easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

gabrieli

choof

ricka

maude

posuerint

posada

dench

forebowels

branchiopod

sinuous

roider

sozine

afghanis

eskenazi

adamitic

serrating

unperturbedness

arbaugh


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: heiresses
cipher variations:
ifjsfttft jgktguugu khluhvvhv limviwwiw mjnwjxxjx
nkoxkyyky olpylzzlz pmqzmaama qnranbbnb rosboccoc
sptcpddpd tqudqeeqe urverffrf vswfsggsg wtxgthhth
xuyhuiiui yvzivjjvj zwajwkkwk axbkxllxl byclymmym
czdmznnzn daenaooao ebfobppbp fcgpcqqcq gdhqdrrdr

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: heiresses
Cipher: svrivhhvh

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: heiresses
Cipher: AABBB AABAA ABAAA BAAAA AABAA BAAAB BAAAB AABAA BAAAB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: heiresses
cipher variations:
ifjsfttftwnzanddndkvpivnnvnydfqdxxdxmlvylhhlhatlgtrrtrcjrwjlljlqrhervvrv
ezxmzffzfshnuhpphpgpdcpzzpzuxtkxjjxjjgktguuguxoaboeeoelwqjwoowozegreyyey
nmwzmiimibumhussusdksxkmmkmrsifswwswfaynaggagtioviqqiqhqedqaaqavyulykkyk
khluhvvhvypbcpffpfmxrkxppxpafhsfzzfzonxanjjnjcvnivttvteltylnnlnstjgtxxtx
gbzobhhbhujpwjrrjrirferbbrbwzvmzllzllimviwwiwzqcdqggqgnyslyqqyqbgitgaaga
poybokkokdwojwuuwufmuzmoomotukhuyyuyhcapciicivkqxkssksjsgfsccscxawnammam
mjnwjxxjxarderhhrhoztmzrrzrchjuhbbhbqpzcpllplexpkxvvxvgnvanppnpuvlivzzvz
idbqdjjdjwlrylttltkthgtddtdybxobnnbnnkoxkyykybsefsiisipaunassasdikviccic
rqadqmmqmfyqlywwywhowboqqoqvwmjwaawajecrekkekxmszmuumuluihueeuezcypcooco
olpylzzlzctfgtjjtjqbvobttbtejlwjddjdsrbernnrngzrmzxxzxipxcprrprwxnkxbbxb
kfdsfllflyntanvvnvmvjivffvfadzqdppdppmqzmaamadughukkukrcwpcuucufkmxkeeke
tscfsoosohasnayyayjqydqssqsxyolyccyclgetgmmgmzoubowwownwkjwggwgbeareqqeq
qnranbbnbevhivllvlsdxqdvvdvglnylfflfutdgtpptpibtobzzbzkrzerttrtyzpmzddzd
mhfuhnnhnapvcpxxpxoxlkxhhxhcfbsfrrfrrosboccocfwijwmmwmteyrewwewhmozmggmg
vuehuqquqjcupcaacalsafsuusuzaqnaeeaenigviooiobqwdqyyqypymlyiiyidgctgssgs
sptcpddpdgxjkxnnxnufzsfxxfxinpanhhnhwvfivrrvrkdvqdbbdbmtbgtvvtvabrobffbf
ojhwjppjpcrxerzzrzqznmzjjzjehduhtthttqudqeeqehyklyooyovgatgyygyjoqboiioi
xwgjwsswslewreccecnuchuwwuwbcspcggcgpkixkqqkqdsyfsaasaraonakkakfieviuuiu
urverffrfizlmzppzpwhbuhzzhzkprcpjjpjyxhkxttxtmfxsfddfdovdivxxvxcdtqdhhdh
qljylrrlretzgtbbtbsbpobllblgjfwjvvjvvswfsggsgjamnaqqaqxicviaaialqsdqkkqk
zyilyuuyungytgeegepwejwyywydeureiieirmkzmssmsfuahuccuctcqpcmmcmhkgxkwwkw
wtxgthhthkbnobrrbryjdwjbbjbmrterllrlazjmzvvzvohzuhffhfqxfkxzzxzefvsfjjfj
snlanttntgvbivddvdudrqdnndnilhylxxlxxuyhuiiuilcopcsscszkexkcckcnsufsmmsm
baknawwawpiaviggigryglyaayafgwtgkkgktombouuouhwcjweewevesreooeojmizmyymy
yvzivjjvjmdpqdttdtalfylddldotvgtnntncblobxxbxqjbwjhhjhszhmzbbzbghxuhllhl
upncpvvpvixdkxffxfwftsfppfpknjanzznzzwajwkkwkneqreuueubmgzmeemepuwhuoouo
dcmpcyycyrkcxkiikitainaccachiyvimmimvqodqwwqwjyelyggygxgutgqqgqlokboaaoa
axbkxllxlofrsfvvfvcnhanffnfqvxivppvpednqdzzdzsldyljjljubjobddbdijzwjnnjn
wrperxxrxkzfmzhhzhyhvuhrrhrmplcpbbpbbyclymmympgstgwwgwdoiboggogrwyjwqqwq
feoreaaeatmezmkkmkvckpceecejkaxkookoxsqfsyysylagnaiiaiziwvissisnqmdqccqc
czdmznnznqhtuhxxhxepjcphhphsxzkxrrxrgfpsfbbfbunfanllnlwdlqdffdfklbylpplp
ytrgtzztzmbhobjjbjajxwjttjtornerddrddaenaooaoriuviyyiyfqkdqiiqityalyssys
hgqtgccgcvogbommomxemreggeglmczmqqmqzushuaauancipckkckbkyxkuukupsofseese
ebfobppbpsjvwjzzjzgrlerjjrjuzbmzttztihruhddhdwphcpnnpnyfnsfhhfhmndanrrnr
avtivbbvbodjqdlldlclzylvvlvqtpgtfftffcgpcqqcqtkwxkaakahsmfskkskvacnauuau
jisvieeiexqidqooqozgotgiiginoebossosbwujwccwcpekremmemdmazmwwmwruqhuggug
gdhqdrrdrulxylbblbitngtlltlwbdobvvbvkjtwjffjfyrjerpprpahpuhjjhjopfcpttpt
cxvkxddxdqflsfnnfnenbanxxnxsvrivhhvhheiressesvmyzmccmcjuohummumxcepcwwcw
lkuxkggkgzskfsqqsqbiqvikkikpqgdquuqudywlyeeyergmtgoogofocboyyoytwsjwiiwi

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: heiresses
Cipher: urverffrf

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: heiresses
Cipher: 325142245134345134

Extended Methods:
Method #1

Plaintext: heiresses
method variations:
nkowkxxkxsptbpccpcxuyguhhuhczdmznnzn

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
h e i r e s s e s 
3 5 4 2 5 3 3 5 3 
2 1 2 4 1 4 4 1 4 
They are then read out in rows:
354253353212414414
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: heiresses
Cipher: xipxhfdtq

Read more ...
Method #3

Plaintext: heiresses
method variations:
wqgyloylo qgyloylow gyloylowq
yloylowqg loylowqgy oylowqgyl
ylowqgylo lowqgyloy owqgyloyl

