easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

odored

limitada

stortz

codirectional

turgidities

sperling

osotriazole

emulousness

fertileness

droma

objure

gustard

sphenolith

consolement

gordian

shailan

conly

starlifter


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: herget
cipher variations:
ifshfu jgtigv khujhw livkix mjwljy
nkxmkz olynla pmzomb qnapnc robqod
spcrpe tqdsqf uretrg vsfush wtgvti
xuhwuj yvixvk zwjywl axkzxm bylayn
czmbzo dancap ebodbq fcpecr gdqfds

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: herget
Cipher: svitvg

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: herget
Cipher: AABBB AABAA BAAAA AABBA AABAA BAABA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: herget
cipher variations:
ifshfuwnatngkvifvsydqrdemlydlqatgptccjwnjaqrezrm
ezmlzyshuxhkgpcjpwuxkvxijgtigvxobuohlwjgwtzersef
nmzemrbuhquddkxokbrsfasnfanmaztivyilhqdkqxvylwyj
khujhwypcvpimxkhxuafstfgonafnscvirveelyplcstgbto
gbonbaujwzjmirelrywzmxzklivkixzqdwqjnyliyvbgtugh
pobgotdwjswffmzqmdtuhcuphcpocbvkxaknjsfmszxanyal
mjwljyarexrkozmjzwchuvhiqpchpuexktxggnarneuvidvq
idqpdcwlybloktgntaybozbmnkxmkzbsfyslpankaxdivwij
rqdiqvfyluyhhobsofvwjewrjerqedxmzcmpluhoubzcpacn
olynlactgztmqbolbyejwxjksrejrwgzmvziipctpgwxkfxs
kfsrfeynadnqmvipvcadqbdopmzombduhaunrcpmczfkxykl
tsfksxhanwajjqduqhxylgytlgtsgfzobeornwjqwdbercep
qnapncevibvosdqndaglyzlmutgltyiboxbkkrevriyzmhzu
mhuthgapcfpsoxkrxecfsdfqrobqodfwjcwpteroebhmzamn
vuhmuzjcpycllsfwsjzaniavnivuihbqdgqtpylsyfdgtegr
spcrpegxkdxqufspfcinabnowvinvakdqzdmmtgxtkabojbw
ojwvjicrehruqzmtzgehufhstqdsqfhyleyrvgtqgdjobcop
xwjowbleraennuhyulbcpkcxpkxwkjdsfisvranuahfivgit
uretrgizmfzswhurhekpcdpqyxkpxcmfsbfoovizvmcdqldy
qlyxlketgjtwsbovbigjwhjuvsfushjangatxivsiflqdeqr
zylqydngtcgppwjawndermezrmzymlfuhkuxtcpwcjhkxikv
wtgvtikbohbuyjwtjgmrefrsazmrzeohudhqqxkbxoefsnfa
snaznmgvilvyudqxdkilyjlwxuhwujlcpicvzkxukhnsfgst
bansafpiveirrylcypfgtogbtobaonhwjmwzveryeljmzkmx
yvixvkmdqjdwalyvliotghtucbotbgqjwfjsszmdzqghuphc
upcbpoixknxawfszfmknalnyzwjywlnerkexbmzwmjpuhiuv
dcpuchrkxgkttanearhivqidvqdcqpjyloybxgtagnlobmoz
axkzxmofslfycnaxnkqvijvwedqvdislyhluubofbsijwrje
wredrqkzmpzcyhubhompcnpabylaynpgtmgzdobyolrwjkwx
ferwejtmzimvvcpgctjkxskfxsfesrlanqadzivcipnqdoqb
czmbzoqhunhaepczpmsxklxygfsxfkunajnwwdqhduklytlg
ytgftsmborbeajwdjqoreprcdancaprivoibfqdaqntylmyz
hgtyglvobkoxxerievlmzumhzuhgutncpscfbkxekrpsfqsd
ebodbqsjwpjcgrebrouzmnzaihuzhmwpclpyyfsjfwmnavni
avihvuodqtdgclyflsqtgrtefcpecrtkxqkdhsfcspvanoab
jivainxqdmqzzgtkgxnobwojbwjiwvperuehdmzgmtruhsuf
gdqfdsulyrleitgdtqwbopbckjwbjoyrenraahulhyopcxpk
cxkjxwqfsvfienahnusvitvghergetvmzsmfjuheurxcpqcd
lkxckpzsfosbbivmizpqdyqldylkyxrgtwgjfobiovtwjuwh

