otehfrf otehffr otehrff otehrff otehfrf otehffr otrfefh otrfehf otrffeh otrffhe otrfhfe
otrfhef otreffh otrefhf otreffh otrefhf otrehff otrehff otrfefh otrfehf otrffeh otrffhe
otrfhfe otrfhef otrheff otrheff otrhfef otrhffe otrhffe otrhfef othferf othfefr othfref
othfrfe othffre othffer othefrf otheffr otherff otherff othefrf otheffr othreff othreff
othrfef othrffe othrffe othrfef othferf othfefr othfref othfrfe othffre othffer fohfert
fohfetr fohfret fohfrte fohftre fohfter fohefrt foheftr foherft fohertf fohetrf fohetfr
fohreft fohretf fohrfet fohrfte fohrtfe fohrtef fohterf fohtefr fohtref fohtrfe fohtfre
fohtfer fofhert fofhetr fofhret fofhrte fofhtre fofhter fofehrt fofehtr foferht foferth
fofetrh fofethr fofreht fofreth fofrhet fofrhte fofrthe fofrteh fofterh foftehr foftreh
foftrhe fofthre fofther foefhrt foefhtr foefrht foefrth foeftrh foefthr foehfrt foehftr
foehrft foehrtf foehtrf foehtfr foerhft foerhtf foerfht foerfth foertfh foerthf foethrf
foethfr foetrhf foetrfh foetfrh foetfhr forfeht forfeth forfhet forfhte forfthe forfteh
forefht forefth forehft forehtf forethf foretfh forheft forhetf forhfet forhfte forhtfe
forhtef fortehf fortefh forthef forthfe fortfhe fortfeh fotferh fotfehr fotfreh fotfrhe
fotfhre fotfher fotefrh fotefhr foterfh foterhf fotehrf fotehfr fotrefh fotrehf fotrfeh
fotrfhe fotrhfe fotrhef fotherf fothefr fothref fothrfe fothfre fothfer fhofert fhofetr
fhofret fhofrte fhoftre fhofter fhoefrt fhoeftr fhoerft fhoertf fhoetrf fhoetfr fhoreft
fhoretf fhorfet fhorfte fhortfe fhortef fhoterf fhotefr fhotref fhotrfe fhotfre fhotfer
fhfoert fhfoetr fhforet fhforte fhfotre fhfoter fhfeort fhfeotr fhferot fhferto fhfetro
fhfetor fhfreot fhfreto fhfroet fhfrote fhfrtoe fhfrteo fhftero fhfteor fhftreo fhftroe
fhftore fhftoer fhefort fhefotr fhefrot fhefrto fheftro fheftor fheofrt fheoftr fheorft
fheortf fheotrf fheotfr fheroft fherotf fherfot fherfto fhertfo fhertof fhetorf fhetofr
fhetrof fhetrfo fhetfro fhetfor fhrfeot fhrfeto fhrfoet fhrfote fhrftoe fhrfteo fhrefot
fhrefto fhreoft fhreotf fhretof fhretfo fhroeft fhroetf fhrofet fhrofte fhrotfe fhrotef
fhrteof fhrtefo fhrtoef fhrtofe fhrtfoe fhrtfeo fhtfero fhtfeor fhtfreo fhtfroe fhtfore
fhtfoer fhtefro fhtefor fhterfo fhterof fhteorf fhteofr fhtrefo fhtreof fhtrfeo fhtrfoe
fhtrofe fhtroef fhtoerf fhtoefr fhtoref fhtorfe fhtofre fhtofer ffhoert ffhoetr ffhoret
ffhorte ffhotre ffhoter ffheort ffheotr ffherot ffherto ffhetro ffhetor ffhreot ffhreto
ffhroet ffhrote ffhrtoe ffhrteo ffhtero ffhteor ffhtreo ffhtroe ffhtore ffhtoer ffohert
ffohetr ffohret ffohrte ffohtre ffohter ffoehrt ffoehtr ffoerht ffoerth ffoetrh ffoethr
fforeht fforeth fforhet fforhte fforthe fforteh ffoterh ffotehr ffotreh ffotrhe ffothre
ffother ffeohrt ffeohtr ffeorht ffeorth ffeotrh ffeothr ffehort ffehotr ffehrot ffehrto
ffehtro ffehtor fferhot fferhto fferoht fferoth ffertoh ffertho ffethro ffethor ffetrho
ffetroh ffetorh ffetohr ffroeht ffroeth ffrohet ffrohte ffrothe ffroteh ffreoht ffreoth
ffrehot ffrehto ffretho ffretoh ffrheot ffrheto ffrhoet ffrhote ffrhtoe ffrhteo ffrteho
ffrteoh ffrtheo ffrthoe ffrtohe ffrtoeh fftoerh fftoehr fftoreh fftorhe fftohre fftoher
ffteorh ffteohr ffteroh ffterho fftehro fftehor fftreoh fftreho fftroeh fftrohe fftrhoe
fftrheo ffthero fftheor ffthreo ffthroe ffthore ffthoer fehfort fehfotr fehfrot fehfrto
fehftro fehftor fehofrt fehoftr fehorft fehortf fehotrf fehotfr fehroft fehrotf fehrfot
fehrfto fehrtfo fehrtof fehtorf fehtofr fehtrof fehtrfo fehtfro fehtfor fefhort fefhotr
fefhrot fefhrto fefhtro fefhtor fefohrt fefohtr feforht feforth fefotrh fefothr fefroht
fefroth fefrhot fefrhto fefrtho fefrtoh feftorh feftohr feftroh feftrho fefthro fefthor
