easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

installments

prairiefarm

dignus

submediation

tailings

unruh

mozarabic

dimoveratque

pennisque

resolvedness

kante

appellavisse

porrectus

erizo

impetrabantque

precorruption

mongomery

pantalgia


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: hinging
cipher variations:
ijohjoh jkpikpi klqjlqj lmrkmrk mnslnsl
notmotm opunpun pqvoqvo qrwprwp rsxqsxq
styrtyr tuzsuzs uvatvat vwbuwbu wxcvxcv
xydwydw yzexzex zafyafy abgzbgz bchacha
cdibdib dejcejc efkdfkd fglegle ghmfhmf

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: hinging
Cipher: srmtrmt

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: hinging
Cipher: AABBB ABAAA ABBAA AABBA ABAAA ABBAA AABBA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: hinging
cipher variations:
ijohjohwzotzotkpofpofyforformvodvodaloplopcronronqhozhoz
exolxolsnoxnoxgdojdojutovtovjkpikpixapuapulqpgqpgzgpsgps
nwpewpebmpqmpqdsposporipaipafypmypmtopyopyhepkepkvupwupw
klqjlqjybqvbqvmrqhrqhahqthqtoxqfxqfcnqrnqretqptqpsjqbjqb
gzqnzqnupqzpqzifqlfqlwvqxvqxlmrkmrkzcrwcrwnsrisribiruiru
pyrgyrgdorsorsfurqurqtkrckrcharoarovqraqrajgrmgrmxwrywry
mnslnsladsxdsxotsjtsjcjsvjsvqzshzshepstpstgvsrvsrulsdlsd
ibspbspwrsbrsbkhsnhsnyxszxsznotmotmbetyetyputkutkdktwktw
ratiatifqtuqtuhwtswtsvmtemtejctqctqxstcstclitoitozytayta
opunpuncfuzfuzqvulvuleluxluxsbujbujgruvruvixutxutwnufnuf
kdurdurytudtudmjupjupazubzubpqvoqvodgvagvarwvmwvmfmvymvy
tcvkcvkhsvwsvwjyvuyvuxovgovglevsevszuveuvenkvqkvqbavcavc
qrwprwpehwbhwbsxwnxwngnwznwzudwldwlitwxtwxkzwvzwvypwhpwh
mfwtfwtavwfvwfolwrlwrcbwdbwdrsxqsxqfixcixctyxoyxohoxaoxa
vexmexmjuxyuxylaxwaxwzqxiqxingxugxubwxgwxgpmxsmxsdcxecxe
styrtyrgjydjyduzypzypipybpybwfynfynkvyzvyzmbyxbyxaryjryj
ohyvhyvcxyhxyhqnytnytedyfdyftuzsuzshkzekzevazqazqjqzcqzc
xgzogzolwzawzanczyczybszkszkpizwizwdyziyzirozuozufezgezg
uvatvatilaflafwbarbarkradradyhaphapmxabxabodazdazctaltal
qjaxjaxezajzajspavpavgfahfahvwbuwbujmbgmbgxcbscbslsbesbe
zibqibqnybcybcpebaebadubmubmrkbykbyfabkabktqbwqbwhgbigbi
wxcvxcvknchnchydctdctmtcftcfajcrjcrozcdzcdqfcbfcbevcnvcn
slczlczgbclbclurcxrcxihcjhcjxydwydwlodiodizeduedunudgudg
bkdskdspadeadergdcgdcfwdowdotmdamdahcdmcdmvsdysdyjidkidk
yzexzexmpejpejafevfevovehvehcletletqbefbefshedhedgxepxep
unebnebidendenwteztezkjeljelzafyafynqfkqfkbgfwgfwpwfiwfi
dmfumfurcfgcfgtifeifehyfqyfqvofcofcjefoefoxufaufalkfmkfm
abgzbgzorglrglchgxhgxqxgjxgjengvngvsdghdghujgfjgfizgrzgr
wpgdpgdkfgpfgpyvgbvgbmlgnlgnbchachapshmshmdihyihyryhkyhk
fohwohwtehiehivkhgkhgjahsahsxqheqhelghqghqzwhcwhcnmhomho
cdibdibqtintinejizjizszilzilgpixpixufijfijwlihlihkbitbit
yrifrifmhirhiraxidxidonipnipdejcejcrujoujofkjakjatajmajm
hqjyqjyvgjkgjkxmjimjilcjucjuzsjgsjgnijsijsbyjeyjepojqojq
efkdfkdsvkpvkpglkblkbubknbknirkzrkzwhklhklynkjnkjmdkvdkv
atkhtkhojktjktczkfzkfqpkrpkrfglegletwlqwlqhmlcmlcvcloclo
jslaslaxilmilmzolkolknelwelwbuliulipklukludalgalgrqlsqls
ghmfhmfuxmrxmrinmdnmdwdmpdmpktmbtmbyjmnjmnapmlpmlofmxfmx
cvmjvmjqlmvlmvebmhbmhsrmtrmthingingvynsynsjoneonexenqenq
luncunczknoknobqnmqnmpgnygnydwnkwnkrmnwmnwfcnicnitsnusnu

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: hinging
Cipher: uvatvat

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: hinging
Cipher: 32423322423322

Extended Methods:
Method #1

Plaintext: hinging
method variations:
nosmosmstxrtxrxycwycwcdhbdhb

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
h i n g i n g 
3 4 3 2 4 3 2 
2 2 3 2 2 3 2 
They are then read out in rows:
34324322232232
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: hinging
Cipher: shogmgh

Read more ...
Method #3

Plaintext: hinging
method variations:
rmhrmhm mhrmhmr hrmhmrm
rmhmrmh mhmrmhr hmrmhrm
mrmhrmh