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: heiresses

first 5040 cipher variations(362880 total)
heiresses heiressse heiresess heiresess heiresses heiressse heiresses heiressse heiresess heiresess heiresses
heiressse heireesss heireesss heireesss heireesss heireesss heireesss heiresses heiressse heiresess heiresess
heiresses heiressse heirseses heirsesse heirseess heirseess heirseses heirsesse heirssees heirssese heirssees
heirssese heirsssee heirsssee heirseses heirsesse heirseess heirseess heirseses heirsesse heirsssee heirsssee
heirssese heirssees heirssees heirssese heirssees heirssese heirssees heirssese heirsssee heirsssee heirseses
heirsesse heirseess heirseess heirseses heirsesse heirseess heirseess heirseses heirsesse heirsesse heirseses
heirssees heirssese heirssees heirssese heirsssee heirsssee heiresses heiressse heiresess heiresess heiresses
heiressse heiresses heiressse heiresess heiresess heiresses heiressse heireesss heireesss heireesss heireesss
heireesss heireesss heiresses heiressse heiresess heiresess heiresses heiressse heirsssee heirsssee heirssese
heirssees heirssees heirssese heirsssee heirsssee heirssese heirssees heirssees heirssese heirsesse heirseses
heirsesse heirseses heirseess heirseess heirseses heirsesse heirseess heirseess heirseses heirsesse heiersses
heierssse heiersess heiersess heiersses heierssse heiersses heierssse heiersess heiersess heiersses heierssse
heieresss heieresss heieresss heieresss heieresss heieresss heiersses heierssse heiersess heiersess heiersses
heierssse heiesrses heiesrsse heiesress heiesress heiesrses heiesrsse heiessres heiessrse heiessers heiessesr
heiessser heiesssre heiesesrs heiesessr heieserss heieserss heiesesrs heiesessr heiessser heiesssre heiessesr
heiessers heiessres heiessrse heiessres heiessrse heiessers heiessesr heiessser heiesssre heiesrses heiesrsse
heiesress heiesress heiesrses heiesrsse heieserss heieserss heiesesrs heiesessr heiesessr heiesesrs heiessres
heiessrse heiessers heiessesr heiessser heiesssre heieessrs heieesssr heieesrss heieesrss heieessrs heieesssr
heieessrs heieesssr heieesrss heieesrss heieessrs heieesssr heieersss heieersss heieersss heieersss heieersss
heieersss heieessrs heieesssr heieesrss heieesrss heieessrs heieesssr heiessser heiesssre heiessesr heiessers
heiessres heiessrse heiessser heiesssre heiessesr heiessers heiessres heiessrse heiesessr heiesesrs heiesessr
heiesesrs heieserss heieserss heiesrses heiesrsse heiesress heiesress heiesrses heiesrsse heiserses heisersse
heiseress heiseress heiserses heisersse heisesres heisesrse heisesers heisesesr heisesser heisessre heiseesrs
heiseessr heiseerss heiseerss heiseesrs heiseessr heisesser heisessre heisesesr heisesers heisesres heisesrse
heisreses heisresse heisreess heisreess heisreses heisresse heisrsees heisrsese heisrsees heisrsese heisrssee
heisrssee heisreses heisresse heisreess heisreess heisreses heisresse heisrssee heisrssee heisrsese heisrsees
heisrsees heisrsese heissrees heissrese heissrees heissrese heissrsee heissrsee heisseres heisserse heisseers
heisseesr heisseser heissesre heisseers heisseesr heisseres heisserse heissesre heisseser heissseer heisssere
heissseer heisssere heisssree heisssree heiserses heisersse heiseress heiseress heiserses heisersse heisesres
heisesrse heisesers heisesesr heisesser heisessre heiseesrs heiseessr heiseerss heiseerss heiseesrs heiseessr
heisesser heisessre heisesesr heisesers heisesres heisesrse heissrsee heissrsee heissrese heissrees heissrees
heissrese heisssree heisssree heisssere heissseer heissseer heisssere heissesre heisseser heisserse heisseres
heisseers heisseesr heisseser heissesre heisseesr heisseers heisseres heisserse heisesres heisesrse heisesers
heisesesr heisesser heisessre heiserses heisersse heiseress heiseress heiserses heisersse heiseerss heiseerss
heiseesrs heiseessr heiseessr heiseesrs heisesres heisesrse heisesers heisesesr heisesser heisessre heisseres
heisserse heisseers heisseesr heisseser heissesre heissrees heissrese heissrees heissrese heissrsee heissrsee
heisseres heisserse heisseers heisseesr heisseser heissesre heisssree heisssree heisssere heissseer heissseer
heisssere heisrsees heisrsese heisrsees heisrsese heisrssee heisrssee heisreses heisresse heisreess heisreess
heisreses heisresse heisreess heisreess heisreses heisresse heisresse heisreses heisrsees heisrsese heisrsees
heisrsese heisrssee heisrssee heisesres heisesrse heisesers heisesesr heisesser heisessre heiserses heisersse
heiseress heiseress heiserses heisersse heiseerss heiseerss heiseesrs heiseessr heiseessr heiseesrs heisesres
heisesrse heisesers heisesesr heisesser heisessre heisssree heisssree heisssere heissseer heissseer heisssere
heissrsee heissrsee heissrese heissrees heissrees heissrese heisserse heisseres heissesre heisseser heisseesr
heisseers heisseres heisserse heisseers heisseesr heisseser heissesre heieessrs heieesssr heieesrss heieesrss
heieessrs heieesssr heieessrs heieesssr heieesrss heieesrss heieessrs heieesssr heieersss heieersss heieersss
heieersss heieersss heieersss heieessrs heieesssr heieesrss heieesrss heieessrs heieesssr heiesesrs heiesessr
heieserss heieserss heiesesrs heiesessr heiessers heiessesr heiessres heiessrse heiesssre heiessser heiesrses
heiesrsse heiesress heiesress heiesrses heiesrsse heiesssre heiessser heiessrse heiessres heiessers heiessesr
heiessers heiessesr heiessres heiessrse heiesssre heiessser heiesesrs heiesessr heieserss heieserss heiesesrs
heiesessr heiesress heiesress heiesrses heiesrsse heiesrsse heiesrses heiessers heiessesr heiessres heiessrse
heiesssre heiessser heiersses heierssse heiersess heiersess heiersses heierssse heiersses heierssse heiersess
heiersess heiersses heierssse heieresss heieresss heieresss heieresss heieresss heieresss heiersses heierssse
heiersess heiersess heiersses heierssse heiesssre heiessser heiessrse heiessres heiessers heiessesr heiesssre
heiessser heiessrse heiessres heiessers heiessesr heiesrsse heiesrses heiesrsse heiesrses heiesress heiesress
heiesesrs heiesessr heieserss heieserss heiesesrs heiesessr heisesser heisessre heisesesr heisesers heisesres
heisesrse heisesser heisessre heisesesr heisesers heisesres heisesrse heiseessr heiseesrs heiseessr heiseesrs
heiseerss heiseerss heiserses heisersse heiseress heiseress heiserses heisersse heisseser heissesre heisseesr
heisseers heisseres heisserse heissseer heisssere heissseer heisssere heisssree heisssree heisseser heissesre
heisseesr heisseers heisseres heisserse heissrsee heissrsee heissrese heissrees heissrees heissrese heissseer
heisssere heissseer heisssere heisssree heisssree heisseser heissesre heisseesr heisseers heisseres heisserse
heisseesr heisseers heisseser heissesre heisserse heisseres heissrees heissrese heissrees heissrese heissrsee
heissrsee heisesser heisessre heisesesr heisesers heisesres heisesrse heisesser heisessre heisesesr heisesers
heisesres heisesrse heiseessr heiseesrs heiseessr heiseesrs heiseerss heiseerss heiserses heisersse heiseress
heiseress heiserses heisersse heisrssee heisrssee heisrsese heisrsees heisrsees heisrsese heisrssee heisrssee
heisrsese heisrsees heisrsees heisrsese heisresse heisreses heisresse heisreses heisreess heisreess heisreses