feofhrt feofhtr feofrht feofrth feoftrh feofthr feohfrt feohftr feohrft feohrtf feohtrf
feohtfr feorhft feorhtf feorfht feorfth feortfh feorthf feothrf feothfr feotrhf feotrfh
feotfrh feotfhr ferfoht ferfoth ferfhot ferfhto ferftho ferftoh ferofht ferofth ferohft
ferohtf ferothf ferotfh ferhoft ferhotf ferhfot ferhfto ferhtfo ferhtof fertohf fertofh
ferthof ferthfo fertfho fertfoh fetforh fetfohr fetfroh fetfrho fetfhro fetfhor fetofrh
fetofhr fetorfh fetorhf fetohrf fetohfr fetrofh fetrohf fetrfoh fetrfho fetrhfo fetrhof
fethorf fethofr fethrof fethrfo fethfro fethfor frhfeot frhfeto frhfoet frhfote frhftoe
frhfteo frhefot frhefto frheoft frheotf frhetof frhetfo frhoeft frhoetf frhofet frhofte
frhotfe frhotef frhteof frhtefo frhtoef frhtofe frhtfoe frhtfeo frfheot frfheto frfhoet
frfhote frfhtoe frfhteo frfehot frfehto frfeoht frfeoth frfetoh frfetho frfoeht frfoeth
frfohet frfohte frfothe frfoteh frfteoh frfteho frftoeh frftohe frfthoe frftheo frefhot
frefhto frefoht frefoth freftoh freftho frehfot frehfto frehoft frehotf frehtof frehtfo
freohft freohtf freofht freofth freotfh freothf frethof frethfo fretohf fretofh fretfoh
fretfho frofeht frofeth frofhet frofhte frofthe frofteh froefht froefth froehft froehtf
froethf froetfh froheft frohetf frohfet frohfte frohtfe frohtef frotehf frotefh frothef
frothfe frotfhe frotfeh frtfeoh frtfeho frtfoeh frtfohe frtfhoe frtfheo frtefoh frtefho
frteofh frteohf frtehof frtehfo frtoefh frtoehf frtofeh frtofhe frtohfe frtohef frtheof
frthefo frthoef frthofe frthfoe frthfeo fthfero fthfeor fthfreo fthfroe fthfore fthfoer
fthefro fthefor ftherfo ftherof ftheorf ftheofr fthrefo fthreof fthrfeo fthrfoe fthrofe
fthroef fthoerf fthoefr fthoref fthorfe fthofre fthofer ftfhero ftfheor ftfhreo ftfhroe
ftfhore ftfhoer ftfehro ftfehor ftferho ftferoh ftfeorh ftfeohr ftfreho ftfreoh ftfrheo
ftfrhoe ftfrohe ftfroeh ftfoerh ftfoehr ftforeh ftforhe ftfohre ftfoher ftefhro ftefhor
ftefrho ftefroh fteforh ftefohr ftehfro ftehfor ftehrfo ftehrof ftehorf ftehofr fterhfo
fterhof fterfho fterfoh fterofh fterohf fteohrf fteohfr fteorhf fteorfh fteofrh fteofhr
ftrfeho ftrfeoh ftrfheo ftrfhoe ftrfohe ftrfoeh ftrefho ftrefoh ftrehfo ftrehof ftreohf
ftreofh ftrhefo ftrheof ftrhfeo ftrhfoe ftrhofe ftrhoef ftroehf ftroefh ftrohef ftrohfe
ftrofhe ftrofeh ftoferh ftofehr ftofreh ftofrhe ftofhre ftofher ftoefrh ftoefhr ftoerfh
ftoerhf ftoehrf ftoehfr ftorefh ftorehf ftorfeh ftorfhe ftorhfe ftorhef ftoherf ftohefr
ftohref ftohrfe ftohfre ftohfer fofhert fofhetr fofhret fofhrte fofhtre fofhter fofehrt
fofehtr foferht foferth fofetrh fofethr fofreht fofreth fofrhet fofrhte fofrthe fofrteh
fofterh foftehr foftreh foftrhe fofthre fofther fohfert fohfetr fohfret fohfrte fohftre
fohfter fohefrt foheftr foherft fohertf fohetrf fohetfr fohreft fohretf fohrfet fohrfte
fohrtfe fohrtef fohterf fohtefr fohtref fohtrfe fohtfre fohtfer foehfrt foehftr foehrft
foehrtf foehtrf foehtfr foefhrt foefhtr foefrht foefrth foeftrh foefthr foerfht foerfth
foerhft foerhtf foerthf foertfh foetfrh foetfhr foetrfh foetrhf foethrf foethfr forheft
forhetf forhfet forhfte forhtfe forhtef forehft forehtf forefht forefth foretfh forethf
forfeht forfeth forfhet forfhte forfthe forfteh fortefh fortehf fortfeh fortfhe forthfe
forthef fotherf fothefr fothref fothrfe fothfre fothfer fotehrf fotehfr foterhf foterfh
fotefrh fotefhr fotrehf fotrefh fotrhef fotrhfe fotrfhe fotrfeh fotferh fotfehr fotfreh
fotfrhe fotfhre fotfher ffohert ffohetr ffohret ffohrte ffohtre ffohter ffoehrt ffoehtr
ffoerht ffoerth ffoetrh ffoethr fforeht fforeth fforhet fforhte fforthe fforteh ffoterh