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: herget
Cipher: uretrg

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: herget
Cipher: 325124225144

Extended Methods:
Method #1

Plaintext: herget
method variations:
nkwmkyspbrpdxugwuiczmbzo

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
h e r g e t 
3 5 2 2 5 4 
2 1 4 2 1 4 
They are then read out in rows:
352254214214
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: herget
Cipher: xgubiq

Read more ...
Method #3

Plaintext: herget
method variations:
wfiwqo fiwqow iwqowf
wqowfi qowfiw owfiwq

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: herget

all 720 cipher variations:
herget hergte heregt heretg herteg hertge hegret hegrte hegert hegetr hegter
hegtre heegrt heegtr heergt heertg heetrg heetgr hetger hetgre hetegr heterg
hetreg hetrge hreget hregte hreegt hreetg hreteg hretge hrgeet hrgete hrgeet
hrgete hrgtee hrgtee hreget hregte hreegt hreetg hreteg hretge hrtgee hrtgee
hrtege hrteeg hrteeg hrtege hgreet hgrete hgreet hgrete hgrtee hgrtee hgeret
hgerte hgeert hgeetr hgeter hgetre hgeert hgeetr hgeret hgerte hgetre hgeter
hgteer hgtere hgteer hgtere hgtree hgtree herget hergte heregt heretg herteg
hertge hegret hegrte hegert hegetr hegter hegtre heegrt heegtr heergt heertg
heetrg heetgr hetger hetgre hetegr heterg hetreg hetrge htrgee htrgee htrege
htreeg htreeg htrege htgree htgree htgere htgeer htgeer htgere htegre hteger
hterge htereg hteerg hteegr hteger htegre hteegr hteerg htereg hterge ehrget
ehrgte ehregt ehretg ehrteg ehrtge ehgret ehgrte ehgert ehgetr ehgter ehgtre
ehegrt ehegtr ehergt ehertg ehetrg ehetgr ehtger ehtgre ehtegr ehterg ehtreg
ehtrge erhget erhgte erhegt erhetg erhteg erhtge erghet erghte ergeht ergeth
ergteh ergthe ereght eregth erehgt erehtg erethg eretgh ertgeh ertghe ertegh
ertehg ertheg erthge egrhet egrhte egreht egreth egrteh egrthe eghret eghrte
eghert eghetr eghter eghtre egehrt egehtr egerht egerth egetrh egethr egther
egthre egtehr egterh egtreh egtrhe eerght eergth eerhgt eerhtg eerthg eertgh
eegrht eegrth eeghrt eeghtr eegthr eegtrh eehgrt eehgtr eehrgt eehrtg eehtrg
eehtgr eetghr eetgrh eethgr eethrg eetrhg eetrgh etrgeh etrghe etregh etrehg
etrheg etrhge etgreh etgrhe etgerh etgehr etgher etghre etegrh eteghr etergh
eterhg etehrg etehgr ethger ethgre ethegr etherg ethreg ethrge rehget rehgte
rehegt rehetg rehteg rehtge reghet reghte regeht regeth regteh regthe reeght
reegth reehgt reehtg reethg reetgh retgeh retghe retegh retehg retheg rethge
rheget rhegte rheegt rheetg rheteg rhetge rhgeet rhgete rhgeet rhgete rhgtee
rhgtee rheget rhegte rheegt rheetg rheteg rhetge rhtgee rhtgee rhtege rhteeg
rhteeg rhtege rgheet rghete rgheet rghete rghtee rghtee rgehet rgehte rgeeht
rgeeth rgeteh rgethe rgeeht rgeeth rgehet rgehte rgethe rgeteh rgteeh rgtehe
rgteeh rgtehe rgthee rgthee rehget rehgte rehegt rehetg rehteg rehtge reghet