heisresse heisreess heisreess heisreses heisresse heriesses heriessse heriesess heriesess heriesses heriessse
heriesses heriessse heriesess heriesess heriesses heriessse herieesss herieesss herieesss herieesss herieesss
herieesss heriesses heriessse heriesess heriesess heriesses heriessse heriseses herisesse heriseess heriseess
heriseses herisesse herissees herissese herissees herissese herisssee herisssee heriseses herisesse heriseess
heriseess heriseses herisesse herisssee herisssee herissese herissees herissees herissese herissees herissese
herissees herissese herisssee herisssee heriseses herisesse heriseess heriseess heriseses herisesse heriseess
heriseess heriseses herisesse herisesse heriseses herissees herissese herissees herissese herisssee herisssee
heriesses heriessse heriesess heriesess heriesses heriessse heriesses heriessse heriesess heriesess heriesses
heriessse herieesss herieesss herieesss herieesss herieesss herieesss heriesses heriessse heriesess heriesess
heriesses heriessse herisssee herisssee herissese herissees herissees herissese herisssee herisssee herissese
herissees herissees herissese herisesse heriseses herisesse heriseses heriseess heriseess heriseses herisesse
heriseess heriseess heriseses herisesse hereisses hereissse hereisess hereisess hereisses hereissse hereisses
hereissse hereisess hereisess hereisses hereissse hereiesss hereiesss hereiesss hereiesss hereiesss hereiesss
hereisses hereissse hereisess hereisess hereisses hereissse heresises heresisse heresiess heresiess heresises
heresisse heressies heressise heresseis heressesi heresssei heresssie heresesis heresessi hereseiss hereseiss
heresesis heresessi heresssei heresssie heressesi heresseis heressies heressise heressies heressise heresseis
heressesi heresssei heresssie heresises heresisse heresiess heresiess heresises heresisse hereseiss hereseiss
heresesis heresessi heresessi heresesis heressies heressise heresseis heressesi heresssei heresssie hereessis
hereesssi hereesiss hereesiss hereessis hereesssi hereessis hereesssi hereesiss hereesiss hereessis hereesssi
hereeisss hereeisss hereeisss hereeisss hereeisss hereeisss hereessis hereesssi hereesiss hereesiss hereessis
hereesssi heresssei heresssie heressesi heresseis heressies heressise heresssei heresssie heressesi heresseis
heressies heressise heresessi heresesis heresessi heresesis hereseiss hereseiss heresises heresisse heresiess
heresiess heresises heresisse herseises herseisse herseiess herseiess herseises herseisse hersesies hersesise
herseseis hersesesi hersessei hersessie herseesis herseessi herseeiss herseeiss herseesis herseessi hersessei
hersessie hersesesi herseseis hersesies hersesise hersieses hersiesse hersieess hersieess hersieses hersiesse
hersisees hersisese hersisees hersisese hersissee hersissee hersieses hersiesse hersieess hersieess hersieses
hersiesse hersissee hersissee hersisese hersisees hersisees hersisese herssiees herssiese herssiees herssiese
herssisee herssisee hersseies hersseise hersseeis hersseesi herssesei herssesie hersseeis hersseesi hersseies
hersseise herssesie herssesei herssseei herssseie herssseei herssseie hersssiee hersssiee herseises herseisse
herseiess herseiess herseises herseisse hersesies hersesise herseseis hersesesi hersessei hersessie herseesis
herseessi herseeiss herseeiss herseesis herseessi hersessei hersessie hersesesi herseseis hersesies hersesise
herssisee herssisee herssiese herssiees herssiees herssiese hersssiee hersssiee herssseie herssseei herssseei
herssseie herssesie herssesei hersseise hersseies hersseeis hersseesi herssesei herssesie hersseesi hersseeis
hersseies hersseise hersesies hersesise herseseis hersesesi hersessei hersessie herseises herseisse herseiess
herseiess herseises herseisse herseeiss herseeiss herseesis herseessi herseessi herseesis hersesies hersesise
herseseis hersesesi hersessei hersessie hersseies hersseise hersseeis hersseesi herssesei herssesie herssiees
herssiese herssiees herssiese herssisee herssisee hersseies hersseise hersseeis hersseesi herssesei herssesie
hersssiee hersssiee herssseie herssseei herssseei herssseie hersisees hersisese hersisees hersisese hersissee
hersissee hersieses hersiesse hersieess hersieess hersieses hersiesse hersieess hersieess hersieses hersiesse
hersiesse hersieses hersisees hersisese hersisees hersisese hersissee hersissee hersesies hersesise herseseis
hersesesi hersessei hersessie herseises herseisse herseiess herseiess herseises herseisse herseeiss herseeiss
herseesis herseessi herseessi herseesis hersesies hersesise herseseis hersesesi hersessei hersessie hersssiee
hersssiee herssseie herssseei herssseei herssseie herssisee herssisee herssiese herssiees herssiees herssiese
hersseise hersseies herssesie herssesei hersseesi hersseeis hersseies hersseise hersseeis hersseesi herssesei
herssesie hereessis hereesssi hereesiss hereesiss hereessis hereesssi hereessis hereesssi hereesiss hereesiss
hereessis hereesssi hereeisss hereeisss hereeisss hereeisss hereeisss hereeisss hereessis hereesssi hereesiss
hereesiss hereessis hereesssi heresesis heresessi hereseiss hereseiss heresesis heresessi heresseis heressesi
heressies heressise heresssie heresssei heresises heresisse heresiess heresiess heresises heresisse heresssie
heresssei heressise heressies heresseis heressesi heresseis heressesi heressies heressise heresssie heresssei
heresesis heresessi hereseiss hereseiss heresesis heresessi heresiess heresiess heresises heresisse heresisse
heresises heresseis heressesi heressies heressise heresssie heresssei hereisses hereissse hereisess hereisess
hereisses hereissse hereisses hereissse hereisess hereisess hereisses hereissse hereiesss hereiesss hereiesss
hereiesss hereiesss hereiesss hereisses hereissse hereisess hereisess hereisses hereissse heresssie heresssei
heressise heressies heresseis heressesi heresssie heresssei heressise heressies heresseis heressesi heresisse
heresises heresisse heresises heresiess heresiess heresesis heresessi hereseiss hereseiss heresesis heresessi
hersessei hersessie hersesesi herseseis hersesies hersesise hersessei hersessie hersesesi herseseis hersesies
hersesise herseessi herseesis herseessi herseesis herseeiss herseeiss herseises herseisse herseiess herseiess
herseises herseisse herssesei herssesie hersseesi hersseeis hersseies hersseise herssseei herssseie herssseei
herssseie hersssiee hersssiee herssesei herssesie hersseesi hersseeis hersseies hersseise herssisee herssisee
herssiese herssiees herssiees herssiese herssseei herssseie herssseei herssseie hersssiee hersssiee herssesei
herssesie hersseesi hersseeis hersseies hersseise hersseesi hersseeis herssesei herssesie hersseise hersseies
herssiees herssiese herssiees herssiese herssisee herssisee hersessei hersessie hersesesi herseseis hersesies
hersesise hersessei hersessie hersesesi herseseis hersesies hersesise herseessi herseesis herseessi herseesis
herseeiss herseeiss herseises herseisse herseiess herseiess herseises herseisse hersissee hersissee hersisese
hersisees hersisees hersisese hersissee hersissee hersisese hersisees hersisees hersisese hersiesse hersieses