ffotehr ffotreh ffotrhe ffothre ffother ffhoert ffhoetr ffhoret ffhorte ffhotre ffhoter
ffheort ffheotr ffherot ffherto ffhetro ffhetor ffhreot ffhreto ffhroet ffhrote ffhrtoe
ffhrteo ffhtero ffhteor ffhtreo ffhtroe ffhtore ffhtoer ffehort ffehotr ffehrot ffehrto
ffehtro ffehtor ffeohrt ffeohtr ffeorht ffeorth ffeotrh ffeothr fferoht fferoth fferhot
fferhto ffertho ffertoh ffetorh ffetohr ffetroh ffetrho ffethro ffethor ffrheot ffrheto
ffrhoet ffrhote ffrhtoe ffrhteo ffrehot ffrehto ffreoht ffreoth ffretoh ffretho ffroeht
ffroeth ffrohet ffrohte ffrothe ffroteh ffrteoh ffrteho ffrtoeh ffrtohe ffrthoe ffrtheo
ffthero fftheor ffthreo ffthroe ffthore ffthoer fftehro fftehor ffterho ffteroh ffteorh
ffteohr fftreho fftreoh fftrheo fftrhoe fftrohe fftroeh fftoerh fftoehr fftoreh fftorhe
fftohre fftoher fhfoert fhfoetr fhforet fhforte fhfotre fhfoter fhfeort fhfeotr fhferot
fhferto fhfetro fhfetor fhfreot fhfreto fhfroet fhfrote fhfrtoe fhfrteo fhftero fhfteor
fhftreo fhftroe fhftore fhftoer fhofert fhofetr fhofret fhofrte fhoftre fhofter fhoefrt
fhoeftr fhoerft fhoertf fhoetrf fhoetfr fhoreft fhoretf fhorfet fhorfte fhortfe fhortef
fhoterf fhotefr fhotref fhotrfe fhotfre fhotfer fheofrt fheoftr fheorft fheortf fheotrf
fheotfr fhefort fhefotr fhefrot fhefrto fheftro fheftor fherfot fherfto fheroft fherotf
fhertof fhertfo fhetfro fhetfor fhetrfo fhetrof fhetorf fhetofr fhroeft fhroetf fhrofet
fhrofte fhrotfe fhrotef fhreoft fhreotf fhrefot fhrefto fhretfo fhretof fhrfeot fhrfeto
fhrfoet fhrfote fhrftoe fhrfteo fhrtefo fhrteof fhrtfeo fhrtfoe fhrtofe fhrtoef fhtoerf
fhtoefr fhtoref fhtorfe fhtofre fhtofer fhteorf fhteofr fhterof fhterfo fhtefro fhtefor
fhtreof fhtrefo fhtroef fhtrofe fhtrfoe fhtrfeo fhtfero fhtfeor fhtfreo fhtfroe fhtfore
fhtfoer fefhort fefhotr fefhrot fefhrto fefhtro fefhtor fefohrt fefohtr feforht feforth
fefotrh fefothr fefroht fefroth fefrhot fefrhto fefrtho fefrtoh feftorh feftohr feftroh
feftrho fefthro fefthor fehfort fehfotr fehfrot fehfrto fehftro fehftor fehofrt fehoftr
fehorft fehortf fehotrf fehotfr fehroft fehrotf fehrfot fehrfto fehrtfo fehrtof fehtorf
fehtofr fehtrof fehtrfo fehtfro fehtfor feohfrt feohftr feohrft feohrtf feohtrf feohtfr
feofhrt feofhtr feofrht feofrth feoftrh feofthr feorfht feorfth feorhft feorhtf feorthf
feortfh feotfrh feotfhr feotrfh feotrhf feothrf feothfr ferhoft ferhotf ferhfot ferhfto
ferhtfo ferhtof ferohft ferohtf ferofht ferofth ferotfh ferothf ferfoht ferfoth ferfhot
ferfhto ferftho ferftoh fertofh fertohf fertfoh fertfho ferthfo ferthof fethorf fethofr
fethrof fethrfo fethfro fethfor fetohrf fetohfr fetorhf fetorfh fetofrh fetofhr fetrohf
fetrofh fetrhof fetrhfo fetrfho fetrfoh fetforh fetfohr fetfroh fetfrho fetfhro fetfhor
frfheot frfheto frfhoet frfhote frfhtoe frfhteo frfehot frfehto frfeoht frfeoth frfetoh
frfetho frfoeht frfoeth frfohet frfohte frfothe frfoteh frfteoh frfteho frftoeh frftohe
frfthoe frftheo frhfeot frhfeto frhfoet frhfote frhftoe frhfteo frhefot frhefto frheoft
frheotf frhetof frhetfo frhoeft frhoetf frhofet frhofte frhotfe frhotef frhteof frhtefo
frhtoef frhtofe frhtfoe frhtfeo frehfot frehfto frehoft frehotf frehtof frehtfo frefhot
frefhto frefoht frefoth freftoh freftho freofht freofth freohft freohtf freothf freotfh
fretfoh fretfho fretofh fretohf frethof frethfo froheft frohetf frohfet frohfte frohtfe
frohtef froehft froehtf froefht froefth froetfh froethf frofeht frofeth frofhet frofhte
frofthe frofteh frotefh frotehf frotfeh frotfhe frothfe frothef frtheof frthefo frthoef
frthofe frthfoe frthfeo frtehof frtehfo frteohf frteofh frtefoh frtefho frtoehf frtoefh
frtohef frtohfe frtofhe frtofeh frtfeoh frtfeho frtfoeh frtfohe frtfhoe frtfheo ftfhero