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: hinging

all 5040 cipher variations:
hinging hingign hingnig hingngi hinggni hinggin hinigng hiniggn hiningg hiningg hinigng
hiniggn hinnigg hinnigg hinngig hinnggi hinnggi hinngig hinging hingign hingnig hingngi
hinggni hinggin higning hignign hignnig hignngi higngni higngin higinng higingn higinng
higingn higignn higignn higning hignign hignnig hignngi higngni higngin higginn higginn
higgnin higgnni higgnni higgnin hiignng hiigngn hiignng hiigngn hiiggnn hiiggnn hiingng
hiinggn hiinngg hiinngg hiingng hiinggn hiinngg hiinngg hiingng hiinggn hiinggn hiingng
hiignng hiigngn hiignng hiigngn hiiggnn hiiggnn hinging hingign hingnig hingngi hinggni
hinggin hinigng hiniggn hiningg hiningg hinigng hiniggn hinnigg hinnigg hinngig hinnggi
hinnggi hinngig hinging hingign hingnig hingngi hinggni hinggin higginn higginn higgnin
higgnni higgnni higgnin higignn higignn higingn higinng higinng higingn hignign higning
higngin higngni hignngi hignnig higning hignign hignnig hignngi higngni higngin hniging
hnigign hnignig hnigngi hniggni hniggin hniigng hniiggn hniingg hniingg hniigng hniiggn
hninigg hninigg hningig hninggi hninggi hningig hniging hnigign hnignig hnigngi hniggni
hniggin hngiing hngiign hnginig hngingi hngigni hngigin hngiing hngiign hnginig hngingi
hngigni hngigin hngniig hngnigi hngniig hngnigi hngngii hngngii hnggini hnggiin hnggnii
hnggnii hnggini hnggiin hniging hnigign hnignig hnigngi hniggni hniggin hniigng hniiggn
hniingg hniingg hniigng hniiggn hninigg hninigg hningig hninggi hninggi hningig hniging
hnigign hnignig hnigngi hniggni hniggin hnngiig hnngigi hnngiig hnngigi hnnggii hnnggii
hnnigig hnniggi hnniigg hnniigg hnnigig hnniggi hnniigg hnniigg hnnigig hnniggi hnniggi
hnnigig hnngiig hnngigi hnngiig hnngigi hnnggii hnnggii hnggini hnggiin hnggnii hnggnii
hnggini hnggiin hngigni hngigin hngingi hnginig hngiing hngiign hngnigi hngniig hngngii
hngngii hngnigi hngniig hngiing hngiign hnginig hngingi hngigni hngigin hgniing hgniign
hgninig hgningi hgnigni hgnigin hgniing hgniign hgninig hgningi hgnigni hgnigin hgnniig
hgnnigi hgnniig hgnnigi hgnngii hgnngii hgngini hgngiin hgngnii hgngnii hgngini hgngiin
hgining hginign hginnig hginngi hgingni hgingin hgiinng hgiingn hgiinng hgiingn hgiignn
hgiignn hgining hginign hginnig hginngi hgingni hgingin hgiginn hgiginn hgignin hgignni
hgignni hgignin hgiinng hgiingn hgiinng hgiingn hgiignn hgiignn hgining hginign hginnig
hginngi hgingni hgingin hginnig hginngi hgining hginign hgingin hgingni hgignni hgignin
hgignni hgignin hgiginn hgiginn hgniing hgniign hgninig hgningi hgnigni hgnigin hgniing
hgniign hgninig hgningi hgnigni hgnigin hgnniig hgnnigi hgnniig hgnnigi hgnngii hgnngii
hgngini hgngiin hgngnii hgngnii hgngini hgngiin hggiinn hggiinn hgginin hgginni hgginni
hgginin hggiinn hggiinn hgginin hgginni hgginni hgginin hggniin hggnini hggniin hggnini
hggnnii hggnnii hggnini hggniin hggnnii hggnnii hggnini hggniin hinging hingign hingnig
hingngi hinggni hinggin hinigng hiniggn hiningg hiningg hinigng hiniggn hinnigg hinnigg
hinngig hinnggi hinnggi hinngig hinging hingign hingnig hingngi hinggni hinggin higning
hignign hignnig hignngi higngni higngin higinng higingn higinng higingn higignn higignn
higning hignign hignnig hignngi higngni higngin higginn higginn higgnin higgnni higgnni
higgnin hiignng hiigngn hiignng hiigngn hiiggnn hiiggnn hiingng hiinggn hiinngg hiinngg
hiingng hiinggn hiinngg hiinngg hiingng hiinggn hiinggn hiingng hiignng hiigngn hiignng
hiigngn hiiggnn hiiggnn hinging hingign hingnig hingngi hinggni hinggin hinigng hiniggn
hiningg hiningg hinigng hiniggn hinnigg hinnigg hinngig hinnggi hinnggi hinngig hinging
hingign hingnig hingngi hinggni hinggin higginn higginn higgnin higgnni higgnni higgnin
higignn higignn higingn higinng higinng higingn hignign higning higngin higngni hignngi
hignnig higning hignign hignnig hignngi higngni higngin hnngiig hnngigi hnngiig hnngigi
hnnggii hnnggii hnnigig hnniggi hnniigg hnniigg hnnigig hnniggi hnniigg hnniigg hnnigig
hnniggi hnniggi hnnigig hnngiig hnngigi hnngiig hnngigi hnnggii hnnggii hngniig hngnigi
hngniig hngnigi hngngii hngngii hnginig hngingi hngiing hngiign hngigin hngigni hngiing
hngiign hnginig hngingi hngigni hngigin hnggiin hnggini hnggiin hnggini hnggnii hnggnii
hnignig hnigngi hniging hnigign hniggin hniggni hningig hninggi hninigg hninigg hningig
hninggi hniingg hniingg hniigng hniiggn hniiggn hniigng hnignig hnigngi hniging hnigign
hniggin hniggni hniging hnigign hnignig hnigngi hniggni hniggin hniigng hniiggn hniingg
hniingg hniigng hniiggn hninigg hninigg hningig hninggi hninggi hningig hniging hnigign
hnignig hnigngi hniggni hniggin hnggiin hnggini hnggiin hnggini hnggnii hnggnii hngigin
hngigni hngiign hngiing hnginig hngingi hngiign hngiing hngigin hngigni hngingi hnginig
hngniig hngnigi hngniig hngnigi hngngii hngngii hgngini hgngiin hgngnii hgngnii hgngini
hgngiin hgnigni hgnigin hgningi hgninig hgniing hgniign hgnnigi hgnniig hgnngii hgnngii
hgnnigi hgnniig hgniing hgniign hgninig hgningi hgnigni hgnigin hggnini hggniin hggnnii
hggnnii hggnini hggniin hgginni hgginin hgginni hgginin hggiinn hggiinn hggnini hggniin
hggnnii hggnnii hggnini hggniin hggiinn hggiinn hgginin hgginni hgginni hgginin hgignni
hgignin hgignni hgignin hgiginn hgiginn hgingni hgingin hginngi hginnig hgining hginign
hginngi hginnig hgingni hgingin hginign hgining hgiinng hgiingn hgiinng hgiingn hgiignn
hgiignn hgngini hgngiin hgngnii hgngnii hgngini hgngiin hgnigni hgnigin hgningi hgninig
hgniing hgniign hgnnigi hgnniig hgnngii hgnngii hgnnigi hgnniig hgniing hgniign hgninig
hgningi hgnigni hgnigin hgiginn hgiginn hgignin hgignni hgignni hgignin hgiignn hgiignn
hgiingn hgiinng hgiinng hgiingn hginign hgining hgingin hgingni hginngi hginnig hgining
