easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

retems

consensus

dialysis

grassiness

concutit

catanese

neurotomical

meddlecome

bewidow

googy

hyperpyretic

transferatur

portwashington

mcquown

natchezan

dispensability

loudenslager

respexeramusque


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: guncotton
cipher variations:
hvodpuupo iwpeqvvqp jxqfrwwrq kyrgsxxsr lzshtyyts
matiuzzut nbujvaavu ocvkwbbwv pdwlxccxw qexmyddyx
rfynzeezy sgzoaffaz thapbggba uibqchhcb vjcrdiidc
wkdsejjed xletfkkfe ymfugllgf zngvhmmhg aohwinnih
bpixjooji cqjykppkj drkzlqqlk eslamrrml ftmbnssnm

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: guncotton
Cipher: tfmxlgglm

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: guncotton
Cipher: AABBA BAABB ABBAA AAABA ABBAB BAABA BAABA ABBAB ABBAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: guncotton
cipher variations:
hvodpuupotjohrggrofxoltsstorlopveevodzotxqqxopnoxzcczonpofdaadozdojfmmfo
lronhyyhoxforjkkjojtovlwwlovhozniinoiwpeqvvqpukpishhspgypmuttupsmpqwffwp
eapuyrrypqopyaddapoqpgebbepaepkgnngpmspoizzipygpskllkpkupwmxxmpwipaojjop
jxqfrwwrqvlqjtiitqhzqnvuuvqtnqrxggxqfbqvzsszqrpqzbeebqprqhfccfqbfqlhoohq
ntqpjaajqzhqtlmmlqlvqxnyynqxjqbpkkpqkyrgsxxsrwmrkujjuriarowvvwruorsyhhyr
gcrwattarsqracffcrqsrigddgrcgrmippirourqkbbkrairumnnmrmwryozzorykrcqllqr
lzshtyytsxnslvkkvsjbspxwwxsvpstziizshdsxbuubstrsbdggdsrtsjheehsdhsnjqqjs
pvsrlcclsbjsvnoonsnxszpaapszlsdrmmrsmatiuzzutyotmwllwtkctqyxxytwqtuajjat
ietycvvctustcehhetsutkiffiteitokrrktqwtsmddmtcktwoppotoytaqbbqtamtesnnst
nbujvaavuzpunxmmxuldurzyyzuxruvbkkbujfuzdwwduvtudfiifutvuljggjufjuplsslu
rxutneenudluxpqqpupzubrccrubnuftootuocvkwbbwvaqvoynnyvmevsazzavysvwcllcv
kgvaexxevwuvegjjgvuwvmkhhkvgkvqmttmvsyvuoffovemvyqrrqvqavcsddsvcovguppuv
pdwlxccxwbrwpzoozwnfwtbaabwztwxdmmdwlhwbfyyfwxvwfhkkhwvxwnliilwhlwrnuunw
tzwvpggpwfnwzrssrwrbwdteetwdpwhvqqvwqexmyddyxcsxqappaxogxucbbcxauxyennex
mixcgzzgxywxgillixwyxomjjmximxsovvoxuaxwqhhqxgoxasttsxscxeuffuxeqxiwrrwx
rfynzeezydtyrbqqbyphyvdccdybvyzfoofynjydhaahyzxyhjmmjyxzypnkknyjnytpwwpy
vbyxriiryhpybtuutytdyfvggvyfryjxssxysgzoaffazeuzscrrczqizweddezcwzagppgz
okzeibbizayziknnkzyazqollozkozuqxxqzwczysjjsziqzcuvvuzuezgwhhwzgszkyttyz
thapbggbafvatdssdarjaxfeefadxabhqqhaplafjccjabzajloolazbarpmmpalpavryyra
xdaztkktajradvwwvavfahxiixahtalzuuzauibqchhcbgwbuettebskbygffgbeybcirrib
qmbgkddkbcabkmppmbacbsqnnqbmqbwszzsbyebaullubksbewxxwbwgbiyjjybiubmavvab
vjcrdiidchxcvfuufctlczhgghcfzcdjssjcrnchleelcdbclnqqncbdctroorcnrcxtaatc
zfcbvmmvcltcfxyyxcxhcjzkkzcjvcnbwwbcwkdsejjediydwgvvgdumdaihhidgadekttkd
sodimffmdecdmorrodcedusppsdosdyubbudagdcwnnwdmudgyzzydyidkalladkwdocxxcd
xletfkkfejzexhwwhevnebjiijehbefluuletpejnggnefdenpsspedfevtqqteptezvccve
bhedxooxenvehzaazezjelbmmbelxepdyydeymfugllgfkafyixxifwofckjjkficfgmvvmf
uqfkohhofgefoqttqfegfwurrufqufawddwfcifeyppyfowfiabbafakfmcnncfmyfqezzef
zngvhmmhglbgzjyyjgxpgdlkklgjdghnwwngvrglpiipghfgpruurgfhgxvssvgrvgbxeexg
djgfzqqzgpxgjbccbgblgndoodgnzgrfaafgaohwinnihmchakzzkhyqhemllmhkehioxxoh
wshmqjjqhighqsvvshgihywttwhswhcyffyhekhgarrahqyhkcddchcmhoeppehoahsgbbgh
bpixjoojindiblaalizrifnmmnilfijpyypixtinrkkrijhirtwwtihjizxuuxitxidzggzi
flihbssbirzildeedidnipfqqfipbithcchicqjykppkjoejcmbbmjasjgonnojmgjkqzzqj
yujosllsjkijsuxxujikjayvvyjuyjeahhajgmjicttcjsajmeffejeojqgrrgjqcjuiddij
drkzlqqlkpfkdnccnkbtkhpoopknhklraarkzvkptmmtkljktvyyvkjlkbzwwzkvzkfbiibk
hnkjduudktbknfggfkfpkrhsshkrdkvjeejkeslamrrmlqgleoddolculiqppqloilmsbbsl
awlqunnulmkluwzzwlkmlcaxxalwalgcjjcliolkevvelucloghhglgqlsittilselwkffkl
ftmbnssnmrhmfpeepmdvmjrqqrmpjmntcctmbxmrvoovmnlmvxaaxmlnmdbyybmxbmhdkkdm
jpmlfwwfmvdmphiihmhrmtjuujmtfmxlgglmguncottonsingqffqnewnksrrsnqknouddun
cynswppwnomnwybbynmoneczzcnycniellenkqnmgxxgnwenqijjinisnukvvknugnymhhmn

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: guncotton
Cipher: thapbggba

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: guncotton
Cipher: 225433314344444333

Extended Methods:
Method #1

Plaintext: guncotton
method variations:
mzshtyytsrexnyddyxwkcsdiidcbphxiooih

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
g u n c o t t o n 
2 5 3 3 4 4 4 4 3 
2 4 3 1 3 4 4 3 3 
They are then read out in rows:
253344443243134433
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: guncotton
Cipher: wnttholtn

Read more ...
Method #3

Plaintext: guncotton
method variations:
wonqsttnh onqsttnhw nqsttnhwo
qsttnhwon sttnhwonq ttnhwonqs
tnhwonqst nhwonqstt hwonqsttn