ftfheor ftfhreo ftfhroe ftfhore ftfhoer ftfehro ftfehor ftferho ftferoh ftfeorh ftfeohr
ftfreho ftfreoh ftfrheo ftfrhoe ftfrohe ftfroeh ftfoerh ftfoehr ftforeh ftforhe ftfohre
ftfoher fthfero fthfeor fthfreo fthfroe fthfore fthfoer fthefro fthefor ftherfo ftherof
ftheorf ftheofr fthrefo fthreof fthrfeo fthrfoe fthrofe fthroef fthoerf fthoefr fthoref
fthorfe fthofre fthofer ftehfro ftehfor ftehrfo ftehrof ftehorf ftehofr ftefhro ftefhor
ftefrho ftefroh fteforh ftefohr fterfho fterfoh fterhfo fterhof fterohf fterofh fteofrh
fteofhr fteorfh fteorhf fteohrf fteohfr ftrhefo ftrheof ftrhfeo ftrhfoe ftrhofe ftrhoef
ftrehfo ftrehof ftrefho ftrefoh ftreofh ftreohf ftrfeho ftrfeoh ftrfheo ftrfhoe ftrfohe
ftrfoeh ftroefh ftroehf ftrofeh ftrofhe ftrohfe ftrohef ftoherf ftohefr ftohref ftohrfe
ftohfre ftohfer ftoehrf ftoehfr ftoerhf ftoerfh ftoefrh ftoefhr ftorehf ftorefh ftorhef
ftorhfe ftorfhe ftorfeh ftoferh ftofehr ftofreh ftofrhe ftofhre ftofher eoffhrt eoffhtr
eoffrht eoffrth eofftrh eoffthr eofhfrt eofhftr eofhrft eofhrtf eofhtrf eofhtfr eofrhft
eofrhtf eofrfht eofrfth eofrtfh eofrthf eofthrf eofthfr eoftrhf eoftrfh eoftfrh eoftfhr
eoffhrt eoffhtr eoffrht eoffrth eofftrh eoffthr eofhfrt eofhftr eofhrft eofhrtf eofhtrf
eofhtfr eofrhft eofrhtf eofrfht eofrfth eofrtfh eofrthf eofthrf eofthfr eoftrhf eoftrfh
eoftfrh eoftfhr eohffrt eohfftr eohfrft eohfrtf eohftrf eohftfr eohffrt eohfftr eohfrft
eohfrtf eohftrf eohftfr eohrfft eohrftf eohrfft eohrftf eohrtff eohrtff eohtfrf eohtffr
eohtrff eohtrff eohtfrf eohtffr eorfhft eorfhtf eorffht eorffth eorftfh eorfthf eorhfft
eorhftf eorhfft eorhftf eorhtff eorhtff eorfhft eorfhtf eorffht eorffth eorftfh eorfthf
eorthff eorthff eortfhf eortffh eortffh eortfhf eotfhrf eotfhfr eotfrhf eotfrfh eotffrh
eotffhr eothfrf eothffr eothrff eothrff eothfrf eothffr eotrhff eotrhff eotrfhf eotrffh
eotrffh eotrfhf eotfhrf eotfhfr eotfrhf eotfrfh eotffrh eotffhr efofhrt efofhtr efofrht
efofrth efoftrh efofthr efohfrt efohftr efohrft efohrtf efohtrf efohtfr eforhft eforhtf
eforfht eforfth efortfh eforthf efothrf efothfr efotrhf efotrfh efotfrh efotfhr effohrt
effohtr efforht efforth effotrh effothr effhort effhotr effhrot effhrto effhtro effhtor
effrhot effrhto effroht effroth effrtoh effrtho effthro effthor efftrho efftroh efftorh
efftohr efhfort efhfotr efhfrot efhfrto efhftro efhftor efhofrt efhoftr efhorft efhortf
efhotrf efhotfr efhroft efhrotf efhrfot efhrfto efhrtfo efhrtof efhtorf efhtofr efhtrof
efhtrfo efhtfro efhtfor efrfhot efrfhto efrfoht efrfoth efrftoh efrftho efrhfot efrhfto
efrhoft efrhotf efrhtof efrhtfo efrohft efrohtf efrofht efrofth efrotfh efrothf efrthof
efrthfo efrtohf efrtofh efrtfoh efrtfho eftfhro eftfhor eftfrho eftfroh eftforh eftfohr
efthfro efthfor efthrfo efthrof efthorf efthofr eftrhfo eftrhof eftrfho eftrfoh eftrofh
eftrohf eftohrf eftohfr eftorhf eftorfh eftofrh eftofhr effohrt effohtr efforht efforth
effotrh effothr effhort effhotr effhrot effhrto effhtro effhtor effrhot effrhto effroht
effroth effrtoh effrtho effthro effthor efftrho efftroh efftorh efftohr efofhrt efofhtr
efofrht efofrth efoftrh efofthr efohfrt efohftr efohrft efohrtf efohtrf efohtfr eforhft
eforhtf eforfht eforfth efortfh eforthf efothrf efothfr efotrhf efotrfh efotfrh efotfhr
efhofrt efhoftr efhorft efhortf efhotrf efhotfr efhfort efhfotr efhfrot efhfrto efhftro
efhftor efhrfot efhrfto efhroft efhrotf efhrtof efhrtfo efhtfro efhtfor efhtrfo efhtrof
efhtorf efhtofr efrohft efrohtf efrofht efrofth efrotfh efrothf efrhoft efrhotf efrhfot
efrhfto efrhtfo efrhtof efrfhot efrfhto efrfoht efrfoth efrftoh efrftho efrthfo efrthof