hginign hginnig hginngi hgingni hgingin ihnging ihngign ihngnig ihngngi ihnggni ihnggin
ihnigng ihniggn ihningg ihningg ihnigng ihniggn ihnnigg ihnnigg ihnngig ihnnggi ihnnggi
ihnngig ihnging ihngign ihngnig ihngngi ihnggni ihnggin ihgning ihgnign ihgnnig ihgnngi
ihgngni ihgngin ihginng ihgingn ihginng ihgingn ihgignn ihgignn ihgning ihgnign ihgnnig
ihgnngi ihgngni ihgngin ihgginn ihgginn ihggnin ihggnni ihggnni ihggnin ihignng ihigngn
ihignng ihigngn ihiggnn ihiggnn ihingng ihinggn ihinngg ihinngg ihingng ihinggn ihinngg
ihinngg ihingng ihinggn ihinggn ihingng ihignng ihigngn ihignng ihigngn ihiggnn ihiggnn
ihnging ihngign ihngnig ihngngi ihnggni ihnggin ihnigng ihniggn ihningg ihningg ihnigng
ihniggn ihnnigg ihnnigg ihnngig ihnnggi ihnnggi ihnngig ihnging ihngign ihngnig ihngngi
ihnggni ihnggin ihgginn ihgginn ihggnin ihggnni ihggnni ihggnin ihgignn ihgignn ihgingn
ihginng ihginng ihgingn ihgnign ihgning ihgngin ihgngni ihgnngi ihgnnig ihgning ihgnign
ihgnnig ihgnngi ihgngni ihgngin inhging inhgign inhgnig inhgngi inhggni inhggin inhigng
inhiggn inhingg inhingg inhigng inhiggn inhnigg inhnigg inhngig inhnggi inhnggi inhngig
inhging inhgign inhgnig inhgngi inhggni inhggin inghing inghign inghnig inghngi inghgni
inghgin ingihng ingihgn inginhg ingingh ingignh ingighn ingnihg ingnigh ingnhig ingnhgi
ingnghi ingngih ingginh inggihn inggnih inggnhi ingghni ingghin inighng inighgn inignhg
inigngh iniggnh inigghn inihgng inihggn inihngg inihngg inihgng inihggn ininhgg ininhgg
ininghg ininggh ininggh ininghg inighng inighgn inignhg inigngh iniggnh inigghn inngihg
inngigh innghig innghgi inngghi innggih innighg inniggh innihgg innihgg innighg inniggh
innhigg innhigg innhgig innhggi innhggi innhgig inngihg inngigh innghig innghgi inngghi
innggih ingginh inggihn inggnih inggnhi ingghni ingghin ingignh ingighn ingingh inginhg
ingihng ingihgn ingnigh ingnihg ingngih ingnghi ingnhgi ingnhig inghing inghign inghnig
inghngi inghgni inghgin ignhing ignhign ignhnig ignhngi ignhgni ignhgin ignihng ignihgn
igninhg igningh ignignh ignighn ignnihg ignnigh ignnhig ignnhgi ignnghi ignngih ignginh
igngihn igngnih igngnhi ignghni ignghin ighning ighnign ighnnig ighnngi ighngni ighngin
ighinng ighingn ighinng ighingn ighignn ighignn ighning ighnign ighnnig ighnngi ighngni
ighngin ighginn ighginn ighgnin ighgnni ighgnni ighgnin igihnng igihngn igihnng igihngn
igihgnn igihgnn iginhng iginhgn iginnhg iginngh igingnh iginghn iginnhg iginngh iginhng
iginhgn iginghn igingnh igignnh igignhn igignnh igignhn igighnn igighnn ignhing ignhign
ignhnig ignhngi ignhgni ignhgin ignihng ignihgn igninhg igningh ignignh ignighn ignnihg
ignnigh ignnhig ignnhgi ignnghi ignngih ignginh igngihn igngnih igngnhi ignghni ignghin
igghinn igghinn igghnin igghnni igghnni igghnin iggihnn iggihnn igginhn igginnh igginnh
igginhn iggnihn iggninh iggnhin iggnhni iggnnhi iggnnih iggninh iggnihn iggnnih iggnnhi
iggnhni iggnhin iinghng iinghgn iingnhg iingngh iinggnh iingghn iinhgng iinhggn iinhngg
iinhngg iinhgng iinhggn iinnhgg iinnhgg iinnghg iinnggh iinnggh iinnghg iinghng iinghgn
iingnhg iingngh iinggnh iingghn iignhng iignhgn iignnhg iignngh iigngnh iignghn iighnng
iighngn iighnng iighngn iighgnn iighgnn iignhng iignhgn iignnhg iignngh iigngnh iignghn
iigghnn iigghnn iiggnhn iiggnnh iiggnnh iiggnhn iihgnng iihgngn iihgnng iihgngn iihggnn
iihggnn iihngng iihnggn iihnngg iihnngg iihngng iihnggn iihnngg iihnngg iihngng iihnggn
iihnggn iihngng iihgnng iihgngn iihgnng iihgngn iihggnn iihggnn iinghng iinghgn iingnhg
iingngh iinggnh iingghn iinhgng iinhggn iinhngg iinhngg iinhgng iinhggn iinnhgg iinnhgg
iinnghg iinnggh iinnggh iinnghg iinghng iinghgn iingnhg iingngh iinggnh iingghn iigghnn
iigghnn iiggnhn iiggnnh iiggnnh iiggnhn iighgnn iighgnn iighngn iighnng iighnng iighngn
iignhgn iignhng iignghn iigngnh iignngh iignnhg iignhng iignhgn iignnhg iignngh iigngnh
iignghn inngihg inngigh innghig innghgi inngghi innggih innighg inniggh innihgg innihgg
innighg inniggh innhigg innhigg innhgig innhggi innhggi innhgig inngihg inngigh innghig
innghgi inngghi innggih ingnihg ingnigh ingnhig ingnhgi ingnghi ingngih inginhg ingingh
ingihng ingihgn ingighn ingignh inghing inghign inghnig inghngi inghgni inghgin inggihn
ingginh ingghin ingghni inggnhi inggnih inignhg inigngh inighng inighgn inigghn iniggnh
ininghg ininggh ininhgg ininhgg ininghg ininggh inihngg inihngg inihgng inihggn inihggn
inihgng inignhg inigngh inighng inighgn inigghn iniggnh inhging inhgign inhgnig inhgngi
inhggni inhggin inhigng inhiggn inhingg inhingg inhigng inhiggn inhnigg inhnigg inhngig
inhnggi inhnggi inhngig inhging inhgign inhgnig inhgngi inhggni inhggin inggihn ingginh
ingghin ingghni inggnhi inggnih ingighn ingignh ingihgn ingihng inginhg ingingh inghign
inghing inghgin inghgni inghngi inghnig ingnihg ingnigh ingnhig ingnhgi ingnghi ingngih
ignginh igngihn igngnih igngnhi ignghni ignghin ignignh ignighn igningh igninhg ignihng
ignihgn ignnigh ignnihg ignngih ignnghi ignnhgi ignnhig ignhing ignhign ignhnig ignhngi
ignhgni ignhgin iggninh iggnihn iggnnih iggnnhi iggnhni iggnhin igginnh igginhn igginnh
igginhn iggihnn iggihnn iggninh iggnihn iggnnih iggnnhi iggnhni iggnhin igghinn igghinn
igghnin igghnni igghnni igghnin igignnh igignhn igignnh igignhn igighnn igighnn igingnh
iginghn iginngh iginnhg iginhng iginhgn iginngh iginnhg igingnh iginghn iginhgn iginhng
igihnng igihngn igihnng igihngn igihgnn igihgnn ignginh igngihn igngnih igngnhi ignghni
ignghin ignignh ignighn igningh igninhg ignihng ignihgn ignnigh ignnihg ignngih ignnghi
ignnhgi ignnhig ignhing ignhign ignhnig ignhngi ignhgni ignhgin ighginn ighginn ighgnin
ighgnni ighgnni ighgnin ighignn ighignn ighingn ighinng ighinng ighingn ighnign ighning