reghte regeht regeth regteh regthe reeght reegth reehgt reehtg reethg reetgh
retgeh retghe retegh retehg retheg rethge rthgee rthgee rthege rtheeg rtheeg
rthege rtghee rtghee rtgehe rtgeeh rtgeeh rtgehe rteghe rtegeh rtehge rteheg
rteehg rteegh rtegeh rteghe rteegh rteehg rteheg rtehge gerhet gerhte gereht
gereth gerteh gerthe gehret gehrte gehert gehetr gehter gehtre geehrt geehtr
geerht geerth geetrh geethr gether gethre getehr geterh getreh getrhe grehet
grehte greeht greeth greteh grethe grheet grhete grheet grhete grhtee grhtee
grehet grehte greeht greeth greteh grethe grthee grthee grtehe grteeh grteeh
grtehe ghreet ghrete ghreet ghrete ghrtee ghrtee gheret gherte gheert gheetr
gheter ghetre gheert gheetr gheret gherte ghetre gheter ghteer ghtere ghteer
ghtere ghtree ghtree gerhet gerhte gereht gereth gerteh gerthe gehret gehrte
gehert gehetr gehter gehtre geehrt geehtr geerht geerth geetrh geethr gether
gethre getehr geterh getreh getrhe gtrhee gtrhee gtrehe gtreeh gtreeh gtrehe
gthree gthree gthere gtheer gtheer gthere gtehre gteher gterhe gtereh gteerh
gteehr gteher gtehre gteehr gteerh gtereh gterhe eerght eergth eerhgt eerhtg
eerthg eertgh eegrht eegrth eeghrt eeghtr eegthr eegtrh eehgrt eehgtr eehrgt
eehrtg eehtrg eehtgr eetghr eetgrh eethgr eethrg eetrhg eetrgh ereght eregth
erehgt erehtg erethg eretgh ergeht ergeth erghet erghte ergthe ergteh erhget
erhgte erhegt erhetg erhteg erhtge ertghe ertgeh erthge ertheg ertehg ertegh
egreht egreth egrhet egrhte egrthe egrteh egerht egerth egehrt egehtr egethr
egetrh eghert eghetr eghret eghrte eghtre eghter egtehr egterh egther egthre
egtrhe egtreh ehrget ehrgte ehregt ehretg ehrteg ehrtge ehgret ehgrte ehgert
ehgetr ehgter ehgtre ehegrt ehegtr ehergt ehertg ehetrg ehetgr ehtger ehtgre
ehtegr ehterg ehtreg ehtrge etrghe etrgeh etrhge etrheg etrehg etregh etgrhe
etgreh etghre etgher etgehr etgerh ethgre ethger ethrge ethreg etherg ethegr
eteghr etegrh etehgr etehrg eterhg etergh tergeh terghe teregh terehg terheg
terhge tegreh tegrhe tegerh tegehr tegher teghre teegrh teeghr teergh teerhg
teehrg teehgr tehger tehgre tehegr teherg tehreg tehrge tregeh treghe treegh
treehg treheg trehge trgeeh trgehe trgeeh trgehe trghee trghee tregeh treghe
treegh treehg treheg trehge trhgee trhgee trhege trheeg trheeg trhege tgreeh
tgrehe tgreeh tgrehe tgrhee tgrhee tgereh tgerhe tgeerh tgeehr tgeher tgehre
tgeerh tgeehr tgereh tgerhe tgehre tgeher tgheer tghere tgheer tghere tghree
tghree tergeh terghe teregh terehg terheg terhge tegreh tegrhe tegerh tegehr
tegher teghre teegrh teeghr teergh teerhg teehrg teehgr tehger tehgre tehegr
teherg tehreg tehrge thrgee thrgee threge threeg threeg threge thgree thgree
thgere thgeer thgeer thgere thegre theger therge thereg theerg theegr theger
thegre theegr theerg thereg therge

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us