efrtfho efrtfoh efrtofh efrtohf eftohrf eftohfr eftorhf eftorfh eftofrh eftofhr efthorf
efthofr efthrof efthrfo efthfro efthfor eftrhof eftrhfo eftrohf eftrofh eftrfoh eftrfho
eftfhro eftfhor eftfrho eftfroh eftforh eftfohr ehffort ehffotr ehffrot ehffrto ehfftro
ehfftor ehfofrt ehfoftr ehforft ehfortf ehfotrf ehfotfr ehfroft ehfrotf ehfrfot ehfrfto
ehfrtfo ehfrtof ehftorf ehftofr ehftrof ehftrfo ehftfro ehftfor ehffort ehffotr ehffrot
ehffrto ehfftro ehfftor ehfofrt ehfoftr ehforft ehfortf ehfotrf ehfotfr ehfroft ehfrotf
ehfrfot ehfrfto ehfrtfo ehfrtof ehftorf ehftofr ehftrof ehftrfo ehftfro ehftfor ehoffrt
ehofftr ehofrft ehofrtf ehoftrf ehoftfr ehoffrt ehofftr ehofrft ehofrtf ehoftrf ehoftfr
ehorfft ehorftf ehorfft ehorftf ehortff ehortff ehotfrf ehotffr ehotrff ehotrff ehotfrf
ehotffr ehrfoft ehrfotf ehrffot ehrffto ehrftfo ehrftof ehrofft ehroftf ehrofft ehroftf
ehrotff ehrotff ehrfoft ehrfotf ehrffot ehrffto ehrftfo ehrftof ehrtoff ehrtoff ehrtfof
ehrtffo ehrtffo ehrtfof ehtforf ehtfofr ehtfrof ehtfrfo ehtffro ehtffor ehtofrf ehtoffr
ehtorff ehtorff ehtofrf ehtoffr ehtroff ehtroff ehtrfof ehtrffo ehtrffo ehtrfof ehtforf
ehtfofr ehtfrof ehtfrfo ehtffro ehtffor erffhot erffhto erffoht erffoth erfftoh erfftho
erfhfot erfhfto erfhoft erfhotf erfhtof erfhtfo erfohft erfohtf erfofht erfofth erfotfh
erfothf erfthof erfthfo erftohf erftofh erftfoh erftfho erffhot erffhto erffoht erffoth
erfftoh erfftho erfhfot erfhfto erfhoft erfhotf erfhtof erfhtfo erfohft erfohtf erfofht
erfofth erfotfh erfothf erfthof erfthfo erftohf erftofh erftfoh erftfho erhffot erhffto
erhfoft erhfotf erhftof erhftfo erhffot erhffto erhfoft erhfotf erhftof erhftfo erhofft
erhoftf erhofft erhoftf erhotff erhotff erhtfof erhtffo erhtoff erhtoff erhtfof erhtffo
erofhft erofhtf eroffht eroffth eroftfh erofthf erohfft erohftf erohfft erohftf erohtff
erohtff erofhft erofhtf eroffht eroffth eroftfh erofthf erothff erothff erotfhf erotffh
erotffh erotfhf ertfhof ertfhfo ertfohf ertfofh ertffoh ertffho erthfof erthffo erthoff
erthoff erthfof erthffo ertohff ertohff ertofhf ertoffh ertoffh ertofhf ertfhof ertfhfo
ertfohf ertfofh ertffoh ertffho etffhro etffhor etffrho etffroh etfforh etffohr etfhfro
etfhfor etfhrfo etfhrof etfhorf etfhofr etfrhfo etfrhof etfrfho etfrfoh etfrofh etfrohf
etfohrf etfohfr etforhf etforfh etfofrh etfofhr etffhro etffhor etffrho etffroh etfforh
etffohr etfhfro etfhfor etfhrfo etfhrof etfhorf etfhofr etfrhfo etfrhof etfrfho etfrfoh
etfrofh etfrohf etfohrf etfohfr etforhf etforfh etfofrh etfofhr ethffro ethffor ethfrfo
ethfrof ethforf ethfofr ethffro ethffor ethfrfo ethfrof ethforf ethfofr ethrffo ethrfof
ethrffo ethrfof ethroff ethroff ethofrf ethoffr ethorff ethorff ethofrf ethoffr etrfhfo
etrfhof etrffho etrffoh etrfofh etrfohf etrhffo etrhfof etrhffo etrhfof etrhoff etrhoff
etrfhfo etrfhof etrffho etrffoh etrfofh etrfohf etrohff etrohff etrofhf etroffh etroffh
etrofhf etofhrf etofhfr etofrhf etofrfh etoffrh etoffhr etohfrf etohffr etohrff etohrff
etohfrf etohffr etorhff etorhff etorfhf etorffh etorffh etorfhf etofhrf etofhfr etofrhf
etofrfh etoffrh etoffhr roffeht roffeth roffhet roffhte roffthe roffteh rofefht rofefth
rofehft rofehtf rofethf rofetfh rofheft rofhetf rofhfet rofhfte rofhtfe rofhtef roftehf
roftefh rofthef rofthfe roftfhe roftfeh roffeht roffeth roffhet roffhte roffthe roffteh
rofefht rofefth rofehft rofehtf rofethf rofetfh rofheft rofhetf rofhfet rofhfte rofhtfe
rofhtef roftehf roftefh rofthef rofthfe roftfhe roftfeh roeffht roeffth roefhft roefhtf
roefthf roeftfh roeffht roeffth roefhft roefhtf roefthf roeftfh roehfft roehftf roehfft
roehftf roehtff roehtff roetfhf roetffh roethff roethff roetfhf roetffh rohfeft rohfetf