ighngin ighngni ighnngi ighnnig ighning ighnign ighnnig ighnngi ighngni ighngin nihging
nihgign nihgnig nihgngi nihggni nihggin nihigng nihiggn nihingg nihingg nihigng nihiggn
nihnigg nihnigg nihngig nihnggi nihnggi nihngig nihging nihgign nihgnig nihgngi nihggni
nihggin nighing nighign nighnig nighngi nighgni nighgin nigihng nigihgn niginhg nigingh
nigignh nigighn nignihg nignigh nignhig nignhgi nignghi nigngih nigginh niggihn niggnih
niggnhi nigghni nigghin niighng niighgn niignhg niigngh niiggnh niigghn niihgng niihggn
niihngg niihngg niihgng niihggn niinhgg niinhgg niinghg niinggh niinggh niinghg niighng
niighgn niignhg niigngh niiggnh niigghn ningihg ningigh ninghig ninghgi ningghi ninggih
ninighg niniggh ninihgg ninihgg ninighg niniggh ninhigg ninhigg ninhgig ninhggi ninhggi
ninhgig ningihg ningigh ninghig ninghgi ningghi ninggih nigginh niggihn niggnih niggnhi
nigghni nigghin nigignh nigighn nigingh niginhg nigihng nigihgn nignigh nignihg nigngih
nignghi nignhgi nignhig nighing nighign nighnig nighngi nighgni nighgin nhiging nhigign
nhignig nhigngi nhiggni nhiggin nhiigng nhiiggn nhiingg nhiingg nhiigng nhiiggn nhinigg
nhinigg nhingig nhinggi nhinggi nhingig nhiging nhigign nhignig nhigngi nhiggni nhiggin
nhgiing nhgiign nhginig nhgingi nhgigni nhgigin nhgiing nhgiign nhginig nhgingi nhgigni
nhgigin nhgniig nhgnigi nhgniig nhgnigi nhgngii nhgngii nhggini nhggiin nhggnii nhggnii
nhggini nhggiin nhiging nhigign nhignig nhigngi nhiggni nhiggin nhiigng nhiiggn nhiingg
nhiingg nhiigng nhiiggn nhinigg nhinigg nhingig nhinggi nhinggi nhingig nhiging nhigign
nhignig nhigngi nhiggni nhiggin nhngiig nhngigi nhngiig nhngigi nhnggii nhnggii nhnigig
nhniggi nhniigg nhniigg nhnigig nhniggi nhniigg nhniigg nhnigig nhniggi nhniggi nhnigig
nhngiig nhngigi nhngiig nhngigi nhnggii nhnggii nhggini nhggiin nhggnii nhggnii nhggini
nhggiin nhgigni nhgigin nhgingi nhginig nhgiing nhgiign nhgnigi nhgniig nhgngii nhgngii
nhgnigi nhgniig nhgiing nhgiign nhginig nhgingi nhgigni nhgigin nghiing nghiign nghinig
nghingi nghigni nghigin nghiing nghiign nghinig nghingi nghigni nghigin nghniig nghnigi
nghniig nghnigi nghngii nghngii nghgini nghgiin nghgnii nghgnii nghgini nghgiin ngihing
ngihign ngihnig ngihngi ngihgni ngihgin ngiihng ngiihgn ngiinhg ngiingh ngiignh ngiighn
nginihg nginigh nginhig nginhgi nginghi ngingih ngiginh ngigihn ngignih ngignhi ngighni
ngighin ngiihng ngiihgn ngiinhg ngiingh ngiignh ngiighn ngihing ngihign ngihnig ngihngi
ngihgni ngihgin nginhig nginhgi nginihg nginigh ngingih nginghi ngighni ngighin ngignhi
ngignih ngiginh ngigihn ngniihg ngniigh ngnihig ngnihgi ngnighi ngnigih ngniihg ngniigh
ngnihig ngnihgi ngnighi ngnigih ngnhiig ngnhigi ngnhiig ngnhigi ngnhgii ngnhgii ngngihi
ngngiih ngnghii ngnghii ngngihi ngngiih nggiinh nggiihn ngginih ngginhi nggihni nggihin
nggiinh nggiihn ngginih ngginhi nggihni nggihin nggniih nggnihi nggniih nggnihi nggnhii
nggnhii ngghini ngghiin ngghnii ngghnii ngghini ngghiin nihging nihgign nihgnig nihgngi
nihggni nihggin nihigng nihiggn nihingg nihingg nihigng nihiggn nihnigg nihnigg nihngig
nihnggi nihnggi nihngig nihging nihgign nihgnig nihgngi nihggni nihggin nighing nighign
nighnig nighngi nighgni nighgin nigihng nigihgn niginhg nigingh nigignh nigighn nignihg
nignigh nignhig nignhgi nignghi nigngih nigginh niggihn niggnih niggnhi nigghni nigghin
niighng niighgn niignhg niigngh niiggnh niigghn niihgng niihggn niihngg niihngg niihgng
niihggn niinhgg niinhgg niinghg niinggh niinggh niinghg niighng niighgn niignhg niigngh
niiggnh niigghn ningihg ningigh ninghig ninghgi ningghi ninggih ninighg niniggh ninihgg
ninihgg ninighg niniggh ninhigg ninhigg ninhgig ninhggi ninhggi ninhgig ningihg ningigh
ninghig ninghgi ningghi ninggih nigginh niggihn niggnih niggnhi nigghni nigghin nigignh
nigighn nigingh niginhg nigihng nigihgn nignigh nignihg nigngih nignghi nignhgi nignhig
nighing nighign nighnig nighngi nighgni nighgin nnhgiig nnhgigi nnhgiig nnhgigi nnhggii
nnhggii nnhigig nnhiggi nnhiigg nnhiigg nnhigig nnhiggi nnhiigg nnhiigg nnhigig nnhiggi
nnhiggi nnhigig nnhgiig nnhgigi nnhgiig nnhgigi nnhggii nnhggii nnghiig nnghigi nnghiig
nnghigi nnghgii nnghgii nngihig nngihgi nngiihg nngiigh nngigih nngighi nngiihg nngiigh
nngihig nngihgi nngighi nngigih nnggiih nnggihi nnggiih nnggihi nngghii nngghii nnighig
nnighgi nnigihg nnigigh nniggih nnigghi nnihgig nnihggi nnihigg nnihigg nnihgig nnihggi
nniihgg nniihgg nniighg nniiggh nniiggh nniighg nnighig nnighgi nnigihg nnigigh nniggih
nnigghi nnigihg nnigigh nnighig nnighgi nnigghi nniggih nniighg nniiggh nniihgg nniihgg
nniighg nniiggh nnihigg nnihigg nnihgig nnihggi nnihggi nnihgig nnigihg nnigigh nnighig
nnighgi nnigghi nniggih nnggiih nnggihi nnggiih nnggihi nngghii nngghii nngigih nngighi
nngiigh nngiihg nngihig nngihgi nngiigh nngiihg nngigih nngighi nngihgi nngihig nnghiig
nnghigi nnghiig nnghigi nnghgii nnghgii nghgini nghgiin nghgnii nghgnii nghgini nghgiin
nghigni nghigin nghingi nghinig nghiing nghiign nghnigi nghniig nghngii nghngii nghnigi
nghniig nghiing nghiign nghinig nghingi nghigni nghigin ngghini ngghiin ngghnii ngghnii
ngghini ngghiin nggihni nggihin ngginhi ngginih nggiinh nggiihn nggnihi nggniih nggnhii
nggnhii nggnihi nggniih nggiinh nggiihn ngginih ngginhi nggihni nggihin ngighni ngighin
ngignhi ngignih ngiginh ngigihn ngihgni ngihgin ngihngi ngihnig ngihing ngihign nginhgi
nginhig nginghi ngingih nginigh nginihg ngiihng ngiihgn ngiinhg ngiingh ngiignh ngiighn
ngngihi ngngiih ngnghii ngnghii ngngihi ngngiih ngnighi ngnigih ngnihgi ngnihig ngniihg
ngniigh ngnhigi ngnhiig ngnhgii ngnhgii ngnhigi ngnhiig ngniihg ngniigh ngnihig ngnihgi
ngnighi ngnigih ngiginh ngigihn ngignih ngignhi ngighni ngighin ngiignh ngiighn ngiingh
ngiinhg ngiihng ngiihgn nginigh nginihg ngingih nginghi nginhgi nginhig ngihing ngihign
