easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

eckland

nejdi

exertive

meleagridis

audiograms

securings

thwacking

wigmaking

hogged

folksongs

whatcheer

conloquium

dolcino

subdirector

unsling

equivocating

gushiness

newtake


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: heroes
cipher variations:
ifspft jgtqgu khurhv livsiw mjwtjx
nkxuky olyvlz pmzwma qnaxnb robyoc
spczpd tqdaqe urebrf vsfcsg wtgdth
xuheui yvifvj zwjgwk axkhxl byliym
czmjzn dankao ebolbp fcpmcq gdqndr

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: heroes
Cipher: svilvh

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: heroes
Cipher: AABBB AABAA BAAAA ABBAB AABAA BAAAB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: heroes
cipher variations:
ifspftwnarndkvitvnydqvdxmlyxlhatgztrcjwdjlqrefrv
ezmhzfshujhpgpclpzuxknxjjgtqguxobsoelwjuwozerwey
nmzymibuhausdkxekmrsfgswfaniagtivkiqhqdmqavyloyk
khurhvypctpfmxkvxpafsxfzonaznjcvibvtelyflnstghtx
gbojbhujwljrirenrbwzmpzllivsiwzqduqgnylwyqbgtyga
pobaokdwjcwufmzgmotuhiuyhcpkcivkxmksjsfoscxanqam
mjwtjxarevrhozmxzrchuzhbqpcbplexkdxvgnahnpuvijvz
idqldjwlynltktgptdyborbnnkxukybsfwsipanyasdivaic
rqdcqmfyleywhobioqvwjkwajermekxmzomuluhquezcpsco
olyvlzctgxtjqbozbtejwbjdsredrngzmfzxipcjprwxklxb
kfsnflynapnvmvirvfadqtdppmzwmaduhyukrcpacufkxcke
tsfesohangayjqdkqsxylmyclgtogmzobqownwjswgberueq
qnaxnbevizvlsdqbdvglydlfutgftpibohbzkrelrtyzmnzd
mhuphnapcrpxoxktxhcfsvfrrobyocfwjawmtercewhmzemg
vuhguqjcpicalsfmsuzanoaenivqiobqdsqypyluyidgtwgs
spczpdgxkbxnufsdfxinafnhwvihvrkdqjdbmtgntvabopbf
ojwrjpcretrzqzmvzjehuxhttqdaqehylcyovgtegyjobgoi
xwjiwslerkecnuhouwbcpqcgpkxskqdsfusaranwakfivyiu
urebrfizmdzpwhufhzkpchpjyxkjxtmfslfdovipvxcdqrdh
qlytlretgvtbsboxblgjwzjvvsfcsgjaneaqxivgialqdiqk
zylkyungtmgepwjqwyderseirmzumsfuhwuctcpycmhkxakw
wtgdthkbofbryjwhjbmrejrlazmlzvohunhfqxkrxzefstfj
snavntgvixvdudqzdnilyblxxuheuilcpgcszkxikcnsfksm
banmawpivoigrylsyafgtugktobwouhwjyweveraeojmzcmy
yvifvjmdqhdtalyjldotgltncbonbxqjwpjhszmtzbghuvhl
upcxpvixkzxfwfsbfpknadnzzwjgwknerieubmzkmepuhmuo
dcpocyrkxqkitanuachivwimvqdyqwjylaygxgtcgqlobeoa
axkhxlofsjfvcnalnfqvinvpedqpdzslyrljubovbdijwxjn
wrezrxkzmbzhyhudhrmpcfpbbyliympgtkgwdobmogrwjowq
ferqeatmzsmkvcpwcejkxykoxsfasylancaiziveisnqdgqc
czmjznqhulhxepcnphsxkpxrgfsrfbunatnlwdqxdfklyzlp
ytgbtzmbodbjajwfjtorehrddankaorivmiyfqdoqitylqys
hgtsgcvobuomxeryeglmzamqzuhcuancpeckbkxgkupsfise
ebolbpsjwnjzgreprjuzmrztihuthdwpcvpnyfszfhmnabnr
avidvbodqfdlclyhlvqtgjtffcpmcqtkxokahsfqskvansau
jivuiexqdwqozgtaginobcosbwjewcpergemdmzimwruhkug
gdqndrulyplbitgrtlwbotbvkjwvjfyrexrpahubhjopcdpt
cxkfxdqfshfnenajnxsvilvhheroesvmzqmcjuhsumxcpucw
lkxwkgzsfysqbivcikpqdequdylgyergtigofobkoytwjmwi