hersiesse hersieses hersieess hersieess hersieses hersiesse hersieess hersieess hersieses hersiesse heerisses
heerissse heerisess heerisess heerisses heerissse heerisses heerissse heerisess heerisess heerisses heerissse
heeriesss heeriesss heeriesss heeriesss heeriesss heeriesss heerisses heerissse heerisess heerisess heerisses
heerissse heersises heersisse heersiess heersiess heersises heersisse heerssies heerssise heersseis heerssesi
heersssei heersssie heersesis heersessi heerseiss heerseiss heersesis heersessi heersssei heersssie heerssesi
heersseis heerssies heerssise heerssies heerssise heersseis heerssesi heersssei heersssie heersises heersisse
heersiess heersiess heersises heersisse heerseiss heerseiss heersesis heersessi heersessi heersesis heerssies
heerssise heersseis heerssesi heersssei heersssie heeressis heeresssi heeresiss heeresiss heeressis heeresssi
heeressis heeresssi heeresiss heeresiss heeressis heeresssi heereisss heereisss heereisss heereisss heereisss
heereisss heeressis heeresssi heeresiss heeresiss heeressis heeresssi heersssei heersssie heerssesi heersseis
heerssies heerssise heersssei heersssie heerssesi heersseis heerssies heerssise heersessi heersesis heersessi
heersesis heerseiss heerseiss heersises heersisse heersiess heersiess heersises heersisse heeirsses heeirssse
heeirsess heeirsess heeirsses heeirssse heeirsses heeirssse heeirsess heeirsess heeirsses heeirssse heeiresss
heeiresss heeiresss heeiresss heeiresss heeiresss heeirsses heeirssse heeirsess heeirsess heeirsses heeirssse
heeisrses heeisrsse heeisress heeisress heeisrses heeisrsse heeissres heeissrse heeissers heeissesr heeissser
heeisssre heeisesrs heeisessr heeiserss heeiserss heeisesrs heeisessr heeissser heeisssre heeissesr heeissers
heeissres heeissrse heeissres heeissrse heeissers heeissesr heeissser heeisssre heeisrses heeisrsse heeisress
heeisress heeisrses heeisrsse heeiserss heeiserss heeisesrs heeisessr heeisessr heeisesrs heeissres heeissrse
heeissers heeissesr heeissser heeisssre heeiessrs heeiesssr heeiesrss heeiesrss heeiessrs heeiesssr heeiessrs
heeiesssr heeiesrss heeiesrss heeiessrs heeiesssr heeiersss heeiersss heeiersss heeiersss heeiersss heeiersss
heeiessrs heeiesssr heeiesrss heeiesrss heeiessrs heeiesssr heeissser heeisssre heeissesr heeissers heeissres
heeissrse heeissser heeisssre heeissesr heeissers heeissres heeissrse heeisessr heeisesrs heeisessr heeisesrs
heeiserss heeiserss heeisrses heeisrsse heeisress heeisress heeisrses heeisrsse heesirses heesirsse heesiress
heesiress heesirses heesirsse heesisres heesisrse heesisers heesisesr heesisser heesissre heesiesrs heesiessr
heesierss heesierss heesiesrs heesiessr heesisser heesissre heesisesr heesisers heesisres heesisrse heesrises
heesrisse heesriess heesriess heesrises heesrisse heesrsies heesrsise heesrseis heesrsesi heesrssei heesrssie
heesresis heesressi heesreiss heesreiss heesresis heesressi heesrssei heesrssie heesrsesi heesrseis heesrsies
heesrsise heessries heessrise heessreis heessresi heessrsei heessrsie heessires heessirse heessiers heessiesr
heessiser heessisre heesseirs heesseisr heesseris heessersi heessesri heessesir heesssier heesssire heessseir
heessseri heesssrei heesssrie heesersis heeserssi heeseriss heeseriss heesersis heeserssi heesesris heesesrsi
heesesirs heesesisr heesessir heesessri heeseisrs heeseissr heeseirss heeseirss heeseisrs heeseissr heesessir
heesessri heesesisr heesesirs heesesris heesesrsi heessrsei heessrsie heessresi heessreis heessries heessrise
heesssrei heesssrie heessseri heessseir heesssier heesssire heessesri heessesir heessersi heesseris heesseirs
heesseisr heessiser heessisre heessiesr heessiers heessires heessirse heesisres heesisrse heesisers heesisesr
heesisser heesissre heesirses heesirsse heesiress heesiress heesirses heesirsse heesierss heesierss heesiesrs
heesiessr heesiessr heesiesrs heesisres heesisrse heesisers heesisesr heesisser heesissre heessires heessirse
heessiers heessiesr heessiser heessisre heessries heessrise heessreis heessresi heessrsei heessrsie heesseris
heessersi heesseirs heesseisr heessesir heessesri heesssrei heesssrie heessseri heessseir heesssier heesssire
heesrsies heesrsise heesrseis heesrsesi heesrssei heesrssie heesrises heesrisse heesriess heesriess heesrises
heesrisse heesreiss heesreiss heesresis heesressi heesressi heesresis heesrsies heesrsise heesrseis heesrsesi
heesrssei heesrssie heesesris heesesrsi heesesirs heesesisr heesessir heesessri heesersis heeserssi heeseriss
heeseriss heesersis heeserssi heeseirss heeseirss heeseisrs heeseissr heeseissr heeseisrs heesesris heesesrsi
heesesirs heesesisr heesessir heesessri heesssrei heesssrie heessseri heessseir heesssier heesssire heessrsei
heessrsie heessresi heessreis heessries heessrise heessersi heesseris heessesri heessesir heesseisr heesseirs
heessires heessirse heessiers heessiesr heessiser heessisre heeeissrs heeeisssr heeeisrss heeeisrss heeeissrs
heeeisssr heeeissrs heeeisssr heeeisrss heeeisrss heeeissrs heeeisssr heeeirsss heeeirsss heeeirsss heeeirsss
heeeirsss heeeirsss heeeissrs heeeisssr heeeisrss heeeisrss heeeissrs heeeisssr heeesisrs heeesissr heeesirss
heeesirss heeesisrs heeesissr heeessirs heeessisr heeessris heeessrsi heeesssri heeesssir heeesrsis heeesrssi
heeesriss heeesriss heeesrsis heeesrssi heeesssri heeesssir heeessrsi heeessris heeessirs heeessisr heeessirs
heeessisr heeessris heeessrsi heeesssri heeesssir heeesisrs heeesissr heeesirss heeesirss heeesisrs heeesissr
heeesriss heeesriss heeesrsis heeesrssi heeesrssi heeesrsis heeessirs heeessisr heeessris heeessrsi heeesssri
heeesssir heeerssis heeersssi heeersiss heeersiss heeerssis heeersssi heeerssis heeersssi heeersiss heeersiss
heeerssis heeersssi heeerisss heeerisss heeerisss heeerisss heeerisss heeerisss heeerssis heeersssi heeersiss
heeersiss heeerssis heeersssi heeesssri heeesssir heeessrsi heeessris heeessirs heeessisr heeesssri heeesssir
heeessrsi heeessris heeessirs heeessisr heeesrssi heeesrsis heeesrssi heeesrsis heeesriss heeesriss heeesisrs
heeesissr heeesirss heeesirss heeesisrs heeesissr heesisser heesissre heesisesr heesisers heesisres heesisrse
heesisser heesissre heesisesr heesisers heesisres heesisrse heesiessr heesiesrs heesiessr heesiesrs heesierss
heesierss heesirses heesirsse heesiress heesiress heesirses heesirsse heessiser heessisre heessiesr heessiers
heessires heessirse heesssier heesssire heessseir heessseri heesssrei heesssrie heessesir heessesri heesseisr
heesseirs heesseris heessersi heessrsei heessrsie heessresi heessreis heessries heessrise heesssier heesssire
heessseir heessseri heesssrei heesssrie heessiser heessisre heessiesr heessiers heessires heessirse heesseisr
heesseirs heessesir heessesri heessersi heesseris heessries heessrise heessreis heessresi heessrsei heessrsie
heesessir heesessri heesesisr heesesirs heesesris heesesrsi heesessir heesessri heesesisr heesesirs heesesris
heesesrsi heeseissr heeseisrs heeseissr heeseisrs heeseirss heeseirss heesersis heeserssi heeseriss heeseriss
heesersis heeserssi heesrssei heesrssie heesrsesi heesrseis heesrsies heesrsise heesrssei heesrssie heesrsesi
heesrseis heesrsies heesrsise heesressi heesresis heesressi heesresis heesreiss heesreiss heesrises heesrisse