rohffet rohffte rohftfe rohftef rohefft roheftf rohefft roheftf rohetff rohetff rohfeft
rohfetf rohffet rohffte rohftfe rohftef rohteff rohteff rohtfef rohtffe rohtffe rohtfef
rotfehf rotfefh rotfhef rotfhfe rotffhe rotffeh rotefhf roteffh rotehff rotehff rotefhf
roteffh rotheff rotheff rothfef rothffe rothffe rothfef rotfehf rotfefh rotfhef rotfhfe
rotffhe rotffeh rfofeht rfofeth rfofhet rfofhte rfofthe rfofteh rfoefht rfoefth rfoehft
rfoehtf rfoethf rfoetfh rfoheft rfohetf rfohfet rfohfte rfohtfe rfohtef rfotehf rfotefh
rfothef rfothfe rfotfhe rfotfeh rffoeht rffoeth rffohet rffohte rffothe rffoteh rffeoht
rffeoth rffehot rffehto rffetho rffetoh rffheot rffheto rffhoet rffhote rffhtoe rffhteo
rffteho rffteoh rfftheo rffthoe rfftohe rfftoeh rfefoht rfefoth rfefhot rfefhto rfeftho
rfeftoh rfeofht rfeofth rfeohft rfeohtf rfeothf rfeotfh rfehoft rfehotf rfehfot rfehfto
rfehtfo rfehtof rfetohf rfetofh rfethof rfethfo rfetfho rfetfoh rfhfeot rfhfeto rfhfoet
rfhfote rfhftoe rfhfteo rfhefot rfhefto rfheoft rfheotf rfhetof rfhetfo rfhoeft rfhoetf
rfhofet rfhofte rfhotfe rfhotef rfhteof rfhtefo rfhtoef rfhtofe rfhtfoe rfhtfeo rftfeho
rftfeoh rftfheo rftfhoe rftfohe rftfoeh rftefho rftefoh rftehfo rftehof rfteohf rfteofh
rfthefo rftheof rfthfeo rfthfoe rfthofe rfthoef rftoehf rftoefh rftohef rftohfe rftofhe
rftofeh rffoeht rffoeth rffohet rffohte rffothe rffoteh rffeoht rffeoth rffehot rffehto
rffetho rffetoh rffheot rffheto rffhoet rffhote rffhtoe rffhteo rffteho rffteoh rfftheo
rffthoe rfftohe rfftoeh rfofeht rfofeth rfofhet rfofhte rfofthe rfofteh rfoefht rfoefth
rfoehft rfoehtf rfoethf rfoetfh rfoheft rfohetf rfohfet rfohfte rfohtfe rfohtef rfotehf
rfotefh rfothef rfothfe rfotfhe rfotfeh rfeofht rfeofth rfeohft rfeohtf rfeothf rfeotfh
rfefoht rfefoth rfefhot rfefhto rfeftho rfeftoh rfehfot rfehfto rfehoft rfehotf rfehtof
rfehtfo rfetfho rfetfoh rfethfo rfethof rfetohf rfetofh rfhoeft rfhoetf rfhofet rfhofte
rfhotfe rfhotef rfheoft rfheotf rfhefot rfhefto rfhetfo rfhetof rfhfeot rfhfeto rfhfoet
rfhfote rfhftoe rfhfteo rfhtefo rfhteof rfhtfeo rfhtfoe rfhtofe rfhtoef rftoehf rftoefh
rftohef rftohfe rftofhe rftofeh rfteohf rfteofh rftehof rftehfo rftefho rftefoh rftheof
rfthefo rfthoef rfthofe rfthfoe rfthfeo rftfeho rftfeoh rftfheo rftfhoe rftfohe rftfoeh
reffoht reffoth reffhot reffhto refftho refftoh refofht refofth refohft refohtf refothf
refotfh refhoft refhotf refhfot refhfto refhtfo refhtof reftohf reftofh refthof refthfo
reftfho reftfoh reffoht reffoth reffhot reffhto refftho refftoh refofht refofth refohft
refohtf refothf refotfh refhoft refhotf refhfot refhfto refhtfo refhtof reftohf reftofh
refthof refthfo reftfho reftfoh reoffht reoffth reofhft reofhtf reofthf reoftfh reoffht
reoffth reofhft reofhtf reofthf reoftfh reohfft reohftf reohfft reohftf reohtff reohtff
reotfhf reotffh reothff reothff reotfhf reotffh rehfoft rehfotf rehffot rehffto rehftfo
rehftof rehofft rehoftf rehofft rehoftf rehotff rehotff rehfoft rehfotf rehffot rehffto
rehftfo rehftof rehtoff rehtoff rehtfof rehtffo rehtffo rehtfof retfohf retfofh retfhof
retfhfo retffho retffoh retofhf retoffh retohff retohff retofhf retoffh rethoff rethoff
rethfof rethffo rethffo rethfof retfohf retfofh retfhof retfhfo retffho retffoh rhffeot
rhffeto rhffoet rhffote rhfftoe rhffteo rhfefot rhfefto rhfeoft rhfeotf rhfetof rhfetfo
rhfoeft rhfoetf rhfofet rhfofte rhfotfe rhfotef rhfteof rhftefo rhftoef rhftofe rhftfoe
rhftfeo rhffeot rhffeto rhffoet rhffote rhfftoe rhffteo rhfefot rhfefto rhfeoft rhfeotf
rhfetof rhfetfo rhfoeft rhfoetf rhfofet rhfofte rhfotfe rhfotef rhfteof rhftefo rhftoef
rhftofe rhftfoe rhftfeo rheffot rheffto rhefoft rhefotf rheftof rheftfo rheffot rheffto