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: guncotton

first 5040 cipher variations(362880 total)
guncotton guncottno guncototn guncotont guncotnot guncotnto guncotton guncottno guncototn guncotont guncotnot
guncotnto guncoottn guncootnt guncoottn guncootnt guncoontt guncoontt guncontot guncontto gunconott gunconott
guncontot guncontto gunctoton gunctotno gunctootn gunctoont gunctonot gunctonto guncttoon guncttono guncttoon
guncttono guncttnoo guncttnoo gunctoton gunctotno gunctootn gunctoont gunctonot gunctonto gunctntoo gunctntoo
gunctnoto gunctnoot gunctnoot gunctnoto guncttoon guncttono guncttoon guncttono guncttnoo guncttnoo gunctoton
gunctotno gunctootn gunctoont gunctonot gunctonto gunctootn gunctoont gunctoton gunctotno gunctonto gunctonot
gunctnoot gunctnoto gunctnoot gunctnoto gunctntoo gunctntoo guncotton guncottno guncototn guncotont guncotnot
guncotnto guncotton guncottno guncototn guncotont guncotnot guncotnto guncoottn guncootnt guncoottn guncootnt
guncoontt guncoontt guncontot guncontto gunconott gunconott guncontot guncontto guncnttoo guncnttoo guncntoto
guncntoot guncntoot guncntoto guncnttoo guncnttoo guncntoto guncntoot guncntoot guncntoto guncnotto guncnotot
guncnotto guncnotot guncnoott guncnoott guncnotot guncnotto guncnoott guncnoott guncnotot guncnotto gunoctton
gunocttno gunoctotn gunoctont gunoctnot gunoctnto gunoctton gunocttno gunoctotn gunoctont gunoctnot gunoctnto
gunocottn gunocotnt gunocottn gunocotnt gunocontt gunocontt gunocntot gunocntto gunocnott gunocnott gunocntot
gunocntto gunotcton gunotctno gunotcotn gunotcont gunotcnot gunotcnto gunottcon gunottcno gunottocn gunottonc
gunottnoc gunottnco gunototcn gunototnc gunotoctn gunotocnt gunotonct gunotontc gunotntoc gunotntco gunotnotc
gunotnoct gunotncot gunotncto gunottcon gunottcno gunottocn gunottonc gunottnoc gunottnco gunotcton gunotctno
gunotcotn gunotcont gunotcnot gunotcnto gunotoctn gunotocnt gunototcn gunototnc gunotontc gunotonct gunotncot
gunotncto gunotnoct gunotnotc gunotntoc gunotntco gunoottcn gunoottnc gunootctn gunootcnt gunootnct gunootntc
gunoottcn gunoottnc gunootctn gunootcnt gunootnct gunootntc gunoocttn gunooctnt gunoocttn gunooctnt gunoocntt
gunoocntt gunoontct gunoonttc gunoonctt gunoonctt gunoontct gunoonttc gunonttoc gunonttco gunontotc gunontoct
gunontcot gunontcto gunonttoc gunonttco gunontotc gunontoct gunontcot gunontcto gunonottc gunonotct gunonottc
gunonotct gunonoctt gunonoctt gunonctot gunonctto gunoncott gunoncott gunonctot gunonctto guntocton guntoctno
guntocotn guntocont guntocnot guntocnto guntotcon guntotcno guntotocn guntotonc guntotnoc guntotnco guntootcn
guntootnc guntooctn guntoocnt guntoonct guntoontc guntontoc guntontco guntonotc guntonoct guntoncot guntoncto
guntcoton guntcotno guntcootn guntcoont guntconot guntconto guntctoon guntctono guntctoon guntctono guntctnoo
guntctnoo guntcoton guntcotno guntcootn guntcoont guntconot guntconto guntcntoo guntcntoo guntcnoto guntcnoot
guntcnoot guntcnoto gunttcoon gunttcono gunttcoon gunttcono gunttcnoo gunttcnoo gunttocon gunttocno gunttoocn
gunttoonc gunttonoc gunttonco gunttoocn gunttoonc gunttocon gunttocno gunttonco gunttonoc gunttnooc gunttnoco
gunttnooc gunttnoco gunttncoo gunttncoo guntocton guntoctno guntocotn guntocont guntocnot guntocnto guntotcon
guntotcno guntotocn guntotonc guntotnoc guntotnco guntootcn guntootnc guntooctn guntoocnt guntoonct guntoontc
guntontoc guntontco guntonotc guntonoct guntoncot guntoncto guntnctoo guntnctoo guntncoto guntncoot guntncoot
guntncoto guntntcoo guntntcoo guntntoco guntntooc guntntooc guntntoco guntnotco guntnotoc guntnocto guntnocot
guntnooct guntnootc guntnotoc guntnotco guntnootc guntnooct guntnocot guntnocto guntotcon guntotcno guntotocn
guntotonc guntotnoc guntotnco guntocton guntoctno guntocotn guntocont guntocnot guntocnto guntooctn guntoocnt
guntootcn guntootnc guntoontc guntoonct guntoncot guntoncto guntonoct guntonotc guntontoc guntontco gunttocon
gunttocno gunttoocn gunttoonc gunttonoc gunttonco gunttcoon gunttcono gunttcoon gunttcono gunttcnoo gunttcnoo
gunttocon gunttocno gunttoocn gunttoonc gunttonoc gunttonco gunttncoo gunttncoo gunttnoco gunttnooc gunttnooc
gunttnoco guntctoon guntctono guntctoon guntctono guntctnoo guntctnoo guntcoton guntcotno guntcootn guntcoont
guntconot guntconto guntcootn guntcoont guntcoton guntcotno guntconto guntconot guntcnoot guntcnoto guntcnoot
guntcnoto guntcntoo guntcntoo guntotcon guntotcno guntotocn guntotonc guntotnoc guntotnco guntocton guntoctno
guntocotn guntocont guntocnot guntocnto guntooctn guntoocnt guntootcn guntootnc guntoontc guntoonct guntoncot
guntoncto guntonoct guntonotc guntontoc guntontco guntntcoo guntntcoo guntntoco guntntooc guntntooc guntntoco
guntnctoo guntnctoo guntncoto guntncoot guntncoot guntncoto guntnocto guntnocot guntnotco guntnotoc guntnootc
guntnooct guntnocot guntnocto guntnooct guntnootc guntnotoc guntnotco gunoottcn gunoottnc gunootctn gunootcnt
gunootnct gunootntc gunoottcn gunoottnc gunootctn gunootcnt gunootnct gunootntc gunoocttn gunooctnt gunoocttn
gunooctnt gunoocntt gunoocntt gunoontct gunoonttc gunoonctt gunoonctt gunoontct gunoonttc gunototcn gunototnc
gunotoctn gunotocnt gunotonct gunotontc gunottocn gunottonc gunottcon gunottcno gunottnco gunottnoc gunotcton
gunotctno gunotcotn gunotcont gunotcnot gunotcnto gunotntco gunotntoc gunotncto gunotncot gunotnoct gunotnotc
gunottocn gunottonc gunottcon gunottcno gunottnco gunottnoc gunototcn gunototnc gunotoctn gunotocnt gunotonct
gunotontc gunotcotn gunotcont gunotcton gunotctno gunotcnto gunotcnot gunotnoct gunotnotc gunotncot gunotncto
gunotntco gunotntoc gunoctton gunocttno gunoctotn gunoctont gunoctnot gunoctnto gunoctton gunocttno gunoctotn
gunoctont gunoctnot gunoctnto gunocottn gunocotnt gunocottn gunocotnt gunocontt gunocontt gunocntot gunocntto
gunocnott gunocnott gunocntot gunocntto gunonttco gunonttoc gunontcto gunontcot gunontoct gunontotc gunonttco