heesriess heesriess heesrises heesrisse hesreises hesreisse hesreiess hesreiess hesreises hesreisse hesresies
hesresise hesreseis hesresesi hesressei hesressie hesreesis hesreessi hesreeiss hesreeiss hesreesis hesreessi
hesressei hesressie hesresesi hesreseis hesresies hesresise hesrieses hesriesse hesrieess hesrieess hesrieses
hesriesse hesrisees hesrisese hesrisees hesrisese hesrissee hesrissee hesrieses hesriesse hesrieess hesrieess
hesrieses hesriesse hesrissee hesrissee hesrisese hesrisees hesrisees hesrisese hesrsiees hesrsiese hesrsiees
hesrsiese hesrsisee hesrsisee hesrseies hesrseise hesrseeis hesrseesi hesrsesei hesrsesie hesrseeis hesrseesi
hesrseies hesrseise hesrsesie hesrsesei hesrsseei hesrsseie hesrsseei hesrsseie hesrssiee hesrssiee hesreises
hesreisse hesreiess hesreiess hesreises hesreisse hesresies hesresise hesreseis hesresesi hesressei hesressie
hesreesis hesreessi hesreeiss hesreeiss hesreesis hesreessi hesressei hesressie hesresesi hesreseis hesresies
hesresise hesrsisee hesrsisee hesrsiese hesrsiees hesrsiees hesrsiese hesrssiee hesrssiee hesrsseie hesrsseei
hesrsseei hesrsseie hesrsesie hesrsesei hesrseise hesrseies hesrseeis hesrseesi hesrsesei hesrsesie hesrseesi
hesrseeis hesrseies hesrseise heserises heserisse heseriess heseriess heserises heserisse hesersies hesersise
heserseis hesersesi heserssei heserssie heseresis heseressi hesereiss hesereiss heseresis heseressi heserssei
heserssie hesersesi heserseis hesersies hesersise heseirses heseirsse heseiress heseiress heseirses heseirsse
heseisres heseisrse heseisers heseisesr heseisser heseissre heseiesrs heseiessr heseierss heseierss heseiesrs
heseiessr heseisser heseissre heseisesr heseisers heseisres heseisrse hesesires hesesirse hesesiers hesesiesr
hesesiser hesesisre hesesries hesesrise hesesreis hesesresi hesesrsei hesesrsie heseseris hesesersi heseseirs
heseseisr hesesesir hesesesri hesessrei hesessrie hesesseri hesesseir hesessier hesessire heseeisrs heseeissr
heseeirss heseeirss heseeisrs heseeissr heseesirs heseesisr heseesris heseesrsi heseessri heseessir heseersis
heseerssi heseeriss heseeriss heseersis heseerssi heseessri heseessir heseesrsi heseesris heseesirs heseesisr
hesesiser hesesisre hesesiesr hesesiers hesesires hesesirse hesessier hesessire hesesseir hesesseri hesessrei
hesessrie hesesesir hesesesri heseseisr heseseirs heseseris hesesersi hesesrsei hesesrsie hesesresi hesesreis
hesesries hesesrise hesierses hesiersse hesieress hesieress hesierses hesiersse hesiesres hesiesrse hesiesers
hesiesesr hesiesser hesiessre hesieesrs hesieessr hesieerss hesieerss hesieesrs hesieessr hesiesser hesiessre
hesiesesr hesiesers hesiesres hesiesrse hesireses hesiresse hesireess hesireess hesireses hesiresse hesirsees
hesirsese hesirsees hesirsese hesirssee hesirssee hesireses hesiresse hesireess hesireess hesireses hesiresse
hesirssee hesirssee hesirsese hesirsees hesirsees hesirsese hesisrees hesisrese hesisrees hesisrese hesisrsee
hesisrsee hesiseres hesiserse hesiseers hesiseesr hesiseser hesisesre hesiseers hesiseesr hesiseres hesiserse
hesisesre hesiseser hesisseer hesissere hesisseer hesissere hesissree hesissree hesierses hesiersse hesieress
hesieress hesierses hesiersse hesiesres hesiesrse hesiesers hesiesesr hesiesser hesiessre hesieesrs hesieessr
hesieerss hesieerss hesieesrs hesieessr hesiesser hesiessre hesiesesr hesiesers hesiesres hesiesrse hesisrsee
hesisrsee hesisrese hesisrees hesisrees hesisrese hesissree hesissree hesissere hesisseer hesisseer hesissere
hesisesre hesiseser hesiserse hesiseres hesiseers hesiseesr hesiseser hesisesre hesiseesr hesiseers hesiseres
hesiserse hesseires hesseirse hesseiers hesseiesr hesseiser hesseisre hesseries hesserise hessereis hesseresi
hessersei hessersie hesseeris hesseersi hesseeirs hesseeisr hesseesir hesseesri hessesrei hessesrie hesseseri
hesseseir hessesier hessesire hessieres hessierse hessieers hessieesr hessieser hessiesre hessirees hessirese
hessirees hessirese hessirsee hessirsee hessieres hessierse hessieers hessieesr hessieser hessiesre hessisree
hessisree hessisere hessiseer hessiseer hessisere hessriees hessriese hessriees hessriese hessrisee hessrisee
hessreies hessreise hessreeis hessreesi hessresei hessresie hessreeis hessreesi hessreies hessreise hessresie
hessresei hessrseei hessrseie hessrseei hessrseie hessrsiee hessrsiee hesseires hesseirse hesseiers hesseiesr
hesseiser hesseisre hesseries hesserise hessereis hesseresi hessersei hessersie hesseeris hesseersi hesseeirs
hesseeisr hesseesir hesseesri hessesrei hessesrie hesseseri hesseseir hessesier hessesire hesssiree hesssiree
hesssiere hesssieer hesssieer hesssiere hesssriee hesssriee hesssreie hesssreei hesssreei hesssreie hessserie
hessserei hessseire hessseier hessseeir hessseeri hessserei hessserie hessseeri hessseeir hessseier hessseire
heseeisrs heseeissr heseeirss heseeirss heseeisrs heseeissr heseesirs heseesisr heseesris heseesrsi heseessri
heseessir heseersis heseerssi heseeriss heseeriss heseersis heseerssi heseessri heseessir heseesrsi heseesris
heseesirs heseesisr heseiesrs heseiessr heseierss heseierss heseiesrs heseiessr heseisers heseisesr heseisres
heseisrse heseissre heseisser heseirses heseirsse heseiress heseiress heseirses heseirsse heseissre heseisser
heseisrse heseisres heseisers heseisesr hesesiers hesesiesr hesesires hesesirse hesesisre hesesiser heseseirs
heseseisr heseseris hesesersi hesesesri hesesesir hesesreis hesesresi hesesries hesesrise hesesrsie hesesrsei
hesesseri hesesseir hesessrei hesessrie hesessire hesessier heserises heserisse heseriess heseriess heserises
heserisse hesersies hesersise heserseis hesersesi heserssei heserssie heseresis heseressi hesereiss hesereiss
heseresis heseressi heserssei heserssie hesersesi heserseis hesersies hesersise hesesisre hesesiser hesesirse
hesesires hesesiers hesesiesr hesessire hesessier hesessrie hesessrei hesesseri hesesseir hesesrsie hesesrsei
hesesrise hesesries hesesreis hesesresi hesesesri hesesesir hesesersi heseseris heseseirs heseseisr hesseiser
hesseisre hesseiesr hesseiers hesseires hesseirse hessesier hessesire hesseseir hesseseri hessesrei hessesrie
hesseesir hesseesri hesseeisr hesseeirs hesseeris hesseersi hessersei hessersie hesseresi hessereis hesseries
hesserise hessieser hessiesre hessieesr hessieers hessieres hessierse hessiseer hessisere hessiseer hessisere
hessisree hessisree hessieser hessiesre hessieesr hessieers hessieres hessierse hessirsee hessirsee hessirese
hessirees hessirees hessirese hesssieer hesssiere hesssieer hesssiere hesssiree hesssiree hessseier hessseire
hessseeir hessseeri hessserei hessserie hessseeir hessseeri hessseier hessseire hessserie hessserei hesssreei
hesssreie hesssreei hesssreie hesssriee hesssriee hesseiser hesseisre hesseiesr hesseiers hesseires hesseirse
hessesier hessesire hesseseir hesseseri hessesrei hessesrie hesseesir hesseesri hesseeisr hesseeirs hesseeris
hesseersi hessersei hessersie hesseresi hessereis hesseries hesserise hessrisee hessrisee hessriese hessriees
hessriees hessriese hessrsiee hessrsiee hessrseie hessrseei hessrseei hessrseie hessresie hessresei hessreise
hessreies hessreeis hessreesi hessresei hessresie hessreesi hessreeis hessreies hessreise hesresies hesresise