rhefoft rhefotf rheftof rheftfo rheofft rheoftf rheofft rheoftf rheotff rheotff rhetfof
rhetffo rhetoff rhetoff rhetfof rhetffo rhofeft rhofetf rhoffet rhoffte rhoftfe rhoftef
rhoefft rhoeftf rhoefft rhoeftf rhoetff rhoetff rhofeft rhofetf rhoffet rhoffte rhoftfe
rhoftef rhoteff rhoteff rhotfef rhotffe rhotffe rhotfef rhtfeof rhtfefo rhtfoef rhtfofe
rhtffoe rhtffeo rhtefof rhteffo rhteoff rhteoff rhtefof rhteffo rhtoeff rhtoeff rhtofef
rhtoffe rhtoffe rhtofef rhtfeof rhtfefo rhtfoef rhtfofe rhtffoe rhtffeo rtffeho rtffeoh
rtffheo rtffhoe rtffohe rtffoeh rtfefho rtfefoh rtfehfo rtfehof rtfeohf rtfeofh rtfhefo
rtfheof rtfhfeo rtfhfoe rtfhofe rtfhoef rtfoehf rtfoefh rtfohef rtfohfe rtfofhe rtfofeh
rtffeho rtffeoh rtffheo rtffhoe rtffohe rtffoeh rtfefho rtfefoh rtfehfo rtfehof rtfeohf
rtfeofh rtfhefo rtfheof rtfhfeo rtfhfoe rtfhofe rtfhoef rtfoehf rtfoefh rtfohef rtfohfe
rtfofhe rtfofeh rteffho rteffoh rtefhfo rtefhof rtefohf rtefofh rteffho rteffoh rtefhfo
rtefhof rtefohf rtefofh rtehffo rtehfof rtehffo rtehfof rtehoff rtehoff rteofhf rteoffh
rteohff rteohff rteofhf rteoffh rthfefo rthfeof rthffeo rthffoe rthfofe rthfoef rtheffo
rthefof rtheffo rthefof rtheoff rtheoff rthfefo rthfeof rthffeo rthffoe rthfofe rthfoef
rthoeff rthoeff rthofef rthoffe rthoffe rthofef rtofehf rtofefh rtofhef rtofhfe rtoffhe
rtoffeh rtoefhf rtoeffh rtoehff rtoehff rtoefhf rtoeffh rtoheff rtoheff rtohfef rtohffe
rtohffe rtohfef rtofehf rtofefh rtofhef rtofhfe rtoffhe rtoffeh tofferh toffehr toffreh
toffrhe toffhre toffher tofefrh tofefhr toferfh toferhf tofehrf tofehfr tofrefh tofrehf
tofrfeh tofrfhe tofrhfe tofrhef tofherf tofhefr tofhref tofhrfe tofhfre tofhfer tofferh
toffehr toffreh toffrhe toffhre toffher tofefrh tofefhr toferfh toferhf tofehrf tofehfr
tofrefh tofrehf tofrfeh tofrfhe tofrhfe tofrhef tofherf tofhefr tofhref tofhrfe tofhfre
tofhfer toeffrh toeffhr toefrfh toefrhf toefhrf toefhfr toeffrh toeffhr toefrfh toefrhf
toefhrf toefhfr toerffh toerfhf toerffh toerfhf toerhff toerhff toehfrf toehffr toehrff
toehrff toehfrf toehffr torfefh torfehf torffeh torffhe torfhfe torfhef toreffh torefhf
toreffh torefhf torehff torehff torfefh torfehf torffeh torffhe torfhfe torfhef torheff
torheff torhfef torhffe torhffe torhfef tohferf tohfefr tohfref tohfrfe tohffre tohffer
tohefrf toheffr toherff toherff tohefrf toheffr tohreff tohreff tohrfef tohrffe tohrffe
tohrfef tohferf tohfefr tohfref tohfrfe tohffre tohffer tfoferh tfofehr tfofreh tfofrhe
tfofhre tfofher tfoefrh tfoefhr tfoerfh tfoerhf tfoehrf tfoehfr tforefh tforehf tforfeh
tforfhe tforhfe tforhef tfoherf tfohefr tfohref tfohrfe tfohfre tfohfer tffoerh tffoehr
tfforeh tfforhe tffohre tffoher tffeorh tffeohr tfferoh tfferho tffehro tffehor tffreoh
tffreho tffroeh tffrohe tffrhoe tffrheo tffhero tffheor tffhreo tffhroe tffhore tffhoer
tfeforh tfefohr tfefroh tfefrho tfefhro tfefhor tfeofrh tfeofhr tfeorfh tfeorhf tfeohrf
tfeohfr tferofh tferohf tferfoh tferfho tferhfo tferhof tfehorf tfehofr tfehrof tfehrfo
tfehfro tfehfor tfrfeoh tfrfeho tfrfoeh tfrfohe tfrfhoe tfrfheo tfrefoh tfrefho tfreofh
tfreohf tfrehof tfrehfo tfroefh tfroehf tfrofeh tfrofhe tfrohfe tfrohef tfrheof tfrhefo
tfrhoef tfrhofe tfrhfoe tfrhfeo tfhfero tfhfeor tfhfreo tfhfroe tfhfore tfhfoer tfhefro
tfhefor tfherfo tfherof tfheorf tfheofr tfhrefo tfhreof tfhrfeo tfhrfoe tfhrofe tfhroef
tfhoerf tfhoefr tfhoref tfhorfe tfhofre tfhofer tffoerh tffoehr tfforeh tfforhe tffohre
tffoher tffeorh tffeohr tfferoh tfferho tffehro tffehor tffreoh tffreho tffroeh tffrohe
tffrhoe tffrheo tffhero tffheor tffhreo tffhroe tffhore tffhoer tfoferh tfofehr tfofreh