ngihnig ngihngi ngihgni ngihgin ginhing ginhign ginhnig ginhngi ginhgni ginhgin ginihng
ginihgn gininhg giningh ginignh ginighn ginnihg ginnigh ginnhig ginnhgi ginnghi ginngih
ginginh gingihn gingnih gingnhi ginghni ginghin gihning gihnign gihnnig gihnngi gihngni
gihngin gihinng gihingn gihinng gihingn gihignn gihignn gihning gihnign gihnnig gihnngi
gihngni gihngin gihginn gihginn gihgnin gihgnni gihgnni gihgnin giihnng giihngn giihnng
giihngn giihgnn giihgnn giinhng giinhgn giinnhg giinngh giingnh giinghn giinnhg giinngh
giinhng giinhgn giinghn giingnh giignnh giignhn giignnh giignhn giighnn giighnn ginhing
ginhign ginhnig ginhngi ginhgni ginhgin ginihng ginihgn gininhg giningh ginignh ginighn
ginnihg ginnigh ginnhig ginnhgi ginnghi ginngih ginginh gingihn gingnih gingnhi ginghni
ginghin gighinn gighinn gighnin gighnni gighnni gighnin gigihnn gigihnn giginhn giginnh
giginnh giginhn gignihn gigninh gignhin gignhni gignnhi gignnih gigninh gignihn gignnih
gignnhi gignhni gignhin gnihing gnihign gnihnig gnihngi gnihgni gnihgin gniihng gniihgn
gniinhg gniingh gniignh gniighn gninihg gninigh gninhig gninhgi gninghi gningih gniginh
gnigihn gnignih gnignhi gnighni gnighin gnhiing gnhiign gnhinig gnhingi gnhigni gnhigin
gnhiing gnhiign gnhinig gnhingi gnhigni gnhigin gnhniig gnhnigi gnhniig gnhnigi gnhngii
gnhngii gnhgini gnhgiin gnhgnii gnhgnii gnhgini gnhgiin gnihing gnihign gnihnig gnihngi
gnihgni gnihgin gniihng gniihgn gniinhg gniingh gniignh gniighn gninihg gninigh gninhig
gninhgi gninghi gningih gniginh gnigihn gnignih gnignhi gnighni gnighin gnnhiig gnnhigi
gnnhiig gnnhigi gnnhgii gnnhgii gnnihig gnnihgi gnniihg gnniigh gnnigih gnnighi gnniihg
gnniigh gnnihig gnnihgi gnnighi gnnigih gnngiih gnngihi gnngiih gnngihi gnnghii gnnghii
gnghini gnghiin gnghnii gnghnii gnghini gnghiin gngihni gngihin gnginhi gnginih gngiinh
gngiihn gngnihi gngniih gngnhii gngnhii gngnihi gngniih gngiinh gngiihn gnginih gnginhi
gngihni gngihin ghniing ghniign ghninig ghningi ghnigni ghnigin ghniing ghniign ghninig
ghningi ghnigni ghnigin ghnniig ghnnigi ghnniig ghnnigi ghnngii ghnngii ghngini ghngiin
ghngnii ghngnii ghngini ghngiin ghining ghinign ghinnig ghinngi ghingni ghingin ghiinng
ghiingn ghiinng ghiingn ghiignn ghiignn ghining ghinign ghinnig ghinngi ghingni ghingin
ghiginn ghiginn ghignin ghignni ghignni ghignin ghiinng ghiingn ghiinng ghiingn ghiignn
ghiignn ghining ghinign ghinnig ghinngi ghingni ghingin ghinnig ghinngi ghining ghinign
ghingin ghingni ghignni ghignin ghignni ghignin ghiginn ghiginn ghniing ghniign ghninig
ghningi ghnigni ghnigin ghniing ghniign ghninig ghningi ghnigni ghnigin ghnniig ghnnigi
ghnniig ghnnigi ghnngii ghnngii ghngini ghngiin ghngnii ghngnii ghngini ghngiin ghgiinn
ghgiinn ghginin ghginni ghginni ghginin ghgiinn ghgiinn ghginin ghginni ghginni ghginin
ghgniin ghgnini ghgniin ghgnini ghgnnii ghgnnii ghgnini ghgniin ghgnnii ghgnnii ghgnini
ghgniin ginhing ginhign ginhnig ginhngi ginhgni ginhgin ginihng ginihgn gininhg giningh
ginignh ginighn ginnihg ginnigh ginnhig ginnhgi ginnghi ginngih ginginh gingihn gingnih
gingnhi ginghni ginghin gihning gihnign gihnnig gihnngi gihngni gihngin gihinng gihingn
gihinng gihingn gihignn gihignn gihning gihnign gihnnig gihnngi gihngni gihngin gihginn
gihginn gihgnin gihgnni gihgnni gihgnin giihnng giihngn giihnng giihngn giihgnn giihgnn
giinhng giinhgn giinnhg giinngh giingnh giinghn giinnhg giinngh giinhng giinhgn giinghn
giingnh giignnh giignhn giignnh giignhn giighnn giighnn ginhing ginhign ginhnig ginhngi
ginhgni ginhgin ginihng ginihgn gininhg giningh ginignh ginighn ginnihg ginnigh ginnhig
ginnhgi ginnghi ginngih ginginh gingihn gingnih gingnhi ginghni ginghin gighinn gighinn
gighnin gighnni gighnni gighnin gigihnn gigihnn giginhn giginnh giginnh giginhn gignihn
gigninh gignhin gignhni gignnhi gignnih gigninh gignihn gignnih gignnhi gignhni gignhin
gnnhiig gnnhigi gnnhiig gnnhigi gnnhgii gnnhgii gnnihig gnnihgi gnniihg gnniigh gnnigih
gnnighi gnniihg gnniigh gnnihig gnnihgi gnnighi gnnigih gnngiih gnngihi gnngiih gnngihi
gnnghii gnnghii gnhniig gnhnigi gnhniig gnhnigi gnhngii gnhngii gnhinig gnhingi gnhiing
gnhiign gnhigin gnhigni gnhiing gnhiign gnhinig gnhingi gnhigni gnhigin gnhgiin gnhgini
gnhgiin gnhgini gnhgnii gnhgnii gnihnig gnihngi gnihing gnihign gnihgin gnihgni gninhig
gninhgi gninihg gninigh gningih gninghi gniinhg gniingh gniihng gniihgn gniighn gniignh
gnignih gnignhi gniginh gnigihn gnighin gnighni gnihing gnihign gnihnig gnihngi gnihgni
gnihgin gniihng gniihgn gniinhg gniingh gniignh gniighn gninihg gninigh gninhig gninhgi
gninghi gningih gniginh gnigihn gnignih gnignhi gnighni gnighin gnghiin gnghini gnghiin
gnghini gnghnii gnghnii gngihin gngihni gngiihn gngiinh gnginih gnginhi gngiihn gngiinh
gngihin gngihni gnginhi gnginih gngniih gngnihi gngniih gngnihi gngnhii gngnhii ggnhini
ggnhiin ggnhnii ggnhnii ggnhini ggnhiin ggnihni ggnihin ggninhi ggninih ggniinh ggniihn
ggnnihi ggnniih ggnnhii ggnnhii ggnnihi ggnniih ggniinh ggniihn ggninih ggninhi ggnihni
ggnihin gghnini gghniin gghnnii gghnnii gghnini gghniin gghinni gghinin gghinni gghinin
gghiinn gghiinn gghnini gghniin gghnnii gghnnii gghnini gghniin gghiinn gghiinn gghinin
gghinni gghinni gghinin ggihnni ggihnin ggihnni ggihnin ggihinn ggihinn gginhni gginhin
gginnhi gginnih ggininh gginihn gginnhi gginnih gginhni gginhin gginihn ggininh ggiinnh
ggiinhn ggiinnh ggiinhn ggiihnn ggiihnn ggnhini ggnhiin ggnhnii ggnhnii ggnhini ggnhiin
ggnihni ggnihin ggninhi ggninih ggniinh ggniihn ggnnihi ggnniih ggnnhii ggnnhii ggnnihi
ggnniih ggniinh ggniihn ggninih ggninhi ggnihni ggnihin ggihinn ggihinn ggihnin ggihnni
ggihnni ggihnin ggiihnn ggiihnn ggiinhn ggiinnh ggiinnh ggiinhn gginihn ggininh gginhin
gginhni gginnhi gginnih ggininh gginihn gginnih gginnhi gginhni gginhin iinghng iinghgn