hesreseis hesresesi hesressei hesressie hesreises hesreisse hesreiess hesreiess hesreises hesreisse hesreeiss
hesreeiss hesreesis hesreessi hesreessi hesreesis hesresies hesresise hesreseis hesresesi hesressei hesressie
hesrseies hesrseise hesrseeis hesrseesi hesrsesei hesrsesie hesrsiees hesrsiese hesrsiees hesrsiese hesrsisee
hesrsisee hesrseies hesrseise hesrseeis hesrseesi hesrsesei hesrsesie hesrssiee hesrssiee hesrsseie hesrsseei
hesrsseei hesrsseie hesrisees hesrisese hesrisees hesrisese hesrissee hesrissee hesrieses hesriesse hesrieess
hesrieess hesrieses hesriesse hesrieess hesrieess hesrieses hesriesse hesriesse hesrieses hesrisees hesrisese
hesrisees hesrisese hesrissee hesrissee hesresies hesresise hesreseis hesresesi hesressei hesressie hesreises
hesreisse hesreiess hesreiess hesreises hesreisse hesreeiss hesreeiss hesreesis hesreessi hesreessi hesreesis
hesresies hesresise hesreseis hesresesi hesressei hesressie hesrssiee hesrssiee hesrsseie hesrsseei hesrsseei
hesrsseie hesrsisee hesrsisee hesrsiese hesrsiees hesrsiees hesrsiese hesrseise hesrseies hesrsesie hesrsesei
hesrseesi hesrseeis hesrseies hesrseise hesrseeis hesrseesi hesrsesei hesrsesie hesersies hesersise heserseis
hesersesi heserssei heserssie heserises heserisse heseriess heseriess heserises heserisse hesereiss hesereiss
heseresis heseressi heseressi heseresis hesersies hesersise heserseis hesersesi heserssei heserssie hesesries
hesesrise hesesreis hesesresi hesesrsei hesesrsie hesesires hesesirse hesesiers hesesiesr hesesiser hesesisre
heseseirs heseseisr heseseris hesesersi hesesesri hesesesir hesessier hesessire hesesseir hesesseri hesessrei
hesessrie heseisres heseisrse heseisers heseisesr heseisser heseissre heseirses heseirsse heseiress heseiress
heseirses heseirsse heseierss heseierss heseiesrs heseiessr heseiessr heseiesrs heseisres heseisrse heseisers
heseisesr heseisser heseissre heseesirs heseesisr heseesris heseesrsi heseessri heseessir heseeisrs heseeissr
heseeirss heseeirss heseeisrs heseeissr heseeriss heseeriss heseersis heseerssi heseerssi heseersis heseesirs
heseesisr heseesris heseesrsi heseessri heseessir hesessier hesessire hesesseir hesesseri hesessrei hesessrie
hesesiser hesesisre hesesiesr hesesiers hesesires hesesirse heseseisr heseseirs hesesesir hesesesri hesesersi
heseseris hesesries hesesrise hesesreis hesesresi hesesrsei hesesrsie hesseries hesserise hessereis hesseresi
hessersei hessersie hesseires hesseirse hesseiers hesseiesr hesseiser hesseisre hesseeirs hesseeisr hesseeris
hesseersi hesseesri hesseesir hessesier hessesire hesseseir hesseseri hessesrei hessesrie hessreies hessreise
hessreeis hessreesi hessresei hessresie hessriees hessriese hessriees hessriese hessrisee hessrisee hessreies
hessreise hessreeis hessreesi hessresei hessresie hessrsiee hessrsiee hessrseie hessrseei hessrseei hessrseie
hessirees hessirese hessirees hessirese hessirsee hessirsee hessieres hessierse hessieers hessieesr hessieser
hessiesre hessieers hessieesr hessieres hessierse hessiesre hessieser hessiseer hessisere hessiseer hessisere
hessisree hessisree hesseries hesserise hessereis hesseresi hessersei hessersie hesseires hesseirse hesseiers
hesseiesr hesseiser hesseisre hesseeirs hesseeisr hesseeris hesseersi hesseesri hesseesir hessesier hessesire
hesseseir hesseseri hessesrei hessesrie hesssriee hesssriee hesssreie hesssreei hesssreei hesssreie hesssiree
hesssiree hesssiere hesssieer hesssieer hesssiere hessseire hessseier hessserie hessserei hessseeri hessseeir
hessseier hessseire hessseeir hessseeri hessserei hessserie hesiesres hesiesrse hesiesers hesiesesr hesiesser
hesiessre hesierses hesiersse hesieress hesieress hesierses hesiersse hesieerss hesieerss hesieesrs hesieessr
hesieessr hesieesrs hesiesres hesiesrse hesiesers hesiesesr hesiesser hesiessre hesiseres hesiserse hesiseers
hesiseesr hesiseser hesisesre hesisrees hesisrese hesisrees hesisrese hesisrsee hesisrsee hesiseres hesiserse
hesiseers hesiseesr hesiseser hesisesre hesissree hesissree hesissere hesisseer hesisseer hesissere hesirsees
hesirsese hesirsees hesirsese hesirssee hesirssee hesireses hesiresse hesireess hesireess hesireses hesiresse
hesireess hesireess hesireses hesiresse hesiresse hesireses hesirsees hesirsese hesirsees hesirsese hesirssee
hesirssee hesiesres hesiesrse hesiesers hesiesesr hesiesser hesiessre hesierses hesiersse hesieress hesieress
hesierses hesiersse hesieerss hesieerss hesieesrs hesieessr hesieessr hesieesrs hesiesres hesiesrse hesiesers
hesiesesr hesiesser hesiessre hesissree hesissree hesissere hesisseer hesisseer hesissere hesisrsee hesisrsee
hesisrese hesisrees hesisrees hesisrese hesiserse hesiseres hesisesre hesiseser hesiseesr hesiseers hesiseres
hesiserse hesiseers hesiseesr hesiseser hesisesre heseesirs heseesisr heseesris heseesrsi heseessri heseessir
heseeisrs heseeissr heseeirss heseeirss heseeisrs heseeissr heseeriss heseeriss heseersis heseerssi heseerssi
heseersis heseesirs heseesisr heseesris heseesrsi heseessri heseessir heseseirs heseseisr heseseris hesesersi
hesesesri hesesesir hesesiers hesesiesr hesesires hesesirse hesesisre hesesiser hesesries hesesrise hesesreis
hesesresi hesesrsei hesesrsie hesessire hesessier hesessrie hesessrei hesesseri hesesseir heseisers heseisesr
heseisres heseisrse heseissre heseisser heseiesrs heseiessr heseierss heseierss heseiesrs heseiessr heseiress
heseiress heseirses heseirsse heseirsse heseirses heseisers heseisesr heseisres heseisrse heseissre heseisser
hesersies hesersise heserseis hesersesi heserssei heserssie heserises heserisse heseriess heseriess heserises
heserisse hesereiss hesereiss heseresis heseressi heseressi heseresis hesersies hesersise heserseis hesersesi
heserssei heserssie hesessire hesessier hesessrie hesessrei hesesseri hesesseir hesesisre hesesiser hesesirse
hesesires hesesiers hesesiesr hesesrise hesesries hesesrsie hesesrsei hesesresi hesesreis heseseirs heseseisr
heseseris hesesersi hesesesri hesesesir hessesier hessesire hesseseir hesseseri hessesrei hessesrie hesseiser
hesseisre hesseiesr hesseiers hesseires hesseirse hesseeisr hesseeirs hesseesir hesseesri hesseersi hesseeris
hesseries hesserise hessereis hesseresi hessersei hessersie hessseier hessseire hessseeir hessseeri hessserei
hessserie hesssieer hesssiere hesssieer hesssiere hesssiree hesssiree hessseier hessseire hessseeir hessseeri
hessserei hessserie hesssriee hesssriee hesssreie hesssreei hesssreei hesssreie hessiseer hessisere hessiseer
hessisere hessisree hessisree hessieser hessiesre hessieesr hessieers hessieres hessierse hessieesr hessieers
hessieser hessiesre hessierse hessieres hessirees hessirese hessirees hessirese hessirsee hessirsee hessesier
hessesire hesseseir hesseseri hessesrei hessesrie hesseiser hesseisre hesseiesr hesseiers hesseires hesseirse
hesseeisr hesseeirs hesseesir hesseesri hesseersi hesseeris hesseries hesserise hessereis hesseresi hessersei
hessersie hessrsiee hessrsiee hessrseie hessrseei hessrseei hessrseie hessrisee hessrisee hessriese hessriees
hessriees hessriese hessreise hessreies hessresie hessresei hessreesi hessreeis hessreies hessreise hessreeis
