easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

lipshutz

fortbridger

cadges

chambermaid

vivianne

lachi

avolio

bultong

hodgen

padlocked

rechoosing

lamentory

peshtigo

ellensburg

formativeness

repleat

buttonholes

usibus


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: hemmed
cipher variations:
ifnnfe jgoogf khpphg liqqih mjrrji
nksskj olttlk pmuuml qnvvnm rowwon
spxxpo tqyyqp urzzrq vsaasr wtbbts
xuccut yvddvu zweewv axffxw byggyx
czhhzy daiiaz ebjjba fckkcb gdlldc

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: hemmed
Cipher: svnnvw

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: hemmed
Cipher: AABBB AABAA ABABB ABABB AABAA AAABB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: hemmed
cipher variations:
ifnnfewnllnkkvjjvqydhhdwmlfflcatddticjzzjuqrxxra
ezvvzgshtthmgprrpsuxppxyjgoogfxommollwkkwrzeiiex
nmggmdbueeujdkaakvrsyysbfawwahtiuuinhqssqtvyqqyz
khpphgypnnpmmxllxsafjjfyonhhnecvffvkelbblwstzztc
gbxxbiujvvjoirttruwzrrzaliqqihzqooqnnymmytbgkkgz
poiiofdwggwlfmccmxtuaaudhcyycjvkwwkpjsuusvxassab
mjrrjiarpprooznnzuchllhaqpjjpgexhhxmgnddnyuvbbve
idzzdkwlxxlqktvvtwybttbcnksskjbsqqsppaooavdimmib
rqkkqhfyiiynhoeeozvwccwfjeaaelxmyymrluwwuxzcuucd
olttlkctrrtqqbppbwejnnjcsrllrigzjjzoipffpawxddxg
kfbbfmynzznsmvxxvyadvvdepmuumldussurrcqqcxfkookd
tsmmsjhakkapjqggqbxyeeyhlgccgnzoaaotnwyywzbewwef
qnvvnmevttvssdrrdyglppleutnntkibllbqkrhhrcyzffzi
mhddhoapbbpuoxzzxacfxxfgrowwonfwuuwttessezhmqqmf
vuoouljcmmcrlsiisdzaggajnieeipbqccqvpyaaybdgyygh
spxxpogxvvxuufttfainrrngwvppvmkdnndsmtjjteabhhbk
ojffjqcrddrwqzbbzcehzzhitqyyqphywwyvvguugbjossoh
xwqqwnleooetnukkufbciiclpkggkrdseesxraccadfiaaij
urzzrqizxxzwwhvvhckpttpiyxrrxomfppfuovllvgcdjjdm
qlhhlsetfftysbddbegjbbjkvsaasrjayyaxxiwwidlquuqj
zyssypngqqgvpwmmwhdekkenrmiimtfugguztceecfhkcckl
wtbbtskbzzbyyjxxjemrvvrkazttzqohrrhwqxnnxiefllfo
snjjnugvhhvaudffdgilddlmxuccutlcaaczzkyykfnswwsl
bauuarpissixryooyjfgmmgptokkovhwiiwbveggehjmeemn
yvddvumdbbdaalzzlgotxxtmcbvvbsqjttjyszppzkghnnhq
upllpwixjjxcwfhhfiknffnozweewvneccebbmaamhpuyyun
dcwwctrkuukztaqqalhiooirvqmmqxjykkydxgiigjloggop
axffxwofddfccnbbniqvzzvoedxxduslvvlaubrrbmijppjs
wrnnrykzllzeyhjjhkmphhpqbyggyxpgeegddoccojrwaawp
feyyevtmwwmbvcsscnjkqqktxsooszlammafzikkilnqiiqr
czhhzyqhffheepddpksxbbxqgfzzfwunxxncwdttdoklrrlu
ytpptambnnbgajlljmorjjrsdaiiazriggiffqeeqltyccyr
hgaagxvoyyodxeuueplmssmvzuqqubncoochbkmmknpskkst
ebjjbasjhhjggrffrmuzddzsihbbhywpzzpeyfvvfqmnttnw
avrrvcodppdiclnnloqtlltufckkcbtkiikhhsggsnvaeeat
jiccizxqaaqfzgwwgrnouuoxbwsswdpeqqejdmoomprummuv
gdlldculjjliithhtowbffbukjddjayrbbrgahxxhsopvvpy
cxttxeqfrrfkenppnqsvnnvwhemmedvmkkmjjuiiupxcggcv
lkeekbzsccshbiyyitpqwwqzdyuuyfrgssglfoqqortwoowx