iingnhg iingngh iinggnh iingghn iinhgng iinhggn iinhngg iinhngg iinhgng iinhggn iinnhgg
iinnhgg iinnghg iinnggh iinnggh iinnghg iinghng iinghgn iingnhg iingngh iinggnh iingghn
iignhng iignhgn iignnhg iignngh iigngnh iignghn iighnng iighngn iighnng iighngn iighgnn
iighgnn iignhng iignhgn iignnhg iignngh iigngnh iignghn iigghnn iigghnn iiggnhn iiggnnh
iiggnnh iiggnhn iihgnng iihgngn iihgnng iihgngn iihggnn iihggnn iihngng iihnggn iihnngg
iihnngg iihngng iihnggn iihnngg iihnngg iihngng iihnggn iihnggn iihngng iihgnng iihgngn
iihgnng iihgngn iihggnn iihggnn iinghng iinghgn iingnhg iingngh iinggnh iingghn iinhgng
iinhggn iinhngg iinhngg iinhgng iinhggn iinnhgg iinnhgg iinnghg iinnggh iinnggh iinnghg
iinghng iinghgn iingnhg iingngh iinggnh iingghn iigghnn iigghnn iiggnhn iiggnnh iiggnnh
iiggnhn iighgnn iighgnn iighngn iighnng iighnng iighngn iignhgn iignhng iignghn iigngnh
iignngh iignnhg iignhng iignhgn iignnhg iignngh iigngnh iignghn inighng inighgn inignhg
inigngh iniggnh inigghn inihgng inihggn inihngg inihngg inihgng inihggn ininhgg ininhgg
ininghg ininggh ininggh ininghg inighng inighgn inignhg inigngh iniggnh inigghn ingihng
ingihgn inginhg ingingh ingignh ingighn inghing inghign inghnig inghngi inghgni inghgin
ingnhig ingnhgi ingnihg ingnigh ingngih ingnghi ingghni ingghin inggnhi inggnih ingginh
inggihn inhging inhgign inhgnig inhgngi inhggni inhggin inhigng inhiggn inhingg inhingg
inhigng inhiggn inhnigg inhnigg inhngig inhnggi inhnggi inhngig inhging inhgign inhgnig
inhgngi inhggni inhggin innghig innghgi inngihg inngigh innggih inngghi innhgig innhggi
innhigg innhigg innhgig innhggi innihgg innihgg innighg inniggh inniggh innighg innghig
innghgi inngihg inngigh innggih inngghi ingghni ingghin inggnhi inggnih ingginh inggihn
inghgni inghgin inghngi inghnig inghing inghign ingnhgi ingnhig ingnghi ingngih ingnigh
ingnihg ingihng ingihgn inginhg ingingh ingignh ingighn ignihng ignihgn igninhg igningh
ignignh ignighn ignhing ignhign ignhnig ignhngi ignhgni ignhgin ignnhig ignnhgi ignnihg
ignnigh ignngih ignnghi ignghni ignghin igngnhi igngnih ignginh igngihn iginhng iginhgn
iginnhg iginngh igingnh iginghn igihnng igihngn igihnng igihngn igihgnn igihgnn iginhng
iginhgn iginnhg iginngh igingnh iginghn igighnn igighnn igignhn igignnh igignnh igignhn
ighinng ighingn ighinng ighingn ighignn ighignn ighning ighnign ighnnig ighnngi ighngni
ighngin ighnnig ighnngi ighning ighnign ighngin ighngni ighgnni ighgnin ighgnni ighgnin
ighginn ighginn ignihng ignihgn igninhg igningh ignignh ignighn ignhing ignhign ignhnig
ignhngi ignhgni ignhgin ignnhig ignnhgi ignnihg ignnigh ignngih ignnghi ignghni ignghin
igngnhi igngnih ignginh igngihn iggihnn iggihnn igginhn igginnh igginnh igginhn igghinn
igghinn igghnin igghnni igghnni igghnin iggnhin iggnhni iggnihn iggninh iggnnih iggnnhi
iggnhni iggnhin iggnnhi iggnnih iggninh iggnihn ihnging ihngign ihngnig ihngngi ihnggni
ihnggin ihnigng ihniggn ihningg ihningg ihnigng ihniggn ihnnigg ihnnigg ihnngig ihnnggi
ihnnggi ihnngig ihnging ihngign ihngnig ihngngi ihnggni ihnggin ihgning ihgnign ihgnnig
ihgnngi ihgngni ihgngin ihginng ihgingn ihginng ihgingn ihgignn ihgignn ihgning ihgnign
ihgnnig ihgnngi ihgngni ihgngin ihgginn ihgginn ihggnin ihggnni ihggnni ihggnin ihignng
ihigngn ihignng ihigngn ihiggnn ihiggnn ihingng ihinggn ihinngg ihinngg ihingng ihinggn
ihinngg ihinngg ihingng ihinggn ihinggn ihingng ihignng ihigngn ihignng ihigngn ihiggnn
ihiggnn ihnging ihngign ihngnig ihngngi ihnggni ihnggin ihnigng ihniggn ihningg ihningg
ihnigng ihniggn ihnnigg ihnnigg ihnngig ihnnggi ihnnggi ihnngig ihnging ihngign ihngnig
ihngngi ihnggni ihnggin ihgginn ihgginn ihggnin ihggnni ihggnni ihggnin ihgignn ihgignn
ihgingn ihginng ihginng ihgingn ihgnign ihgning ihgngin ihgngni ihgnngi ihgnnig ihgning
ihgnign ihgnnig ihgnngi ihgngni ihgngin innghig innghgi inngihg inngigh innggih inngghi
innhgig innhggi innhigg innhigg innhgig innhggi innihgg innihgg innighg inniggh inniggh
innighg innghig innghgi inngihg inngigh innggih inngghi ingnhig ingnhgi ingnihg ingnigh
ingngih ingnghi inghnig inghngi inghing inghign inghgin inghgni ingihng ingihgn inginhg
ingingh ingignh ingighn ingghin ingghni inggihn ingginh inggnih inggnhi inhgnig inhgngi
inhging inhgign inhggin inhggni inhngig inhnggi inhnigg inhnigg inhngig inhnggi inhingg
inhingg inhigng inhiggn inhiggn inhigng inhgnig inhgngi inhging inhgign inhggin inhggni
inighng inighgn inignhg inigngh iniggnh inigghn inihgng inihggn inihngg inihngg inihgng
inihggn ininhgg ininhgg ininghg ininggh ininggh ininghg inighng inighgn inignhg inigngh
iniggnh inigghn ingghin ingghni inggihn ingginh inggnih inggnhi inghgin inghgni inghign
inghing inghnig inghngi ingihgn ingihng ingighn ingignh ingingh inginhg ingnhig ingnhgi
ingnihg ingnigh ingngih ingnghi ignghni ignghin igngnhi igngnih ignginh igngihn ignhgni
ignhgin ignhngi ignhnig ignhing ignhign ignnhgi ignnhig ignnghi ignngih ignnigh ignnihg
ignihng ignihgn igninhg igningh ignignh ignighn iggnhni iggnhin iggnnhi iggnnih iggninh
iggnihn igghnni igghnin igghnni igghnin igghinn igghinn iggnhni iggnhin iggnnhi iggnnih
iggninh iggnihn iggihnn iggihnn igginhn igginnh igginnh igginhn ighgnni ighgnin ighgnni
ighgnin ighginn ighginn ighngni ighngin ighnngi ighnnig ighning ighnign ighnngi ighnnig
ighngni ighngin ighnign ighning ighinng ighingn ighinng ighingn ighignn ighignn ignghni
ignghin igngnhi igngnih ignginh igngihn ignhgni ignhgin ignhngi ignhnig ignhing ignhign
ignnhgi ignnhig ignnghi ignngih ignnigh ignnihg ignihng ignihgn igninhg igningh ignignh
ignighn igighnn igighnn igignhn igignnh igignnh igignhn igihgnn igihgnn igihngn igihnng
igihnng igihngn iginhgn iginhng iginghn igingnh iginngh iginnhg iginhng iginhgn iginnhg