gunonttoc gunontcto gunontcot gunontoct gunontotc gunonctto gunonctot gunonctto gunonctot gunoncott gunoncott
gunonotct gunonottc gunonoctt gunonoctt gunonotct gunonottc gunnottoc gunnottco gunnototc gunnotoct gunnotcot
gunnotcto gunnottoc gunnottco gunnototc gunnotoct gunnotcot gunnotcto gunnoottc gunnootct gunnoottc gunnootct
gunnooctt gunnooctt gunnoctot gunnoctto gunnocott gunnocott gunnoctot gunnoctto gunntotoc gunntotco gunntootc
gunntooct gunntocot gunntocto gunnttooc gunnttoco gunnttooc gunnttoco gunnttcoo gunnttcoo gunntotoc gunntotco
gunntootc gunntooct gunntocot gunntocto gunntctoo gunntctoo gunntcoto gunntcoot gunntcoot gunntcoto gunnttooc
gunnttoco gunnttooc gunnttoco gunnttcoo gunnttcoo gunntotoc gunntotco gunntootc gunntooct gunntocot gunntocto
gunntootc gunntooct gunntotoc gunntotco gunntocto gunntocot gunntcoot gunntcoto gunntcoot gunntcoto gunntctoo
gunntctoo gunnottoc gunnottco gunnototc gunnotoct gunnotcot gunnotcto gunnottoc gunnottco gunnototc gunnotoct
gunnotcot gunnotcto gunnoottc gunnootct gunnoottc gunnootct gunnooctt gunnooctt gunnoctot gunnoctto gunnocott
gunnocott gunnoctot gunnoctto gunncttoo gunncttoo gunnctoto gunnctoot gunnctoot gunnctoto gunncttoo gunncttoo
gunnctoto gunnctoot gunnctoot gunnctoto gunncotto gunncotot gunncotto gunncotot gunncoott gunncoott gunncotot
gunncotto gunncoott gunncoott gunncotot gunncotto gucnotton gucnottno gucnototn gucnotont gucnotnot gucnotnto
gucnotton gucnottno gucnototn gucnotont gucnotnot gucnotnto gucnoottn gucnootnt gucnoottn gucnootnt gucnoontt
gucnoontt gucnontot gucnontto gucnonott gucnonott gucnontot gucnontto gucntoton gucntotno gucntootn gucntoont
gucntonot gucntonto gucnttoon gucnttono gucnttoon gucnttono gucnttnoo gucnttnoo gucntoton gucntotno gucntootn
gucntoont gucntonot gucntonto gucntntoo gucntntoo gucntnoto gucntnoot gucntnoot gucntnoto gucnttoon gucnttono
gucnttoon gucnttono gucnttnoo gucnttnoo gucntoton gucntotno gucntootn gucntoont gucntonot gucntonto gucntootn
gucntoont gucntoton gucntotno gucntonto gucntonot gucntnoot gucntnoto gucntnoot gucntnoto gucntntoo gucntntoo
gucnotton gucnottno gucnototn gucnotont gucnotnot gucnotnto gucnotton gucnottno gucnototn gucnotont gucnotnot
gucnotnto gucnoottn gucnootnt gucnoottn gucnootnt gucnoontt gucnoontt gucnontot gucnontto gucnonott gucnonott
gucnontot gucnontto gucnnttoo gucnnttoo gucnntoto gucnntoot gucnntoot gucnntoto gucnnttoo gucnnttoo gucnntoto
gucnntoot gucnntoot gucnntoto gucnnotto gucnnotot gucnnotto gucnnotot gucnnoott gucnnoott gucnnotot gucnnotto
gucnnoott gucnnoott gucnnotot gucnnotto gucontton guconttno gucontotn gucontont gucontnot gucontnto gucontton
guconttno gucontotn gucontont gucontnot gucontnto guconottn guconotnt guconottn guconotnt guconontt guconontt
guconntot guconntto guconnott guconnott guconntot guconntto gucotnton gucotntno gucotnotn gucotnont gucotnnot
gucotnnto gucottnon gucottnno gucottonn gucottonn gucottnon gucottnno gucototnn gucototnn gucotontn gucotonnt
gucotonnt gucotontn gucotnton gucotntno gucotnotn gucotnont gucotnnot gucotnnto gucottnon gucottnno gucottonn
gucottonn gucottnon gucottnno gucotnton gucotntno gucotnotn gucotnont gucotnnot gucotnnto gucotontn gucotonnt
gucototnn gucototnn gucotontn gucotonnt gucotnnot gucotnnto gucotnont gucotnotn gucotnton gucotntno gucoottnn
gucoottnn gucootntn gucootnnt gucootnnt gucootntn gucoottnn gucoottnn gucootntn gucootnnt gucootnnt gucootntn
gucoonttn gucoontnt gucoonttn gucoontnt gucoonntt gucoonntt gucoontnt gucoonttn gucoonntt gucoonntt gucoontnt
gucoonttn gucontton guconttno gucontotn gucontont gucontnot gucontnto gucontton guconttno gucontotn gucontont
gucontnot gucontnto guconottn guconotnt guconottn guconotnt guconontt guconontt guconntot guconntto guconnott
guconnott guconntot guconntto guctonton guctontno guctonotn guctonont guctonnot guctonnto guctotnon guctotnno
guctotonn guctotonn guctotnon guctotnno guctootnn guctootnn guctoontn guctoonnt guctoonnt guctoontn guctonton
guctontno guctonotn guctonont guctonnot guctonnto guctnoton guctnotno guctnootn guctnoont guctnonot guctnonto
guctntoon guctntono guctntoon guctntono guctntnoo guctntnoo guctnoton guctnotno guctnootn guctnoont guctnonot
guctnonto guctnntoo guctnntoo guctnnoto guctnnoot guctnnoot guctnnoto gucttnoon gucttnono gucttnoon gucttnono
gucttnnoo gucttnnoo gucttonon gucttonno gucttoonn gucttoonn gucttonon gucttonno gucttoonn gucttoonn gucttonon
gucttonno gucttonno gucttonon gucttnoon gucttnono gucttnoon gucttnono gucttnnoo gucttnnoo guctonton guctontno
guctonotn guctonont guctonnot guctonnto guctotnon guctotnno guctotonn guctotonn guctotnon guctotnno guctootnn
guctootnn guctoontn guctoonnt guctoonnt guctoontn guctonton guctontno guctonotn guctonont guctonnot guctonnto
guctnntoo guctnntoo guctnnoto guctnnoot guctnnoot guctnnoto guctntnoo guctntnoo guctntono guctntoon guctntoon
guctntono guctnotno guctnoton guctnonto guctnonot guctnoont guctnootn guctnoton guctnotno guctnootn guctnoont
guctnonot guctnonto guctotnon guctotnno guctotonn guctotonn guctotnon guctotnno guctonton guctontno guctonotn
guctonont guctonnot guctonnto guctoontn guctoonnt guctootnn guctootnn guctoontn guctoonnt guctonnot guctonnto
guctonont guctonotn guctonton guctontno gucttonon gucttonno gucttoonn gucttoonn gucttonon gucttonno gucttnoon
gucttnono gucttnoon gucttnono gucttnnoo gucttnnoo gucttonon gucttonno gucttoonn gucttoonn gucttonon gucttonno
gucttnnoo gucttnnoo gucttnono gucttnoon gucttnoon gucttnono guctntoon guctntono guctntoon guctntono guctntnoo
guctntnoo guctnoton guctnotno guctnootn guctnoont guctnonot guctnonto guctnootn guctnoont guctnoton guctnotno
guctnonto guctnonot guctnnoot guctnnoto guctnnoot guctnnoto guctnntoo guctnntoo guctotnon guctotnno guctotonn
guctotonn guctotnon guctotnno guctonton guctontno guctonotn guctonont guctonnot guctonnto guctoontn guctoonnt
guctootnn guctootnn guctoontn guctoonnt guctonnot guctonnto guctonont guctonotn guctonton guctontno guctntnoo