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: hemmed
Cipher: urzzrq

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: hemmed
Cipher: 325123235141

Extended Methods:
Method #1

Plaintext: hemmed
method variations:
nkrrkispwwpoxubbutczggzy

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath: 
h e m m e d 
3 5 2 2 5 4 
2 1 3 3 1 1
They are then read out in rows:
352254213311
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: hemmed
Cipher: xgubna

Read more ...
Method #3

Plaintext: hemmed
method variations:
wfhxql fhxqlw hxqlwf
xqlwfh qlwfhx lwfhxq

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: hemmed

all 720 cipher variations:
hemmed hemmde hememd hemedm hemdem hemdme hemmed hemmde hememd hemedm hemdem
hemdme heemmd heemdm heemmd heemdm heedmm heedmm hedmem hedmme hedemm hedemm
hedmem hedmme hmemed hmemde hmeemd hmeedm hmedem hmedme hmmeed hmmede hmmeed
hmmede hmmdee hmmdee hmemed hmemde hmeemd hmeedm hmedem hmedme hmdmee hmdmee
hmdeme hmdeem hmdeem hmdeme hmmeed hmmede hmmeed hmmede hmmdee hmmdee hmemed
hmemde hmeemd hmeedm hmedem hmedme hmeemd hmeedm hmemed hmemde hmedme hmedem
hmdeem hmdeme hmdeem hmdeme hmdmee hmdmee hemmed hemmde hememd hemedm hemdem
hemdme hemmed hemmde hememd hemedm hemdem hemdme heemmd heemdm heemmd heemdm
heedmm heedmm hedmem hedmme hedemm hedemm hedmem hedmme hdmmee hdmmee hdmeme
hdmeem hdmeem hdmeme hdmmee hdmmee hdmeme hdmeem hdmeem hdmeme hdemme hdemem
hdemme hdemem hdeemm hdeemm hdemem hdemme hdeemm hdeemm hdemem hdemme ehmmed
ehmmde ehmemd ehmedm ehmdem ehmdme ehmmed ehmmde ehmemd ehmedm ehmdem ehmdme
ehemmd ehemdm ehemmd ehemdm ehedmm ehedmm ehdmem ehdmme ehdemm ehdemm ehdmem
ehdmme emhmed emhmde emhemd emhedm emhdem emhdme emmhed emmhde emmehd emmedh
emmdeh emmdhe ememhd ememdh emehmd emehdm emedhm emedmh emdmeh emdmhe emdemh
emdehm emdhem emdhme emmhed emmhde emmehd emmedh emmdeh emmdhe emhmed emhmde
emhemd emhedm emhdem emhdme emehmd emehdm ememhd ememdh emedmh emedhm emdhem
emdhme emdehm emdemh emdmeh emdmhe eemmhd eemmdh eemhmd eemhdm eemdhm eemdmh
eemmhd eemmdh eemhmd eemhdm eemdhm eemdmh eehmmd eehmdm eehmmd eehmdm eehdmm
eehdmm eedmhm eedmmh eedhmm eedhmm eedmhm eedmmh edmmeh edmmhe edmemh edmehm
edmhem edmhme edmmeh edmmhe edmemh edmehm edmhem edmhme edemmh edemhm edemmh
edemhm edehmm edehmm edhmem edhmme edhemm edhemm edhmem edhmme mehmed mehmde
mehemd mehedm mehdem mehdme memhed memhde memehd memedh memdeh memdhe meemhd
meemdh meehmd meehdm meedhm meedmh medmeh medmhe medemh medehm medhem medhme
mhemed mhemde mheemd mheedm mhedem mhedme mhmeed mhmede mhmeed mhmede mhmdee
mhmdee mhemed mhemde mheemd mheedm mhedem mhedme mhdmee mhdmee mhdeme mhdeem
mhdeem mhdeme mmheed mmhede mmheed mmhede mmhdee mmhdee mmehed mmehde mmeehd
mmeedh mmedeh mmedhe mmeehd mmeedh mmehed mmehde mmedhe mmedeh mmdeeh mmdehe
mmdeeh mmdehe mmdhee mmdhee mehmed mehmde mehemd mehedm mehdem mehdme memhed