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: heroes
Cipher: urebrf

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: heroes
Cipher: 325124435134

Extended Methods:
Method #1

Plaintext: heroes
method variations:
nkwtkxspbypcxugduhczmizn

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
h e r o e s 
3 5 2 4 5 3 
2 1 4 3 1 4 
They are then read out in rows:
352453214314
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: heroes
Cipher: xrpboq

Read more ...
Method #3

Plaintext: heroes
method variations:
wftxlo ftxlow txlowf
xlowft lowftx owftxl

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: heroes

all 720 cipher variations:
heroes herose hereos hereso herseo hersoe heores heorse heoers heoesr heoser
heosre heeors heeosr heeros heerso heesro heesor hesoer hesore heseor hesero
hesreo hesroe hreoes hreose hreeos hreeso hreseo hresoe hroees hroese hroees
hroese hrosee hrosee hreoes hreose hreeos hreeso hreseo hresoe hrsoee hrsoee
hrseoe hrseeo hrseeo hrseoe horees horese horees horese horsee horsee hoeres
hoerse hoeers hoeesr hoeser hoesre hoeers hoeesr hoeres hoerse hoesre hoeser
hoseer hosere hoseer hosere hosree hosree heroes herose hereos hereso herseo
hersoe heores heorse heoers heoesr heoser heosre heeors heeosr heeros heerso
heesro heesor hesoer hesore heseor hesero hesreo hesroe hsroee hsroee hsreoe
hsreeo hsreeo hsreoe hsoree hsoree hsoere hsoeer hsoeer hsoere hseore hseoer
hseroe hsereo hseero hseeor hseoer hseore hseeor hseero hsereo hseroe ehroes
ehrose ehreos ehreso ehrseo ehrsoe ehores ehorse ehoers ehoesr ehoser ehosre
eheors eheosr eheros eherso ehesro ehesor ehsoer ehsore ehseor ehsero ehsreo
ehsroe erhoes erhose erheos erheso erhseo erhsoe erohes erohse eroehs eroesh
eroseh eroshe ereohs ereosh erehos erehso eresho eresoh ersoeh ersohe erseoh
erseho ersheo ershoe eorhes eorhse eorehs eoresh eorseh eorshe eohres eohrse
eohers eohesr eohser eohsre eoehrs eoehsr eoerhs eoersh eoesrh eoeshr eosher
eoshre eosehr eoserh eosreh eosrhe eerohs eerosh eerhos eerhso eersho eersoh
eeorhs eeorsh eeohrs eeohsr eeoshr eeosrh eehors eehosr eehros eehrso eehsro
eehsor eesohr eesorh eeshor eeshro eesrho eesroh esroeh esrohe esreoh esreho
esrheo esrhoe esoreh esorhe esoerh esoehr esoher esohre eseorh eseohr eseroh
eserho esehro esehor eshoer eshore esheor eshero eshreo eshroe rehoes rehose
reheos reheso rehseo rehsoe reohes reohse reoehs reoesh reoseh reoshe reeohs
reeosh reehos reehso reesho reesoh resoeh resohe reseoh reseho resheo reshoe
rheoes rheose rheeos rheeso rheseo rhesoe rhoees rhoese rhoees rhoese rhosee
rhosee rheoes rheose rheeos rheeso rheseo rhesoe rhsoee rhsoee rhseoe rhseeo
rhseeo rhseoe rohees rohese rohees rohese rohsee rohsee roehes roehse roeehs
roeesh roeseh roeshe roeehs roeesh roehes roehse roeshe roeseh roseeh rosehe
roseeh rosehe roshee roshee rehoes rehose reheos reheso rehseo rehsoe reohes