guctntnoo guctntono guctntoon guctntoon guctntono guctnntoo guctnntoo guctnnoto guctnnoot guctnnoot guctnnoto
guctnonto guctnonot guctnotno guctnoton guctnootn guctnoont guctnonot guctnonto guctnoont guctnootn guctnoton
guctnotno gucoottnn gucoottnn gucootntn gucootnnt gucootnnt gucootntn gucoottnn gucoottnn gucootntn gucootnnt
gucootnnt gucootntn gucoonttn gucoontnt gucoonttn gucoontnt gucoonntt gucoonntt gucoontnt gucoonttn gucoonntt
gucoonntt gucoontnt gucoonttn gucototnn gucototnn gucotontn gucotonnt gucotonnt gucotontn gucottonn gucottonn
gucottnon gucottnno gucottnno gucottnon gucotnton gucotntno gucotnotn gucotnont gucotnnot gucotnnto gucotntno
gucotnton gucotnnto gucotnnot gucotnont gucotnotn gucottonn gucottonn gucottnon gucottnno gucottnno gucottnon
gucototnn gucototnn gucotontn gucotonnt gucotonnt gucotontn gucotnotn gucotnont gucotnton gucotntno gucotnnto
gucotnnot gucotnont gucotnotn gucotnnot gucotnnto gucotntno gucotnton gucontton guconttno gucontotn gucontont
gucontnot gucontnto gucontton guconttno gucontotn gucontont gucontnot gucontnto guconottn guconotnt guconottn
guconotnt guconontt guconontt guconntot guconntto guconnott guconnott guconntot guconntto guconttno gucontton
gucontnto gucontnot gucontont gucontotn guconttno gucontton gucontnto gucontnot gucontont gucontotn guconntto
guconntot guconntto guconntot guconnott guconnott guconotnt guconottn guconontt guconontt guconotnt guconottn
gucnotton gucnottno gucnototn gucnotont gucnotnot gucnotnto gucnotton gucnottno gucnototn gucnotont gucnotnot
gucnotnto gucnoottn gucnootnt gucnoottn gucnootnt gucnoontt gucnoontt gucnontot gucnontto gucnonott gucnonott
gucnontot gucnontto gucntoton gucntotno gucntootn gucntoont gucntonot gucntonto gucnttoon gucnttono gucnttoon
gucnttono gucnttnoo gucnttnoo gucntoton gucntotno gucntootn gucntoont gucntonot gucntonto gucntntoo gucntntoo
gucntnoto gucntnoot gucntnoot gucntnoto gucnttoon gucnttono gucnttoon gucnttono gucnttnoo gucnttnoo gucntoton
gucntotno gucntootn gucntoont gucntonot gucntonto gucntootn gucntoont gucntoton gucntotno gucntonto gucntonot
gucntnoot gucntnoto gucntnoot gucntnoto gucntntoo gucntntoo gucnotton gucnottno gucnototn gucnotont gucnotnot
gucnotnto gucnotton gucnottno gucnototn gucnotont gucnotnot gucnotnto gucnoottn gucnootnt gucnoottn gucnootnt
gucnoontt gucnoontt gucnontot gucnontto gucnonott gucnonott gucnontot gucnontto gucnnttoo gucnnttoo gucnntoto
gucnntoot gucnntoot gucnntoto gucnnttoo gucnnttoo gucnntoto gucnntoot gucnntoot gucnntoto gucnnotto gucnnotot
gucnnotto gucnnotot gucnnoott gucnnoott gucnnotot gucnnotto gucnnoott gucnnoott gucnnotot gucnnotto guocntton
guocnttno guocntotn guocntont guocntnot guocntnto guocntton guocnttno guocntotn guocntont guocntnot guocntnto
guocnottn guocnotnt guocnottn guocnotnt guocnontt guocnontt guocnntot guocnntto guocnnott guocnnott guocnntot
guocnntto guoctnton guoctntno guoctnotn guoctnont guoctnnot guoctnnto guocttnon guocttnno guocttonn guocttonn
guocttnon guocttnno guoctotnn guoctotnn guoctontn guoctonnt guoctonnt guoctontn guoctnton guoctntno guoctnotn
guoctnont guoctnnot guoctnnto guocttnon guocttnno guocttonn guocttonn guocttnon guocttnno guoctnton guoctntno
guoctnotn guoctnont guoctnnot guoctnnto guoctontn guoctonnt guoctotnn guoctotnn guoctontn guoctonnt guoctnnot
guoctnnto guoctnont guoctnotn guoctnton guoctntno guocottnn guocottnn guocotntn guocotnnt guocotnnt guocotntn
guocottnn guocottnn guocotntn guocotnnt guocotnnt guocotntn guoconttn guocontnt guoconttn guocontnt guoconntt
guoconntt guocontnt guoconttn guoconntt guoconntt guocontnt guoconttn guocntton guocnttno guocntotn guocntont
guocntnot guocntnto guocntton guocnttno guocntotn guocntont guocntnot guocntnto guocnottn guocnotnt guocnottn
guocnotnt guocnontt guocnontt guocnntot guocnntto guocnnott guocnnott guocnntot guocnntto guonctton guoncttno
guonctotn guonctont guonctnot guonctnto guonctton guoncttno guonctotn guonctont guonctnot guonctnto guoncottn
guoncotnt guoncottn guoncotnt guoncontt guoncontt guoncntot guoncntto guoncnott guoncnott guoncntot guoncntto
guontcton guontctno guontcotn guontcont guontcnot guontcnto guonttcon guonttcno guonttocn guonttonc guonttnoc
guonttnco guontotcn guontotnc guontoctn guontocnt guontonct guontontc guontntoc guontntco guontnotc guontnoct
guontncot guontncto guonttcon guonttcno guonttocn guonttonc guonttnoc guonttnco guontcton guontctno guontcotn
guontcont guontcnot guontcnto guontoctn guontocnt guontotcn guontotnc guontontc guontonct guontncot guontncto
guontnoct guontnotc guontntoc guontntco guonottcn guonottnc guonotctn guonotcnt guonotnct guonotntc guonottcn
guonottnc guonotctn guonotcnt guonotnct guonotntc guonocttn guonoctnt guonocttn guonoctnt guonocntt guonocntt
guonontct guononttc guononctt guononctt guonontct guononttc guonnttoc guonnttco guonntotc guonntoct guonntcot
guonntcto guonnttoc guonnttco guonntotc guonntoct guonntcot guonntcto guonnottc guonnotct guonnottc guonnotct
guonnoctt guonnoctt guonnctot guonnctto guonncott guonncott guonnctot guonnctto guotncton guotnctno guotncotn
guotncont guotncnot guotncnto guotntcon guotntcno guotntocn guotntonc guotntnoc guotntnco guotnotcn guotnotnc
guotnoctn guotnocnt guotnonct guotnontc guotnntoc guotnntco guotnnotc guotnnoct guotnncot guotnncto guotcnton
guotcntno guotcnotn guotcnont guotcnnot guotcnnto guotctnon guotctnno guotctonn guotctonn guotctnon guotctnno
guotcotnn guotcotnn guotcontn guotconnt guotconnt guotcontn guotcnton guotcntno guotcnotn guotcnont guotcnnot
guotcnnto guottcnon guottcnno guottconn guottconn guottcnon guottcnno guottncon guottncno guottnocn guottnonc
guottnnoc guottnnco guottoncn guottonnc guottocnn guottocnn guottoncn guottonnc guottnnoc guottnnco guottnonc
guottnocn guottncon guottncno guotoctnn guotoctnn guotocntn guotocnnt guotocnnt guotocntn guototcnn guototcnn
guototncn guototnnc guototnnc guototncn guotontcn guotontnc guotonctn guotoncnt guotonnct guotonntc guotontnc