hessreesi hessresei hessresie heeressis heeresssi heeresiss heeresiss heeressis heeresssi heeressis heeresssi
heeresiss heeresiss heeressis heeresssi heereisss heereisss heereisss heereisss heereisss heereisss heeressis
heeresssi heeresiss heeresiss heeressis heeresssi heersesis heersessi heerseiss heerseiss heersesis heersessi
heersseis heerssesi heerssies heerssise heersssie heersssei heersises heersisse heersiess heersiess heersises
heersisse heersssie heersssei heerssise heerssies heersseis heerssesi heersseis heerssesi heerssies heerssise
heersssie heersssei heersesis heersessi heerseiss heerseiss heersesis heersessi heersiess heersiess heersises
heersisse heersisse heersises heersseis heerssesi heerssies heerssise heersssie heersssei heerisses heerissse
heerisess heerisess heerisses heerissse heerisses heerissse heerisess heerisess heerisses heerissse heeriesss
heeriesss heeriesss heeriesss heeriesss heeriesss heerisses heerissse heerisess heerisess heerisses heerissse
heersssie heersssei heerssise heerssies heersseis heerssesi heersssie heersssei heerssise heerssies heersseis
heerssesi heersisse heersises heersisse heersises heersiess heersiess heersesis heersessi heerseiss heerseiss
heersesis heersessi heeerssis heeersssi heeersiss heeersiss heeerssis heeersssi heeerssis heeersssi heeersiss
heeersiss heeerssis heeersssi heeerisss heeerisss heeerisss heeerisss heeerisss heeerisss heeerssis heeersssi
heeersiss heeersiss heeerssis heeersssi heeesrsis heeesrssi heeesriss heeesriss heeesrsis heeesrssi heeessris
heeessrsi heeessirs heeessisr heeesssir heeesssri heeesisrs heeesissr heeesirss heeesirss heeesisrs heeesissr
heeesssir heeesssri heeessisr heeessirs heeessris heeessrsi heeessris heeessrsi heeessirs heeessisr heeesssir
heeesssri heeesrsis heeesrssi heeesriss heeesriss heeesrsis heeesrssi heeesirss heeesirss heeesisrs heeesissr
heeesissr heeesisrs heeessris heeessrsi heeessirs heeessisr heeesssir heeesssri heeeissrs heeeisssr heeeisrss
heeeisrss heeeissrs heeeisssr heeeissrs heeeisssr heeeisrss heeeisrss heeeissrs heeeisssr heeeirsss heeeirsss
heeeirsss heeeirsss heeeirsss heeeirsss heeeissrs heeeisssr heeeisrss heeeisrss heeeissrs heeeisssr heeesssir
heeesssri heeessisr heeessirs heeessris heeessrsi heeesssir heeesssri heeessisr heeessirs heeessris heeessrsi
heeesissr heeesisrs heeesissr heeesisrs heeesirss heeesirss heeesrsis heeesrssi heeesriss heeesriss heeesrsis
heeesrssi heesersis heeserssi heeseriss heeseriss heesersis heeserssi heesesris heesesrsi heesesirs heesesisr
heesessir heesessri heeseisrs heeseissr heeseirss heeseirss heeseisrs heeseissr heesessir heesessri heesesisr
heesesirs heesesris heesesrsi heesresis heesressi heesreiss heesreiss heesresis heesressi heesrseis heesrsesi
heesrsies heesrsise heesrssie heesrssei heesrises heesrisse heesriess heesriess heesrises heesrisse heesrssie
heesrssei heesrsise heesrsies heesrseis heesrsesi heessreis heessresi heessries heessrise heessrsie heessrsei
heesseris heessersi heesseirs heesseisr heessesir heessesri heessiers heessiesr heessires heessirse heessisre
heessiser heessseir heessseri heesssier heesssire heesssrie heesssrei heesirses heesirsse heesiress heesiress
heesirses heesirsse heesisres heesisrse heesisers heesisesr heesisser heesissre heesiesrs heesiessr heesierss
heesierss heesiesrs heesiessr heesisser heesissre heesisesr heesisers heesisres heesisrse heessrsie heessrsei
heessrise heessries heessreis heessresi heesssrie heesssrei heesssire heesssier heessseir heessseri heessisre
heessiser heessirse heessires heessiers heessiesr heessesir heessesri heesseisr heesseirs heesseris heessersi
heesesris heesesrsi heesesirs heesesisr heesessir heesessri heesersis heeserssi heeseriss heeseriss heesersis
heeserssi heeseirss heeseirss heeseisrs heeseissr heeseissr heeseisrs heesesris heesesrsi heesesirs heesesisr
heesessir heesessri heesseris heessersi heesseirs heesseisr heessesir heessesri heessreis heessresi heessries
heessrise heessrsie heessrsei heessires heessirse heessiers heessiesr heessiser heessisre heesssrie heesssrei
heesssire heesssier heessseir heessseri heesrseis heesrsesi heesrsies heesrsise heesrssie heesrssei heesresis
heesressi heesreiss heesreiss heesresis heesressi heesriess heesriess heesrises heesrisse heesrisse heesrises
heesrseis heesrsesi heesrsies heesrsise heesrssie heesrssei heesisres heesisrse heesisers heesisesr heesisser
heesissre heesirses heesirsse heesiress heesiress heesirses heesirsse heesierss heesierss heesiesrs heesiessr
heesiessr heesiesrs heesisres heesisrse heesisers heesisesr heesisser heesissre heesssrie heesssrei heesssire
heesssier heessseir heessseri heessrsie heessrsei heessrise heessries heessreis heessresi heessirse heessires
heessisre heessiser heessiesr heessiers heesseris heessersi heesseirs heesseisr heessesir heessesri heeiessrs
heeiesssr heeiesrss heeiesrss heeiessrs heeiesssr heeiessrs heeiesssr heeiesrss heeiesrss heeiessrs heeiesssr
heeiersss heeiersss heeiersss heeiersss heeiersss heeiersss heeiessrs heeiesssr heeiesrss heeiesrss heeiessrs
heeiesssr heeisesrs heeisessr heeiserss heeiserss heeisesrs heeisessr heeissers heeissesr heeissres heeissrse
heeisssre heeissser heeisrses heeisrsse heeisress heeisress heeisrses heeisrsse heeisssre heeissser heeissrse
heeissres heeissers heeissesr heeissers heeissesr heeissres heeissrse heeisssre heeissser heeisesrs heeisessr
heeiserss heeiserss heeisesrs heeisessr heeisress heeisress heeisrses heeisrsse heeisrsse heeisrses heeissers
heeissesr heeissres heeissrse heeisssre heeissser heeirsses heeirssse heeirsess heeirsess heeirsses heeirssse
heeirsses heeirssse heeirsess heeirsess heeirsses heeirssse heeiresss heeiresss heeiresss heeiresss heeiresss
heeiresss heeirsses heeirssse heeirsess heeirsess heeirsses heeirssse heeisssre heeissser heeissrse heeissres
heeissers heeissesr heeisssre heeissser heeissrse heeissres heeissers heeissesr heeisrsse heeisrses heeisrsse
heeisrses heeisress heeisress heeisesrs heeisessr heeiserss heeiserss heeisesrs heeisessr heesessir heesessri
heesesisr heesesirs heesesris heesesrsi heesessir heesessri heesesisr heesesirs heesesris heesesrsi heeseissr
heeseisrs heeseissr heeseisrs heeseirss heeseirss heesersis heeserssi heeseriss heeseriss heesersis heeserssi
heessesir heessesri heesseisr heesseirs heesseris heessersi heessseir heessseri heesssier heesssire heesssrie
heesssrei heessiser heessisre heessiesr heessiers heessires heessirse heessrsie heessrsei heessrise heessries
heessreis heessresi heessseir heessseri heesssier heesssire heesssrie heesssrei heessesir heessesri heesseisr
heesseirs heesseris heessersi heessiesr heessiers heessiser heessisre heessirse heessires heessreis heessresi
heessries heessrise heessrsie heessrsei heesisser heesissre heesisesr heesisers heesisres heesisrse heesisser
heesissre heesisesr heesisers heesisres heesisrse heesiessr heesiesrs heesiessr heesiesrs heesierss heesierss
heesirses heesirsse heesiress heesiress heesirses heesirsse heesrssie heesrssei heesrsise heesrsies heesrseis
heesrsesi heesrssie heesrssei heesrsise heesrsies heesrseis heesrsesi heesrisse heesrises heesrisse heesrises
heesriess heesriess heesresis heesressi heesreiss heesreiss heesresis heesressi hesressei hesressie hesresesi