reohse reoehs reoesh reoseh reoshe reeohs reeosh reehos reehso reesho reesoh
resoeh resohe reseoh reseho resheo reshoe rshoee rshoee rsheoe rsheeo rsheeo
rsheoe rsohee rsohee rsoehe rsoeeh rsoeeh rsoehe rseohe rseoeh rsehoe rseheo
rseeho rseeoh rseoeh rseohe rseeoh rseeho rseheo rsehoe oerhes oerhse oerehs
oeresh oerseh oershe oehres oehrse oehers oehesr oehser oehsre oeehrs oeehsr
oeerhs oeersh oeesrh oeeshr oesher oeshre oesehr oeserh oesreh oesrhe orehes
orehse oreehs oreesh oreseh oreshe orhees orhese orhees orhese orhsee orhsee
orehes orehse oreehs oreesh oreseh oreshe orshee orshee orsehe orseeh orseeh
orsehe ohrees ohrese ohrees ohrese ohrsee ohrsee oheres oherse oheers oheesr
oheser ohesre oheers oheesr oheres oherse ohesre oheser ohseer ohsere ohseer
ohsere ohsree ohsree oerhes oerhse oerehs oeresh oerseh oershe oehres oehrse
oehers oehesr oehser oehsre oeehrs oeehsr oeerhs oeersh oeesrh oeeshr oesher
oeshre oesehr oeserh oesreh oesrhe osrhee osrhee osrehe osreeh osreeh osrehe
oshree oshree oshere osheer osheer oshere osehre oseher oserhe osereh oseerh
oseehr oseher osehre oseehr oseerh osereh oserhe eerohs eerosh eerhos eerhso
eersho eersoh eeorhs eeorsh eeohrs eeohsr eeoshr eeosrh eehors eehosr eehros
eehrso eehsro eehsor eesohr eesorh eeshor eeshro eesrho eesroh ereohs ereosh
erehos erehso eresho eresoh eroehs eroesh erohes erohse eroshe eroseh erhoes
erhose erheos erheso erhseo erhsoe ersohe ersoeh ershoe ersheo erseho erseoh
eorehs eoresh eorhes eorhse eorshe eorseh eoerhs eoersh eoehrs eoehsr eoeshr
eoesrh eohers eohesr eohres eohrse eohsre eohser eosehr eoserh eosher eoshre
eosrhe eosreh ehroes ehrose ehreos ehreso ehrseo ehrsoe ehores ehorse ehoers
ehoesr ehoser ehosre eheors eheosr eheros eherso ehesro ehesor ehsoer ehsore
ehseor ehsero ehsreo ehsroe esrohe esroeh esrhoe esrheo esreho esreoh esorhe
esoreh esohre esoher esoehr esoerh eshore eshoer eshroe eshreo eshero esheor
eseohr eseorh esehor esehro eserho eseroh seroeh serohe sereoh sereho serheo
serhoe seoreh seorhe seoerh seoehr seoher seohre seeorh seeohr seeroh seerho
seehro seehor sehoer sehore seheor sehero sehreo sehroe sreoeh sreohe sreeoh
sreeho sreheo srehoe sroeeh sroehe sroeeh sroehe srohee srohee sreoeh sreohe
sreeoh sreeho sreheo srehoe srhoee srhoee srheoe srheeo srheeo srheoe soreeh
sorehe soreeh sorehe sorhee sorhee soereh soerhe soeerh soeehr soeher soehre
soeerh soeehr soereh soerhe soehre soeher soheer sohere soheer sohere sohree
sohree seroeh serohe sereoh sereho serheo serhoe seoreh seorhe seoerh seoehr
seoher seohre seeorh seeohr seeroh seerho seehro seehor sehoer sehore seheor
sehero sehreo sehroe shroee shroee shreoe shreeo shreeo shreoe shoree shoree
shoere shoeer shoeer shoere sheore sheoer sheroe shereo sheero sheeor sheoer
sheore sheeor sheero shereo sheroe

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us