guotontcn guotonntc guotonnct guotoncnt guotonctn guotncton guotnctno guotncotn guotncont guotncnot guotncnto
guotntcon guotntcno guotntocn guotntonc guotntnoc guotntnco guotnotcn guotnotnc guotnoctn guotnocnt guotnonct
guotnontc guotnntoc guotnntco guotnnotc guotnnoct guotnncot guotnncto guotntcon guotntcno guotntocn guotntonc
guotntnoc guotntnco guotncton guotnctno guotncotn guotncont guotncnot guotncnto guotnoctn guotnocnt guotnotcn
guotnotnc guotnontc guotnonct guotnncot guotnncto guotnnoct guotnnotc guotnntoc guotnntco guottncon guottncno
guottnocn guottnonc guottnnoc guottnnco guottcnon guottcnno guottconn guottconn guottcnon guottcnno guottocnn
guottocnn guottoncn guottonnc guottonnc guottoncn guottncon guottncno guottnocn guottnonc guottnnoc guottnnco
guotctnon guotctnno guotctonn guotctonn guotctnon guotctnno guotcnton guotcntno guotcnotn guotcnont guotcnnot
guotcnnto guotcontn guotconnt guotcotnn guotcotnn guotcontn guotconnt guotcnnot guotcnnto guotcnont guotcnotn
guotcnton guotcntno guototcnn guototcnn guototncn guototnnc guototnnc guototncn guotoctnn guotoctnn guotocntn
guotocnnt guotocnnt guotocntn guotonctn guotoncnt guotontcn guotontnc guotonntc guotonnct guotoncnt guotonctn
guotonnct guotonntc guotontnc guotontcn guotntcon guotntcno guotntocn guotntonc guotntnoc guotntnco guotncton
guotnctno guotncotn guotncont guotncnot guotncnto guotnoctn guotnocnt guotnotcn guotnotnc guotnontc guotnonct
guotnncot guotnncto guotnnoct guotnnotc guotnntoc guotnntco guoonttcn guoonttnc guoontctn guoontcnt guoontnct
guoontntc guoonttcn guoonttnc guoontctn guoontcnt guoontnct guoontntc guooncttn guoonctnt guooncttn guoonctnt
guooncntt guooncntt guoonntct guoonnttc guoonnctt guoonnctt guoonntct guoonnttc guootntcn guootntnc guootnctn
guootncnt guootnnct guootnntc guoottncn guoottnnc guoottcnn guoottcnn guoottncn guoottnnc guootctnn guootctnn
guootcntn guootcnnt guootcnnt guootcntn guootntcn guootntnc guootnctn guootncnt guootnnct guootnntc guoottncn
guoottnnc guoottcnn guoottcnn guoottncn guoottnnc guootntcn guootntnc guootnctn guootncnt guootnnct guootnntc
guootcntn guootcnnt guootctnn guootctnn guootcntn guootcnnt guootnnct guootnntc guootncnt guootnctn guootntcn
guootntnc guoocttnn guoocttnn guooctntn guooctnnt guooctnnt guooctntn guoocttnn guoocttnn guooctntn guooctnnt
guooctnnt guooctntn guoocnttn guoocntnt guoocnttn guoocntnt guoocnntt guoocnntt guoocntnt guoocnttn guoocnntt
guoocnntt guoocntnt guoocnttn guoonttcn guoonttnc guoontctn guoontcnt guoontnct guoontntc guoonttcn guoonttnc
guoontctn guoontcnt guoontnct guoontntc guooncttn guoonctnt guooncttn guoonctnt guooncntt guooncntt guoonntct
guoonnttc guoonnctt guoonnctt guoonntct guoonnttc guonnttoc guonnttco guonntotc guonntoct guonntcot guonntcto
guonnttoc guonnttco guonntotc guonntoct guonntcot guonntcto guonnottc guonnotct guonnottc guonnotct guonnoctt
guonnoctt guonnctot guonnctto guonncott guonncott guonnctot guonnctto guontntoc guontntco guontnotc guontnoct
guontncot guontncto guonttnoc guonttnco guonttonc guonttocn guonttcon guonttcno guontotnc guontotcn guontontc
guontonct guontocnt guontoctn guontcton guontctno guontcotn guontcont guontcnot guontcnto guonttnoc guonttnco
guonttonc guonttocn guonttcon guonttcno guontntoc guontntco guontnotc guontnoct guontncot guontncto guontontc
guontonct guontotnc guontotcn guontoctn guontocnt guontcnot guontcnto guontcont guontcotn guontcton guontctno
guonottnc guonottcn guonotntc guonotnct guonotcnt guonotctn guonottnc guonottcn guonotntc guonotnct guonotcnt
guonotctn guononttc guonontct guononttc guonontct guononctt guononctt guonoctnt guonocttn guonocntt guonocntt
guonoctnt guonocttn guonctton guoncttno guonctotn guonctont guonctnot guonctnto guonctton guoncttno guonctotn
guonctont guonctnot guonctnto guoncottn guoncotnt guoncottn guoncotnt guoncontt guoncontt guoncntot guoncntto
guoncnott guoncnott guoncntot guoncntto gutconton gutcontno gutconotn gutconont gutconnot gutconnto gutcotnon
gutcotnno gutcotonn gutcotonn gutcotnon gutcotnno gutcootnn gutcootnn gutcoontn gutcoonnt gutcoonnt gutcoontn
gutconton gutcontno gutconotn gutconont gutconnot gutconnto gutcnoton gutcnotno gutcnootn gutcnoont gutcnonot
gutcnonto gutcntoon gutcntono gutcntoon gutcntono gutcntnoo gutcntnoo gutcnoton gutcnotno gutcnootn gutcnoont
gutcnonot gutcnonto gutcnntoo gutcnntoo gutcnnoto gutcnnoot gutcnnoot gutcnnoto gutctnoon gutctnono gutctnoon
gutctnono gutctnnoo gutctnnoo gutctonon gutctonno gutctoonn gutctoonn gutctonon gutctonno gutctoonn gutctoonn
gutctonon gutctonno gutctonno gutctonon gutctnoon gutctnono gutctnoon gutctnono gutctnnoo gutctnnoo gutconton
gutcontno gutconotn gutconont gutconnot gutconnto gutcotnon gutcotnno gutcotonn gutcotonn gutcotnon gutcotnno
gutcootnn gutcootnn gutcoontn gutcoonnt gutcoonnt gutcoontn gutconton gutcontno gutconotn gutconont gutconnot
gutconnto gutcnntoo gutcnntoo gutcnnoto gutcnnoot gutcnnoot gutcnnoto gutcntnoo gutcntnoo gutcntono gutcntoon
gutcntoon gutcntono gutcnotno gutcnoton gutcnonto gutcnonot gutcnoont gutcnootn gutcnoton gutcnotno gutcnootn
gutcnoont gutcnonot gutcnonto gutocnton gutocntno gutocnotn gutocnont gutocnnot gutocnnto gutoctnon gutoctnno
gutoctonn gutoctonn gutoctnon gutoctnno gutocotnn gutocotnn gutocontn gutoconnt gutoconnt gutocontn gutocnton
gutocntno gutocnotn gutocnont gutocnnot gutocnnto gutoncton gutonctno gutoncotn gutoncont gutoncnot gutoncnto
gutontcon gutontcno gutontocn gutontonc gutontnoc gutontnco gutonotcn gutonotnc gutonoctn gutonocnt gutononct
gutonontc gutonntoc gutonntco gutonnotc gutonnoct gutonncot gutonncto gutotncon gutotncno gutotnocn gutotnonc
gutotnnoc gutotnnco gutotcnon gutotcnno gutotconn gutotconn gutotcnon gutotcnno gutotocnn gutotocnn gutotoncn
gutotonnc gutotonnc gutotoncn gutotncon gutotncno gutotnocn gutotnonc gutotnnoc gutotnnco gutoontcn gutoontnc
gutoonctn gutooncnt gutoonnct gutoonntc gutootncn gutootnnc gutootcnn gutootcnn gutootncn gutootnnc gutooctnn