memhde memehd memedh memdeh memdhe meemhd meemdh meehmd meehdm meedhm meedmh
medmeh medmhe medemh medehm medhem medhme mdhmee mdhmee mdheme mdheem mdheem
mdheme mdmhee mdmhee mdmehe mdmeeh mdmeeh mdmehe mdemhe mdemeh mdehme mdehem
mdeehm mdeemh mdemeh mdemhe mdeemh mdeehm mdehem mdehme memhed memhde memehd
memedh memdeh memdhe mehmed mehmde mehemd mehedm mehdem mehdme meehmd meehdm
meemhd meemdh meedmh meedhm medhem medhme medehm medemh medmeh medmhe mmehed
mmehde mmeehd mmeedh mmedeh mmedhe mmheed mmhede mmheed mmhede mmhdee mmhdee
mmehed mmehde mmeehd mmeedh mmedeh mmedhe mmdhee mmdhee mmdehe mmdeeh mmdeeh
mmdehe mhmeed mhmede mhmeed mhmede mhmdee mhmdee mhemed mhemde mheemd mheedm
mhedem mhedme mheemd mheedm mhemed mhemde mhedme mhedem mhdeem mhdeme mhdeem
mhdeme mhdmee mhdmee memhed memhde memehd memedh memdeh memdhe mehmed mehmde
mehemd mehedm mehdem mehdme meehmd meehdm meemhd meemdh meedmh meedhm medhem
medhme medehm medemh medmeh medmhe mdmhee mdmhee mdmehe mdmeeh mdmeeh mdmehe
mdhmee mdhmee mdheme mdheem mdheem mdheme mdehme mdehem mdemhe mdemeh mdeemh
mdeehm mdehem mdehme mdeehm mdeemh mdemeh mdemhe eemmhd eemmdh eemhmd eemhdm
eemdhm eemdmh eemmhd eemmdh eemhmd eemhdm eemdhm eemdmh eehmmd eehmdm eehmmd
eehmdm eehdmm eehdmm eedmhm eedmmh eedhmm eedhmm eedmhm eedmmh ememhd ememdh
emehmd emehdm emedhm emedmh emmehd emmedh emmhed emmhde emmdhe emmdeh emhmed
emhmde emhemd emhedm emhdem emhdme emdmhe emdmeh emdhme emdhem emdehm emdemh
emmehd emmedh emmhed emmhde emmdhe emmdeh ememhd ememdh emehmd emehdm emedhm
emedmh emhemd emhedm emhmed emhmde emhdme emhdem emdehm emdemh emdhem emdhme
emdmhe emdmeh ehmmed ehmmde ehmemd ehmedm ehmdem ehmdme ehmmed ehmmde ehmemd
ehmedm ehmdem ehmdme ehemmd ehemdm ehemmd ehemdm ehedmm ehedmm ehdmem ehdmme
ehdemm ehdemm ehdmem ehdmme edmmhe edmmeh edmhme edmhem edmehm edmemh edmmhe
edmmeh edmhme edmhem edmehm edmemh edhmme edhmem edhmme edhmem edhemm edhemm
edemhm edemmh edehmm edehmm edemhm edemmh demmeh demmhe dememh demehm demhem
demhme demmeh demmhe dememh demehm demhem demhme deemmh deemhm deemmh deemhm
deehmm deehmm dehmem dehmme dehemm dehemm dehmem dehmme dmemeh dmemhe dmeemh
dmeehm dmehem dmehme dmmeeh dmmehe dmmeeh dmmehe dmmhee dmmhee dmemeh dmemhe
dmeemh dmeehm dmehem dmehme dmhmee dmhmee dmheme dmheem dmheem dmheme dmmeeh
dmmehe dmmeeh dmmehe dmmhee dmmhee dmemeh dmemhe dmeemh dmeehm dmehem dmehme
dmeemh dmeehm dmemeh dmemhe dmehme dmehem dmheem dmheme dmheem dmheme dmhmee
dmhmee demmeh demmhe dememh demehm demhem demhme demmeh demmhe dememh demehm
demhem demhme deemmh deemhm deemmh deemhm deehmm deehmm dehmem dehmme dehemm
dehemm dehmem dehmme dhmmee dhmmee dhmeme dhmeem dhmeem dhmeme dhmmee dhmmee
dhmeme dhmeem dhmeem dhmeme dhemme dhemem dhemme dhemem dheemm dheemm dhemem
dhemme dheemm dheemm dhemem dhemme

Read more ...[1] , [2] , [3]

History of cryptography
© 2011 Easy Ciphers. All rights reserved. contact us