iginngh igingnh iginghn ningihg ningigh ninghig ninghgi ningghi ninggih ninighg niniggh
ninihgg ninihgg ninighg niniggh ninhigg ninhigg ninhgig ninhggi ninhggi ninhgig ningihg
ningigh ninghig ninghgi ningghi ninggih nignihg nignigh nignhig nignhgi nignghi nigngih
niginhg nigingh nigihng nigihgn nigighn nigignh nighing nighign nighnig nighngi nighgni
nighgin niggihn nigginh nigghin nigghni niggnhi niggnih niignhg niigngh niighng niighgn
niigghn niiggnh niinghg niinggh niinhgg niinhgg niinghg niinggh niihngg niihngg niihgng
niihggn niihggn niihgng niignhg niigngh niighng niighgn niigghn niiggnh nihging nihgign
nihgnig nihgngi nihggni nihggin nihigng nihiggn nihingg nihingg nihigng nihiggn nihnigg
nihnigg nihngig nihnggi nihnggi nihngig nihging nihgign nihgnig nihgngi nihggni nihggin
niggihn nigginh nigghin nigghni niggnhi niggnih nigighn nigignh nigihgn nigihng niginhg
nigingh nighign nighing nighgin nighgni nighngi nighnig nignihg nignigh nignhig nignhgi
nignghi nigngih nnigihg nnigigh nnighig nnighgi nnigghi nniggih nniighg nniiggh nniihgg
nniihgg nniighg nniiggh nnihigg nnihigg nnihgig nnihggi nnihggi nnihgig nnigihg nnigigh
nnighig nnighgi nnigghi nniggih nngiihg nngiigh nngihig nngihgi nngighi nngigih nngiihg
nngiigh nngihig nngihgi nngighi nngigih nnghiig nnghigi nnghiig nnghigi nnghgii nnghgii
nnggihi nnggiih nngghii nngghii nnggihi nnggiih nnigihg nnigigh nnighig nnighgi nnigghi
nniggih nniighg nniiggh nniihgg nniihgg nniighg nniiggh nnihigg nnihigg nnihgig nnihggi
nnihggi nnihgig nnigihg nnigigh nnighig nnighgi nnigghi nniggih nnhgiig nnhgigi nnhgiig
nnhgigi nnhggii nnhggii nnhigig nnhiggi nnhiigg nnhiigg nnhigig nnhiggi nnhiigg nnhiigg
nnhigig nnhiggi nnhiggi nnhigig nnhgiig nnhgigi nnhgiig nnhgigi nnhggii nnhggii nnggihi
nnggiih nngghii nngghii nnggihi nnggiih nngighi nngigih nngihgi nngihig nngiihg nngiigh
nnghigi nnghiig nnghgii nnghgii nnghigi nnghiig nngiihg nngiigh nngihig nngihgi nngighi
nngigih ngniihg ngniigh ngnihig ngnihgi ngnighi ngnigih ngniihg ngniigh ngnihig ngnihgi
ngnighi ngnigih ngnhiig ngnhigi ngnhiig ngnhigi ngnhgii ngnhgii ngngihi ngngiih ngnghii
ngnghii ngngihi ngngiih nginihg nginigh nginhig nginhgi nginghi ngingih ngiinhg ngiingh
ngiihng ngiihgn ngiighn ngiignh ngihing ngihign ngihnig ngihngi ngihgni ngihgin ngigihn
ngiginh ngighin ngighni ngignhi ngignih ngiinhg ngiingh ngiihng ngiihgn ngiighn ngiignh
nginihg nginigh nginhig nginhgi nginghi ngingih ngihnig ngihngi ngihing ngihign ngihgin
ngihgni ngignhi ngignih ngighni ngighin ngigihn ngiginh nghiing nghiign nghinig nghingi
nghigni nghigin nghiing nghiign nghinig nghingi nghigni nghigin nghniig nghnigi nghniig
nghnigi nghngii nghngii nghgini nghgiin nghgnii nghgnii nghgini nghgiin nggiihn nggiinh
nggihin nggihni ngginhi ngginih nggiihn nggiinh nggihin nggihni ngginhi ngginih ngghiin
ngghini ngghiin ngghini ngghnii ngghnii nggnihi nggniih nggnhii nggnhii nggnihi nggniih
ningihg ningigh ninghig ninghgi ningghi ninggih ninighg niniggh ninihgg ninihgg ninighg
niniggh ninhigg ninhigg ninhgig ninhggi ninhggi ninhgig ningihg ningigh ninghig ninghgi
ningghi ninggih nignihg nignigh nignhig nignhgi nignghi nigngih niginhg nigingh nigihng
nigihgn nigighn nigignh nighing nighign nighnig nighngi nighgni nighgin niggihn nigginh
nigghin nigghni niggnhi niggnih niignhg niigngh niighng niighgn niigghn niiggnh niinghg
niinggh niinhgg niinhgg niinghg niinggh niihngg niihngg niihgng niihggn niihggn niihgng
niignhg niigngh niighng niighgn niigghn niiggnh nihging nihgign nihgnig nihgngi nihggni
nihggin nihigng nihiggn nihingg nihingg nihigng nihiggn nihnigg nihnigg nihngig nihnggi
nihnggi nihngig nihging nihgign nihgnig nihgngi nihggni nihggin niggihn nigginh nigghin
nigghni niggnhi niggnih nigighn nigignh nigihgn nigihng niginhg nigingh nighign nighing
nighgin nighgni nighngi nighnig nignihg nignigh nignhig nignhgi nignghi nigngih nhngiig
nhngigi nhngiig nhngigi nhnggii nhnggii nhnigig nhniggi nhniigg nhniigg nhnigig nhniggi
nhniigg nhniigg nhnigig nhniggi nhniggi nhnigig nhngiig nhngigi nhngiig nhngigi nhnggii
nhnggii nhgniig nhgnigi nhgniig nhgnigi nhgngii nhgngii nhginig nhgingi nhgiing nhgiign
nhgigin nhgigni nhgiing nhgiign nhginig nhgingi nhgigni nhgigin nhggiin nhggini nhggiin
nhggini nhggnii nhggnii nhignig nhigngi nhiging nhigign nhiggin nhiggni nhingig nhinggi
nhinigg nhinigg nhingig nhinggi nhiingg nhiingg nhiigng nhiiggn nhiiggn nhiigng nhignig
nhigngi nhiging nhigign nhiggin nhiggni nhiging nhigign nhignig nhigngi nhiggni nhiggin
nhiigng nhiiggn nhiingg nhiingg nhiigng nhiiggn nhinigg nhinigg nhingig nhinggi nhinggi
nhingig nhiging nhigign nhignig nhigngi nhiggni nhiggin nhggiin nhggini nhggiin nhggini
nhggnii nhggnii nhgigin nhgigni nhgiign nhgiing nhginig nhgingi nhgiign nhgiing nhgigin
nhgigni nhgingi nhginig nhgniig nhgnigi nhgniig nhgnigi nhgngii nhgngii ngngihi ngngiih
ngnghii ngnghii ngngihi ngngiih ngnighi ngnigih ngnihgi ngnihig ngniihg ngniigh ngnhigi
ngnhiig ngnhgii ngnhgii ngnhigi ngnhiig ngniihg ngniigh ngnihig ngnihgi ngnighi ngnigih
nggnihi nggniih nggnhii nggnhii nggnihi nggniih ngginhi ngginih nggihni nggihin nggiihn
nggiinh ngghini ngghiin ngghnii ngghnii ngghini ngghiin nggiihn nggiinh nggihin nggihni
ngginhi ngginih ngignhi ngignih ngighni ngighin ngigihn ngiginh nginghi ngingih nginhgi
nginhig nginihg nginigh ngihngi ngihnig ngihgni ngihgin ngihign ngihing ngiinhg ngiingh
ngiihng ngiihgn ngiighn ngiignh nghgini nghgiin nghgnii nghgnii nghgini nghgiin nghigni
nghigin nghingi nghinig nghiing nghiign nghnigi nghniig nghngii nghngii nghnigi nghniig
nghiing nghiign nghinig nghingi nghigni nghigin ngigihn ngiginh ngighin ngighni ngignhi
ngignih ngiighn ngiignh ngiihgn ngiihng ngiinhg ngiingh ngihign ngihing ngihgin ngihgni
ngihngi ngihnig nginihg nginigh nginhig nginhgi nginghi ngingih ginginh gingihn gingnih