tfofrhe tfofhre tfofher tfoefrh tfoefhr tfoerfh tfoerhf tfoehrf tfoehfr tforefh tforehf
tforfeh tforfhe tforhfe tforhef tfoherf tfohefr tfohref tfohrfe tfohfre tfohfer tfeofrh
tfeofhr tfeorfh tfeorhf tfeohrf tfeohfr tfeforh tfefohr tfefroh tfefrho tfefhro tfefhor
tferfoh tferfho tferofh tferohf tferhof tferhfo tfehfro tfehfor tfehrfo tfehrof tfehorf
tfehofr tfroefh tfroehf tfrofeh tfrofhe tfrohfe tfrohef tfreofh tfreohf tfrefoh tfrefho
tfrehfo tfrehof tfrfeoh tfrfeho tfrfoeh tfrfohe tfrfhoe tfrfheo tfrhefo tfrheof tfrhfeo
tfrhfoe tfrhofe tfrhoef tfhoerf tfhoefr tfhoref tfhorfe tfhofre tfhofer tfheorf tfheofr
tfherof tfherfo tfhefro tfhefor tfhreof tfhrefo tfhroef tfhrofe tfhrfoe tfhrfeo tfhfero
tfhfeor tfhfreo tfhfroe tfhfore tfhfoer tefforh teffohr teffroh teffrho teffhro teffhor
tefofrh tefofhr teforfh teforhf tefohrf tefohfr tefrofh tefrohf tefrfoh tefrfho tefrhfo
tefrhof tefhorf tefhofr tefhrof tefhrfo tefhfro tefhfor tefforh teffohr teffroh teffrho
teffhro teffhor tefofrh tefofhr teforfh teforhf tefohrf tefohfr tefrofh tefrohf tefrfoh
tefrfho tefrhfo tefrhof tefhorf tefhofr tefhrof tefhrfo tefhfro tefhfor teoffrh teoffhr
teofrfh teofrhf teofhrf teofhfr teoffrh teoffhr teofrfh teofrhf teofhrf teofhfr teorffh
teorfhf teorffh teorfhf teorhff teorhff teohfrf teohffr teohrff teohrff teohfrf teohffr
terfofh terfohf terffoh terffho terfhfo terfhof teroffh terofhf teroffh terofhf terohff
terohff terfofh terfohf terffoh terffho terfhfo terfhof terhoff terhoff terhfof terhffo
terhffo terhfof tehforf tehfofr tehfrof tehfrfo tehffro tehffor tehofrf tehoffr tehorff
tehorff tehofrf tehoffr tehroff tehroff tehrfof tehrffo tehrffo tehrfof tehforf tehfofr
tehfrof tehfrfo tehffro tehffor trffeoh trffeho trffoeh trffohe trffhoe trffheo trfefoh
trfefho trfeofh trfeohf trfehof trfehfo trfoefh trfoehf trfofeh trfofhe trfohfe trfohef
trfheof trfhefo trfhoef trfhofe trfhfoe trfhfeo trffeoh trffeho trffoeh trffohe trffhoe
trffheo trfefoh trfefho trfeofh trfeohf trfehof trfehfo trfoefh trfoehf trfofeh trfofhe
trfohfe trfohef trfheof trfhefo trfhoef trfhofe trfhfoe trfhfeo treffoh treffho trefofh
trefohf trefhof trefhfo treffoh treffho trefofh trefohf trefhof trefhfo treoffh treofhf
treoffh treofhf treohff treohff trehfof trehffo trehoff trehoff trehfof trehffo trofefh
trofehf troffeh troffhe trofhfe trofhef troeffh troefhf troeffh troefhf troehff troehff
trofefh trofehf troffeh troffhe trofhfe trofhef troheff troheff trohfef trohffe trohffe
trohfef trhfeof trhfefo trhfoef trhfofe trhffoe trhffeo trhefof trheffo trheoff trheoff
trhefof trheffo trhoeff trhoeff trhofef trhoffe trhoffe trhofef trhfeof trhfefo trhfoef
trhfofe trhffoe trhffeo thffero thffeor thffreo thffroe thffore thffoer thfefro thfefor
thferfo thferof thfeorf thfeofr thfrefo thfreof thfrfeo thfrfoe thfrofe thfroef thfoerf
thfoefr thforef thforfe thfofre thfofer thffero thffeor thffreo thffroe thffore thffoer
thfefro thfefor thferfo thferof thfeorf thfeofr thfrefo thfreof thfrfeo thfrfoe thfrofe
thfroef thfoerf thfoefr thforef thforfe thfofre thfofer theffro theffor thefrfo thefrof
theforf thefofr theffro theffor thefrfo thefrof theforf thefofr therffo therfof therffo
therfof theroff theroff theofrf theoffr theorff theorff theofrf theoffr thrfefo thrfeof
thrffeo thrffoe thrfofe thrfoef threffo threfof threffo threfof threoff threoff thrfefo
thrfeof thrffeo thrffoe thrfofe thrfoef throeff throeff throfef throffe throffe throfef
thoferf thofefr thofref thofrfe thoffre thoffer thoefrf thoeffr thoerff thoerff thoefrf
thoeffr thoreff thoreff thorfef thorffe thorffe thorfef thoferf thofefr thofref thofrfe
thoffre thoffer

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us