gutooctnn gutoocntn gutoocnnt gutoocnnt gutoocntn gutoontcn gutoontnc gutoonctn gutooncnt gutoonnct gutoonntc
gutonntoc gutonntco gutonnotc gutonnoct gutonncot gutonncto gutontnoc gutontnco gutontonc gutontocn gutontcon
gutontcno gutonotnc gutonotcn gutonontc gutononct gutonocnt gutonoctn gutoncton gutonctno gutoncotn gutoncont
gutoncnot gutoncnto gutnocton gutnoctno gutnocotn gutnocont gutnocnot gutnocnto gutnotcon gutnotcno gutnotocn
gutnotonc gutnotnoc gutnotnco gutnootcn gutnootnc gutnooctn gutnoocnt gutnoonct gutnoontc gutnontoc gutnontco
gutnonotc gutnonoct gutnoncot gutnoncto gutncoton gutncotno gutncootn gutncoont gutnconot gutnconto gutnctoon
gutnctono gutnctoon gutnctono gutnctnoo gutnctnoo gutncoton gutncotno gutncootn gutncoont gutnconot gutnconto
gutncntoo gutncntoo gutncnoto gutncnoot gutncnoot gutncnoto gutntcoon gutntcono gutntcoon gutntcono gutntcnoo
gutntcnoo gutntocon gutntocno gutntoocn gutntoonc gutntonoc gutntonco gutntoocn gutntoonc gutntocon gutntocno
gutntonco gutntonoc gutntnooc gutntnoco gutntnooc gutntnoco gutntncoo gutntncoo gutnocton gutnoctno gutnocotn
gutnocont gutnocnot gutnocnto gutnotcon gutnotcno gutnotocn gutnotonc gutnotnoc gutnotnco gutnootcn gutnootnc
gutnooctn gutnoocnt gutnoonct gutnoontc gutnontoc gutnontco gutnonotc gutnonoct gutnoncot gutnoncto gutnnctoo
gutnnctoo gutnncoto gutnncoot gutnncoot gutnncoto gutnntcoo gutnntcoo gutnntoco gutnntooc gutnntooc gutnntoco
gutnnotco gutnnotoc gutnnocto gutnnocot gutnnooct gutnnootc gutnnotoc gutnnotco gutnnootc gutnnooct gutnnocot
gutnnocto guttoncon guttoncno guttonocn guttononc guttonnoc guttonnco guttocnon guttocnno guttoconn guttoconn
guttocnon guttocnno guttoocnn guttoocnn guttooncn guttoonnc guttoonnc guttooncn guttoncon guttoncno guttonocn
guttononc guttonnoc guttonnco guttnocon guttnocno guttnoocn guttnoonc guttnonoc guttnonco guttncoon guttncono
guttncoon guttncono guttncnoo guttncnoo guttnocon guttnocno guttnoocn guttnoonc guttnonoc guttnonco guttnncoo
guttnncoo guttnnoco guttnnooc guttnnooc guttnnoco guttcnoon guttcnono guttcnoon guttcnono guttcnnoo guttcnnoo
guttconon guttconno guttcoonn guttcoonn guttconon guttconno guttcoonn guttcoonn guttconon guttconno guttconno
guttconon guttcnoon guttcnono guttcnoon guttcnono guttcnnoo guttcnnoo guttoncon guttoncno guttonocn guttononc
guttonnoc guttonnco guttocnon guttocnno guttoconn guttoconn guttocnon guttocnno guttoocnn guttoocnn guttooncn
guttoonnc guttoonnc guttooncn guttoncon guttoncno guttonocn guttononc guttonnoc guttonnco guttnncoo guttnncoo
guttnnoco guttnnooc guttnnooc guttnnoco guttncnoo guttncnoo guttncono guttncoon guttncoon guttncono guttnocno
guttnocon guttnonco guttnonoc guttnoonc guttnoocn guttnocon guttnocno guttnoocn guttnoonc guttnonoc guttnonco
gutoontcn gutoontnc gutoonctn gutooncnt gutoonnct gutoonntc gutootncn gutootnnc gutootcnn gutootcnn gutootncn
gutootnnc gutooctnn gutooctnn gutoocntn gutoocnnt gutoocnnt gutoocntn gutoontcn gutoontnc gutoonctn gutooncnt
gutoonnct gutoonntc gutonotcn gutonotnc gutonoctn gutonocnt gutononct gutonontc gutontocn gutontonc gutontcon
gutontcno gutontnco gutontnoc gutoncton gutonctno gutoncotn gutoncont gutoncnot gutoncnto gutonntco gutonntoc
gutonncto gutonncot gutonnoct gutonnotc gutotnocn gutotnonc gutotncon gutotncno gutotnnco gutotnnoc gutotoncn
gutotonnc gutotocnn gutotocnn gutotoncn gutotonnc gutotconn gutotconn gutotcnon gutotcnno gutotcnno gutotcnon
gutotnocn gutotnonc gutotncon gutotncno gutotnnco gutotnnoc gutocnton gutocntno gutocnotn gutocnont gutocnnot
gutocnnto gutoctnon gutoctnno gutoctonn gutoctonn gutoctnon gutoctnno gutocotnn gutocotnn gutocontn gutoconnt
gutoconnt gutocontn gutocnton gutocntno gutocnotn gutocnont gutocnnot gutocnnto gutonntco gutonntoc gutonncto
gutonncot gutonnoct gutonnotc gutontnco gutontnoc gutontcno gutontcon gutontocn gutontonc gutonctno gutoncton
gutoncnto gutoncnot gutoncont gutoncotn gutonotcn gutonotnc gutonoctn gutonocnt gutononct gutonontc gutnontoc
gutnontco gutnonotc gutnonoct gutnoncot gutnoncto gutnotnoc gutnotnco gutnotonc gutnotocn gutnotcon gutnotcno
gutnootnc gutnootcn gutnoontc gutnoonct gutnoocnt gutnooctn gutnocton gutnoctno gutnocotn gutnocont gutnocnot
gutnocnto gutnnotoc gutnnotco gutnnootc gutnnooct gutnnocot gutnnocto gutnntooc gutnntoco gutnntooc gutnntoco
gutnntcoo gutnntcoo gutnnotoc gutnnotco gutnnootc gutnnooct gutnnocot gutnnocto gutnnctoo gutnnctoo gutnncoto
gutnncoot gutnncoot gutnncoto gutntnooc gutntnoco gutntnooc gutntnoco gutntncoo gutntncoo gutntonoc gutntonco
gutntoonc gutntoocn gutntocon gutntocno gutntoonc gutntoocn gutntonoc gutntonco gutntocno gutntocon gutntcoon
gutntcono gutntcoon gutntcono gutntcnoo gutntcnoo gutnontoc gutnontco gutnonotc gutnonoct gutnoncot gutnoncto
gutnotnoc gutnotnco gutnotonc gutnotocn gutnotcon gutnotcno gutnootnc gutnootcn gutnoontc gutnoonct gutnoocnt
gutnooctn gutnocton gutnoctno gutnocotn gutnocont gutnocnot gutnocnto gutncntoo gutncntoo gutncnoto gutncnoot
gutncnoot gutncnoto gutnctnoo gutnctnoo gutnctono gutnctoon gutnctoon gutnctono gutncotno gutncoton gutnconto
gutnconot gutncoont gutncootn gutncoton gutncotno gutncootn gutncoont gutnconot gutnconto gutcotnon gutcotnno
gutcotonn gutcotonn gutcotnon gutcotnno gutconton gutcontno gutconotn gutconont gutconnot gutconnto gutcoontn
gutcoonnt gutcootnn gutcootnn gutcoontn gutcoonnt gutconnot gutconnto gutconont gutconotn gutconton gutcontno
gutctonon gutctonno gutctoonn gutctoonn gutctonon gutctonno gutctnoon gutctnono gutctnoon gutctnono gutctnnoo
gutctnnoo gutctonon gutctonno gutctoonn gutctoonn gutctonon gutctonno gutctnnoo gutctnnoo gutctnono gutctnoon
gutctnoon gutctnono gutcntoon gutcntono gutcntoon gutcntono gutcntnoo gutcntnoo gutcnoton gutcnotno gutcnootn
gutcnoont gutcnonot gutcnonto gutcnootn gutcnoont gutcnoton gutcnotno gutcnonto gutcnonot gutcnnoot gutcnnoto
gutcnnoot gutcnnoto gutcnntoo gutcnntoo gutcotnon gutcotnno gutcotonn gutcotonn gutcotnon gutcotnno gutconton