gingnhi ginghni ginghin ginignh ginighn giningh gininhg ginihng ginihgn ginnigh ginnihg
ginngih ginnghi ginnhgi ginnhig ginhing ginhign ginhnig ginhngi ginhgni ginhgin gigninh
gignihn gignnih gignnhi gignhni gignhin giginnh giginhn giginnh giginhn gigihnn gigihnn
gigninh gignihn gignnih gignnhi gignhni gignhin gighinn gighinn gighnin gighnni gighnni
gighnin giignnh giignhn giignnh giignhn giighnn giighnn giingnh giinghn giinngh giinnhg
giinhng giinhgn giinngh giinnhg giingnh giinghn giinhgn giinhng giihnng giihngn giihnng
giihngn giihgnn giihgnn ginginh gingihn gingnih gingnhi ginghni ginghin ginignh ginighn
giningh gininhg ginihng ginihgn ginnigh ginnihg ginngih ginnghi ginnhgi ginnhig ginhing
ginhign ginhnig ginhngi ginhgni ginhgin gihginn gihginn gihgnin gihgnni gihgnni gihgnin
gihignn gihignn gihingn gihinng gihinng gihingn gihnign gihning gihngin gihngni gihnngi
gihnnig gihning gihnign gihnnig gihnngi gihngni gihngin gniginh gnigihn gnignih gnignhi
gnighni gnighin gniignh gniighn gniingh gniinhg gniihng gniihgn gninigh gninihg gningih
gninghi gninhgi gninhig gnihing gnihign gnihnig gnihngi gnihgni gnihgin gngiinh gngiihn
gnginih gnginhi gngihni gngihin gngiinh gngiihn gnginih gnginhi gngihni gngihin gngniih
gngnihi gngniih gngnihi gngnhii gngnhii gnghini gnghiin gnghnii gnghnii gnghini gnghiin
gniginh gnigihn gnignih gnignhi gnighni gnighin gniignh gniighn gniingh gniinhg gniihng
gniihgn gninigh gninihg gningih gninghi gninhgi gninhig gnihing gnihign gnihnig gnihngi
gnihgni gnihgin gnngiih gnngihi gnngiih gnngihi gnnghii gnnghii gnnigih gnnighi gnniigh
gnniihg gnnihig gnnihgi gnniigh gnniihg gnnigih gnnighi gnnihgi gnnihig gnnhiig gnnhigi
gnnhiig gnnhigi gnnhgii gnnhgii gnhgini gnhgiin gnhgnii gnhgnii gnhgini gnhgiin gnhigni
gnhigin gnhingi gnhinig gnhiing gnhiign gnhnigi gnhniig gnhngii gnhngii gnhnigi gnhniig
gnhiing gnhiign gnhinig gnhingi gnhigni gnhigin ggniinh ggniihn ggninih ggninhi ggnihni
ggnihin ggniinh ggniihn ggninih ggninhi ggnihni ggnihin ggnniih ggnnihi ggnniih ggnnihi
ggnnhii ggnnhii ggnhini ggnhiin ggnhnii ggnhnii ggnhini ggnhiin ggininh gginihn gginnih
gginnhi gginhni gginhin ggiinnh ggiinhn ggiinnh ggiinhn ggiihnn ggiihnn ggininh gginihn
gginnih gginnhi gginhni gginhin ggihinn ggihinn ggihnin ggihnni ggihnni ggihnin ggiinnh
ggiinhn ggiinnh ggiinhn ggiihnn ggiihnn ggininh gginihn gginnih gginnhi gginhni gginhin
gginnih gginnhi ggininh gginihn gginhin gginhni ggihnni ggihnin ggihnni ggihnin ggihinn
ggihinn ggniinh ggniihn ggninih ggninhi ggnihni ggnihin ggniinh ggniihn ggninih ggninhi
ggnihni ggnihin ggnniih ggnnihi ggnniih ggnnihi ggnnhii ggnnhii ggnhini ggnhiin ggnhnii
ggnhnii ggnhini ggnhiin gghiinn gghiinn gghinin gghinni gghinni gghinin gghiinn gghiinn
gghinin gghinni gghinni gghinin gghniin gghnini gghniin gghnini gghnnii gghnnii gghnini
gghniin gghnnii gghnnii gghnini gghniin ginginh gingihn gingnih gingnhi ginghni ginghin
ginignh ginighn giningh gininhg ginihng ginihgn ginnigh ginnihg ginngih ginnghi ginnhgi
ginnhig ginhing ginhign ginhnig ginhngi ginhgni ginhgin gigninh gignihn gignnih gignnhi
gignhni gignhin giginnh giginhn giginnh giginhn gigihnn gigihnn gigninh gignihn gignnih
gignnhi gignhni gignhin gighinn gighinn gighnin gighnni gighnni gighnin giignnh giignhn
giignnh giignhn giighnn giighnn giingnh giinghn giinngh giinnhg giinhng giinhgn giinngh
giinnhg giingnh giinghn giinhgn giinhng giihnng giihngn giihnng giihngn giihgnn giihgnn
ginginh gingihn gingnih gingnhi ginghni ginghin ginignh ginighn giningh gininhg ginihng
ginihgn ginnigh ginnihg ginngih ginnghi ginnhgi ginnhig ginhing ginhign ginhnig ginhngi
ginhgni ginhgin gihginn gihginn gihgnin gihgnni gihgnni gihgnin gihignn gihignn gihingn
gihinng gihinng gihingn gihnign gihning gihngin gihngni gihnngi gihnnig gihning gihnign
gihnnig gihnngi gihngni gihngin gnngiih gnngihi gnngiih gnngihi gnnghii gnnghii gnnigih
gnnighi gnniigh gnniihg gnnihig gnnihgi gnniigh gnniihg gnnigih gnnighi gnnihgi gnnihig
gnnhiig gnnhigi gnnhiig gnnhigi gnnhgii gnnhgii gngniih gngnihi gngniih gngnihi gngnhii
gngnhii gnginih gnginhi gngiinh gngiihn gngihin gngihni gngiinh gngiihn gnginih gnginhi
gngihni gngihin gnghiin gnghini gnghiin gnghini gnghnii gnghnii gnignih gnignhi gniginh
gnigihn gnighin gnighni gningih gninghi gninigh gninihg gninhig gninhgi gniingh gniinhg
gniignh gniighn gniihgn gniihng gnihnig gnihngi gnihing gnihign gnihgin gnihgni gniginh
gnigihn gnignih gnignhi gnighni gnighin gniignh gniighn gniingh gniinhg gniihng gniihgn
gninigh gninihg gningih gninghi gninhgi gninhig gnihing gnihign gnihnig gnihngi gnihgni
gnihgin gnhgiin gnhgini gnhgiin gnhgini gnhgnii gnhgnii gnhigin gnhigni gnhiign gnhiing
gnhinig gnhingi gnhiign gnhiing gnhigin gnhigni gnhingi gnhinig gnhniig gnhnigi gnhniig
gnhnigi gnhngii gnhngii ghngini ghngiin ghngnii ghngnii ghngini ghngiin ghnigni ghnigin
ghningi ghninig ghniing ghniign ghnnigi ghnniig ghnngii ghnngii ghnnigi ghnniig ghniing
ghniign ghninig ghningi ghnigni ghnigin ghgnini ghgniin ghgnnii ghgnnii ghgnini ghgniin
ghginni ghginin ghginni ghginin ghgiinn ghgiinn ghgnini ghgniin ghgnnii ghgnnii ghgnini
ghgniin ghgiinn ghgiinn ghginin ghginni ghginni ghginin ghignni ghignin ghignni ghignin
ghiginn ghiginn ghingni ghingin ghinngi ghinnig ghining ghinign ghinngi ghinnig ghingni
ghingin ghinign ghining ghiinng ghiingn ghiinng ghiingn ghiignn ghiignn ghngini ghngiin
ghngnii ghngnii ghngini ghngiin ghnigni ghnigin ghningi ghninig ghniing ghniign ghnnigi
ghnniig ghnngii ghnngii ghnnigi ghnniig ghniing ghniign ghninig ghningi ghnigni ghnigin
ghiginn ghiginn ghignin ghignni ghignni ghignin ghiignn ghiignn ghiingn ghiinng ghiinng
ghiingn ghinign ghining ghingin ghingni ghinngi ghinnig ghining ghinign ghinnig ghinngi
ghingni ghingin

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us