hesreseis hesresies hesresise hesressei hesressie hesresesi hesreseis hesresies hesresise hesreessi hesreesis
hesreessi hesreesis hesreeiss hesreeiss hesreises hesreisse hesreiess hesreiess hesreises hesreisse hesrsesei
hesrsesie hesrseesi hesrseeis hesrseies hesrseise hesrsseei hesrsseie hesrsseei hesrsseie hesrssiee hesrssiee
hesrsesei hesrsesie hesrseesi hesrseeis hesrseies hesrseise hesrsisee hesrsisee hesrsiese hesrsiees hesrsiees
hesrsiese hesrsseei hesrsseie hesrsseei hesrsseie hesrssiee hesrssiee hesrsesei hesrsesie hesrseesi hesrseeis
hesrseies hesrseise hesrseesi hesrseeis hesrsesei hesrsesie hesrseise hesrseies hesrsiees hesrsiese hesrsiees
hesrsiese hesrsisee hesrsisee hesressei hesressie hesresesi hesreseis hesresies hesresise hesressei hesressie
hesresesi hesreseis hesresies hesresise hesreessi hesreesis hesreessi hesreesis hesreeiss hesreeiss hesreises
hesreisse hesreiess hesreiess hesreises hesreisse hesrissee hesrissee hesrisese hesrisees hesrisees hesrisese
hesrissee hesrissee hesrisese hesrisees hesrisees hesrisese hesriesse hesrieses hesriesse hesrieses hesrieess
hesrieess hesrieses hesriesse hesrieess hesrieess hesrieses hesriesse heserssei heserssie hesersesi heserseis
hesersies hesersise heserssei heserssie hesersesi heserseis hesersies hesersise heseressi heseresis heseressi
heseresis hesereiss hesereiss heserises heserisse heseriess heseriess heserises heserisse hesesrsei hesesrsie
hesesresi hesesreis hesesries hesesrise hesessrei hesessrie hesesseri hesesseir hesessier hesessire hesesesri
hesesesir hesesersi heseseris heseseirs heseseisr hesesiser hesesisre hesesiesr hesesiers hesesires hesesirse
hesessrei hesessrie hesesseri hesesseir hesessier hesessire hesesrsei hesesrsie hesesresi hesesreis hesesries
hesesrise hesesersi heseseris hesesesri hesesesir heseseisr heseseirs hesesires hesesirse hesesiers hesesiesr
hesesiser hesesisre heseessri heseessir heseesrsi heseesris heseesirs heseesisr heseessri heseessir heseesrsi
heseesris heseesirs heseesisr heseerssi heseersis heseerssi heseersis heseeriss heseeriss heseeisrs heseeissr
heseeirss heseeirss heseeisrs heseeissr heseisser heseissre heseisesr heseisers heseisres heseisrse heseisser
heseissre heseisesr heseisers heseisres heseisrse heseiessr heseiesrs heseiessr heseiesrs heseierss heseierss
heseirses heseirsse heseiress heseiress heseirses heseirsse hessersei hessersie hesseresi hessereis hesseries
hesserise hessesrei hessesrie hesseseri hesseseir hessesier hessesire hesseesri hesseesir hesseersi hesseeris
hesseeirs hesseeisr hesseiser hesseisre hesseiesr hesseiers hesseires hesseirse hessresei hessresie hessreesi
hessreeis hessreies hessreise hessrseei hessrseie hessrseei hessrseie hessrsiee hessrsiee hessresei hessresie
hessreesi hessreeis hessreies hessreise hessrisee hessrisee hessriese hessriees hessriees hessriese hesssreei
hesssreie hesssreei hesssreie hesssriee hesssriee hessserei hessserie hessseeri hessseeir hessseier hessseire
hessseeri hessseeir hessserei hessserie hessseire hessseier hesssieer hesssiere hesssieer hesssiere hesssiree
hesssiree hessersei hessersie hesseresi hessereis hesseries hesserise hessesrei hessesrie hesseseri hesseseir
hessesier hessesire hesseesri hesseesir hesseersi hesseeris hesseeirs hesseeisr hesseiser hesseisre hesseiesr
hesseiers hesseires hesseirse hessirsee hessirsee hessirese hessirees hessirees hessirese hessisree hessisree
hessisere hessiseer hessiseer hessisere hessiesre hessieser hessierse hessieres hessieers hessieesr hessieser
hessiesre hessieesr hessieers hessieres hessierse hessesrei hessesrie hesseseri hesseseir hessesier hessesire
hessersei hessersie hesseresi hessereis hesseries hesserise hesseersi hesseeris hesseesri hesseesir hesseeisr
hesseeirs hesseires hesseirse hesseiers hesseiesr hesseiser hesseisre hessserei hessserie hessseeri hessseeir
hessseier hessseire hesssreei hesssreie hesssreei hesssreie hesssriee hesssriee hessserei hessserie hessseeri
hessseeir hessseier hessseire hesssiree hesssiree hesssiere hesssieer hesssieer hesssiere hessrseei hessrseie
hessrseei hessrseie hessrsiee hessrsiee hessresei hessresie hessreesi hessreeis hessreies hessreise hessreesi
hessreeis hessresei hessresie hessreise hessreies hessriees hessriese hessriees hessriese hessrisee hessrisee
hessesrei hessesrie hesseseri hesseseir hessesier hessesire hessersei hessersie hesseresi hessereis hesseries
hesserise hesseersi hesseeris hesseesri hesseesir hesseeisr hesseeirs hesseires hesseirse hesseiers hesseiesr
hesseiser hesseisre hessisree hessisree hessisere hessiseer hessiseer hessisere hessirsee hessirsee hessirese
hessirees hessirees hessirese hessierse hessieres hessiesre hessieser hessieesr hessieers hessieres hessierse
hessieers hessieesr hessieser hessiesre heseessri heseessir heseesrsi heseesris heseesirs heseesisr heseessri
heseessir heseesrsi heseesris heseesirs heseesisr heseerssi heseersis heseerssi heseersis heseeriss heseeriss
heseeisrs heseeissr heseeirss heseeirss heseeisrs heseeissr hesesesri hesesesir hesesersi heseseris heseseirs
heseseisr hesesseri hesesseir hesessrei hesessrie hesessire hesessier hesesrsei hesesrsie hesesresi hesesreis
hesesries hesesrise hesesisre hesesiser hesesirse hesesires hesesiers hesesiesr hesesseri hesesseir hesessrei
hesessrie hesessire hesessier hesesesri hesesesir hesesersi heseseris heseseirs heseseisr hesesresi hesesreis
hesesrsei hesesrsie hesesrise hesesries hesesiers hesesiesr hesesires hesesirse hesesisre hesesiser heserssei
heserssie hesersesi heserseis hesersies hesersise heserssei heserssie hesersesi heserseis hesersies hesersise
heseressi heseresis heseressi heseresis hesereiss hesereiss heserises heserisse heseriess heseriess heserises
heserisse heseissre heseisser heseisrse heseisres heseisers heseisesr heseissre heseisser heseisrse heseisres
heseisers heseisesr heseirsse heseirses heseirsse heseirses heseiress heseiress heseiesrs heseiessr heseierss
heseierss heseiesrs heseiessr hesiesser hesiessre hesiesesr hesiesers hesiesres hesiesrse hesiesser hesiessre
hesiesesr hesiesers hesiesres hesiesrse hesieessr hesieesrs hesieessr hesieesrs hesieerss hesieerss hesierses
hesiersse hesieress hesieress hesierses hesiersse hesiseser hesisesre hesiseesr hesiseers hesiseres hesiserse
hesisseer hesissere hesisseer hesissere hesissree hesissree hesiseser hesisesre hesiseesr hesiseers hesiseres
hesiserse hesisrsee hesisrsee hesisrese hesisrees hesisrees hesisrese hesisseer hesissere hesisseer hesissere
hesissree hesissree hesiseser hesisesre hesiseesr hesiseers hesiseres hesiserse hesiseesr hesiseers hesiseser
hesisesre hesiserse hesiseres hesisrees hesisrese hesisrees hesisrese hesisrsee hesisrsee hesiesser hesiessre
hesiesesr hesiesers hesiesres hesiesrse hesiesser hesiessre hesiesesr hesiesers hesiesres hesiesrse hesieessr
hesieesrs hesieessr hesieesrs hesieerss hesieerss hesierses hesiersse hesieress hesieress hesierses hesiersse
hesirssee hesirssee hesirsese hesirsees hesirsees hesirsese hesirssee hesirssee hesirsese hesirsees hesirsees
hesirsese hesiresse hesireses hesiresse hesireses hesireess hesireess hesireses hesiresse hesireess hesireess
hesireses hesiresse

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us