gutcontno gutconotn gutconont gutconnot gutconnto gutcoontn gutcoonnt gutcootnn gutcootnn gutcoontn gutcoonnt
gutconnot gutconnto gutconont gutconotn gutconton gutcontno gutcntnoo gutcntnoo gutcntono gutcntoon gutcntoon
gutcntono gutcnntoo gutcnntoo gutcnnoto gutcnnoot gutcnnoot gutcnnoto gutcnonto gutcnonot gutcnotno gutcnoton
gutcnootn gutcnoont gutcnonot gutcnonto gutcnoont gutcnootn gutcnoton gutcnotno gutoctnon gutoctnno gutoctonn
gutoctonn gutoctnon gutoctnno gutocnton gutocntno gutocnotn gutocnont gutocnnot gutocnnto gutocontn gutoconnt
gutocotnn gutocotnn gutocontn gutoconnt gutocnnot gutocnnto gutocnont gutocnotn gutocnton gutocntno gutotcnon
gutotcnno gutotconn gutotconn gutotcnon gutotcnno gutotncon gutotncno gutotnocn gutotnonc gutotnnoc gutotnnco
gutotoncn gutotonnc gutotocnn gutotocnn gutotoncn gutotonnc gutotnnoc gutotnnco gutotnonc gutotnocn gutotncon
gutotncno gutontcon gutontcno gutontocn gutontonc gutontnoc gutontnco gutoncton gutonctno gutoncotn gutoncont
gutoncnot gutoncnto gutonoctn gutonocnt gutonotcn gutonotnc gutonontc gutononct gutonncot gutonncto gutonnoct
gutonnotc gutonntoc gutonntco gutootncn gutootnnc gutootcnn gutootcnn gutootncn gutootnnc gutoontcn gutoontnc
gutoonctn gutooncnt gutoonnct gutoonntc gutoocntn gutoocnnt gutooctnn gutooctnn gutoocntn gutoocnnt gutoonnct
gutoonntc gutooncnt gutoonctn gutoontcn gutoontnc gutontnoc gutontnco gutontonc gutontocn gutontcon gutontcno
gutonntoc gutonntco gutonnotc gutonnoct gutonncot gutonncto gutonontc gutononct gutonotnc gutonotcn gutonoctn
gutonocnt gutoncnot gutoncnto gutoncont gutoncotn gutoncton gutonctno guttocnon guttocnno guttoconn guttoconn
guttocnon guttocnno guttoncon guttoncno guttonocn guttononc guttonnoc guttonnco guttooncn guttoonnc guttoocnn
guttoocnn guttooncn guttoonnc guttonnoc guttonnco guttononc guttonocn guttoncon guttoncno guttconon guttconno
guttcoonn guttcoonn guttconon guttconno guttcnoon guttcnono guttcnoon guttcnono guttcnnoo guttcnnoo guttconon
guttconno guttcoonn guttcoonn guttconon guttconno guttcnnoo guttcnnoo guttcnono guttcnoon guttcnoon guttcnono
guttncoon guttncono guttncoon guttncono guttncnoo guttncnoo guttnocon guttnocno guttnoocn guttnoonc guttnonoc
guttnonco guttnoocn guttnoonc guttnocon guttnocno guttnonco guttnonoc guttnnooc guttnnoco guttnnooc guttnnoco
guttnncoo guttnncoo guttocnon guttocnno guttoconn guttoconn guttocnon guttocnno guttoncon guttoncno guttonocn
guttononc guttonnoc guttonnco guttooncn guttoonnc guttoocnn guttoocnn guttooncn guttoonnc guttonnoc guttonnco
guttononc guttonocn guttoncon guttoncno guttncnoo guttncnoo guttncono guttncoon guttncoon guttncono guttnncoo
guttnncoo guttnnoco guttnnooc guttnnooc guttnnoco guttnonco guttnonoc guttnocno guttnocon guttnoocn guttnoonc
guttnonoc guttnonco guttnoonc guttnoocn guttnocon guttnocno gutnotcon gutnotcno gutnotocn gutnotonc gutnotnoc
gutnotnco gutnocton gutnoctno gutnocotn gutnocont gutnocnot gutnocnto gutnooctn gutnoocnt gutnootcn gutnootnc
gutnoontc gutnoonct gutnoncot gutnoncto gutnonoct gutnonotc gutnontoc gutnontco gutntocon gutntocno gutntoocn
gutntoonc gutntonoc gutntonco gutntcoon gutntcono gutntcoon gutntcono gutntcnoo gutntcnoo gutntocon gutntocno
gutntoocn gutntoonc gutntonoc gutntonco gutntncoo gutntncoo gutntnoco gutntnooc gutntnooc gutntnoco gutnctoon
gutnctono gutnctoon gutnctono gutnctnoo gutnctnoo gutncoton gutncotno gutncootn gutncoont gutnconot gutnconto
gutncootn gutncoont gutncoton gutncotno gutnconto gutnconot gutncnoot gutncnoto gutncnoot gutncnoto gutncntoo
gutncntoo gutnotcon gutnotcno gutnotocn gutnotonc gutnotnoc gutnotnco gutnocton gutnoctno gutnocotn gutnocont
gutnocnot gutnocnto gutnooctn gutnoocnt gutnootcn gutnootnc gutnoontc gutnoonct gutnoncot gutnoncto gutnonoct
gutnonotc gutnontoc gutnontco gutnntcoo gutnntcoo gutnntoco gutnntooc gutnntooc gutnntoco gutnnctoo gutnnctoo
gutnncoto gutnncoot gutnncoot gutnncoto gutnnocto gutnnocot gutnnotco gutnnotoc gutnnootc gutnnooct gutnnocot
gutnnocto gutnnooct gutnnootc gutnnotoc gutnnotco gutootncn gutootnnc gutootcnn gutootcnn gutootncn gutootnnc
gutoontcn gutoontnc gutoonctn gutooncnt gutoonnct gutoonntc gutoocntn gutoocnnt gutooctnn gutooctnn gutoocntn
gutoocnnt gutoonnct gutoonntc gutooncnt gutoonctn gutoontcn gutoontnc gutotoncn gutotonnc gutotocnn gutotocnn
gutotoncn gutotonnc gutotnocn gutotnonc gutotncon gutotncno gutotnnco gutotnnoc gutotcnon gutotcnno gutotconn
gutotconn gutotcnon gutotcnno gutotnnco gutotnnoc gutotncno gutotncon gutotnocn gutotnonc gutontocn gutontonc
gutontcon gutontcno gutontnco gutontnoc gutonotcn gutonotnc gutonoctn gutonocnt gutononct gutonontc gutoncotn
gutoncont gutoncton gutonctno gutoncnto gutoncnot gutonnoct gutonnotc gutonncot gutonncto gutonntco gutonntoc
gutoctnon gutoctnno gutoctonn gutoctonn gutoctnon gutoctnno gutocnton gutocntno gutocnotn gutocnont gutocnnot
gutocnnto gutocontn gutoconnt gutocotnn gutocotnn gutocontn gutoconnt gutocnnot gutocnnto gutocnont gutocnotn
gutocnton gutocntno gutontnco gutontnoc gutontcno gutontcon gutontocn gutontonc gutonntco gutonntoc gutonncto
gutonncot gutonnoct gutonnotc gutoncnto gutoncnot gutonctno gutoncton gutoncotn gutoncont gutononct gutonontc
gutonocnt gutonoctn gutonotcn gutonotnc gutnotnoc gutnotnco gutnotonc gutnotocn gutnotcon gutnotcno gutnontoc
gutnontco gutnonotc gutnonoct gutnoncot gutnoncto gutnoontc gutnoonct gutnootnc gutnootcn gutnooctn gutnoocnt
gutnocnot gutnocnto gutnocont gutnocotn gutnocton gutnoctno gutntonoc gutntonco gutntoonc gutntoocn gutntocon
gutntocno gutntnooc gutntnoco gutntnooc gutntnoco gutntncoo gutntncoo gutntonoc gutntonco gutntoonc gutntoocn
gutntocon gutntocno gutntcnoo gutntcnoo gutntcono gutntcoon gutntcoon gutntcono gutnntooc gutnntoco gutnntooc
gutnntoco gutnntcoo gutnntcoo gutnnotoc gutnnotco gutnnootc gutnnooct gutnnocot gutnnocto gutnnootc gutnnooct
gutnnotoc gutnnotco gutnnocto gutnnocot gutnncoot gutnncoto gutnncoot gutnncoto gutnnctoo gutnnctoo gutnotnoc
gutnotnco gutnotonc gutnotocn gutnotcon gutnotcno gutnontoc gutnontco gutnonotc gutnonoct gutnoncot gutnoncto
gutnoontc gutnoonct gutnootnc gutnootcn gutnooctn gutnoocnt gutnocnot gutnocnto gutnocont gutnocotn gutnocton
gutnoctno gutnctnoo gutnctnoo gutnctono gutnctoon gutnctoon gutnctono gutncntoo gutncntoo gutncnoto gutncnoot
gutncnoot gutncnoto gutnconto gutnconot gutncotno gutncoton gutncootn gutncoont gutnconot gutnconto gutncoont
gutncootn gutncoton gutncotno guocottnn guocottnn guocotntn guocotnnt guocotnnt guocotntn guocottnn guocottnn
guocotntn guocotnnt guocotnnt guocotntn guoconttn guocontnt guoconttn guocontnt guoconntt guoconntt guocontnt
guoconttn guoconntt guoconntt guocontnt guoconttn guoctotnn guoctotnn guoctontn guoctonnt guoctonnt guoctontn
guocttonn guocttonn guocttnon guocttnno guocttnno guocttnon guoctnton guoctntno guoctnotn guoctnont guoctnnot
guoctnnto guoctntno guoctnton guoctnnto guoctnnot guoctnont guoctnotn guocttonn guocttonn guocttnon guocttnno
guocttnno guocttnon guoctotnn guoctotnn guoctontn guoctonnt guoctonnt guoctontn guoctnotn guoctnont guoctnton
guoctntno guoctnnto guoctnnot guoctnont guoctnotn guoctnnot guoctnnto guoctntno guoctnton guocntton guocnttno
guocntotn guocntont guocntnot guocntnto guocntton guocnttno guocntotn guocntont guocntnot guocntnto guocnottn
guocnotnt guocnottn guocnotnt guocnontt guocnontt guocnntot guocnntto guocnnott guocnnott guocnntot guocnntto
guocnttno guocntton guocntnto guocntnot guocntont guocntotn guocnttno guocntton guocntnto guocntnot guocntont
guocntotn guocnntto guocnntot guocnntto guocnntot guocnnott guocnnott guocnotnt guocnottn guocnontt guocnontt
guocnotnt guocnottn guoocttnn guoocttnn guooctntn guooctnnt guooctnnt guooctntn guoocttnn guoocttnn guooctntn
guooctnnt guooctnnt guooctntn guoocnttn guoocntnt guoocnttn guoocntnt guoocnntt guoocnntt guoocntnt guoocnttn
guoocnntt guoocnntt guoocntnt guoocnttn guootctnn guootctnn guootcntn guootcnnt guootcnnt guootcntn guoottcnn
guoottcnn guoottncn guoottnnc guoottnnc guoottncn guootntcn guootntnc guootnctn guootncnt guootnnct guootnntc
guootntnc guootntcn guootnntc guootnnct guootncnt guootnctn guoottcnn guoottcnn guoottncn guoottnnc guoottnnc
guoottncn guootctnn guootctnn guootcntn guootcnnt guootcnnt guootcntn guootnctn guootncnt guootntcn guootntnc
guootnntc guootnnct guootncnt guootnctn guootnnct guootnntc guootntnc guootntcn guoonttcn guoonttnc guoontctn
guoontcnt guoontnct guoontntc guoonttcn guoonttnc guoontctn guoontcnt guoontnct guoontntc guooncttn guoonctnt
guooncttn guoonctnt guooncntt guooncntt guoonntct guoonnttc guoonnctt guoonnctt guoonntct guoonnttc guoonttnc
guoonttcn guoontntc guoontnct guoontcnt guoontctn guoonttnc guoonttcn guoontntc guoontnct guoontcnt guoontctn
guoonnttc guoonntct guoonnttc guoonntct guoonnctt guoonnctt guoonctnt guooncttn guooncntt guooncntt guoonctnt
guooncttn guotoctnn guotoctnn guotocntn guotocnnt guotocnnt guotocntn guototcnn guototcnn guototncn guototnnc
guototnnc guototncn guotontcn guotontnc guotonctn guotoncnt guotonnct guotonntc guotontnc guotontcn guotonntc
guotonnct guotoncnt guotonctn guotcotnn guotcotnn guotcontn guotconnt guotconnt guotcontn guotctonn guotctonn
guotctnon guotctnno guotctnno guotctnon guotcnton guotcntno guotcnotn guotcnont guotcnnot guotcnnto guotcntno
guotcnton guotcnnto guotcnnot guotcnont guotcnotn guottconn guottconn guottcnon guottcnno guottcnno guottcnon
guottocnn guottocnn guottoncn guottonnc guottonnc guottoncn guottnocn guottnonc guottncon guottncno guottnnco
guottnnoc guottnonc guottnocn guottnnoc guottnnco guottncno guottncon guotncton guotnctno guotncotn guotncont
guotncnot guotncnto guotntcon guotntcno guotntocn guotntonc guotntnoc guotntnco guotnotcn guotnotnc guotnoctn
guotnocnt guotnonct guotnontc guotnntoc guotnntco guotnnotc guotnnoct guotnncot guotnncto guotnctno guotncton
guotncnto guotncnot guotncont guotncotn guotntcno guotntcon guotntnco guotntnoc guotntonc guotntocn guotnntco
guotnntoc guotnncto guotnncot guotnnoct guotnnotc guotnotnc guotnotcn guotnontc guotnonct guotnocnt guotnoctn
guototcnn guototcnn guototncn guototnnc guototnnc guototncn guotoctnn guotoctnn guotocntn guotocnnt guotocnnt
guotocntn guotonctn guotoncnt guotontcn guotontnc guotonntc guotonnct guotoncnt guotonctn guotonnct guotonntc
guotontnc guotontcn guottocnn guottocnn guottoncn guottonnc guottonnc guottoncn guottconn guottconn guottcnon
guottcnno guottcnno guottcnon guottncon guottncno guottnocn guottnonc guottnnoc guottnnco guottncno guottncon
guottnnco guottnnoc guottnonc guottnocn guotctonn guotctonn guotctnon guotctnno guotctnno guotctnon guotcotnn
guotcotnn guotcontn guotconnt guotconnt guotcontn guotcnotn guotcnont guotcnton guotcntno guotcnnto guotcnnot
guotcnont guotcnotn guotcnnot guotcnnto guotcntno guotcnton guotntcon guotntcno guotntocn guotntonc guotntnoc
guotntnco guotncton guotnctno guotncotn guotncont guotncnot guotncnto guotnoctn guotnocnt guotnotcn guotnotnc
guotnontc guotnonct guotnncot guotnncto guotnnoct guotnnotc guotnntoc guotnntco guotntcno guotntcon guotntnco
guotntnoc guotntonc guotntocn guotnctno guotncton guotncnto guotncnot guotncont guotncotn guotnncto guotnncot
guotnntco guotnntoc guotnnotc guotnnoct guotnocnt guotnoctn guotnonct guotnontc guotnotnc guotnotcn guonottcn
guonottnc guonotctn guonotcnt guonotnct guonotntc guonottcn guonottnc guonotctn guonotcnt guonotnct guonotntc
guonocttn guonoctnt guonocttn guonoctnt guonocntt guonocntt guonontct guononttc guononctt guononctt guonontct
guononttc guontotcn guontotnc guontoctn guontocnt guontonct guontontc guonttocn guonttonc guonttcon guonttcno
guonttnco guonttnoc guontcton guontctno guontcotn guontcont guontcnot guontcnto guontntco guontntoc guontncto
guontncot guontnoct guontnotc guonttocn guonttonc guonttcon guonttcno guonttnco guonttnoc guontotcn guontotnc
guontoctn guontocnt guontonct guontontc guontcotn guontcont guontcton guontctno guontcnto guontcnot guontnoct
guontnotc guontncot guontncto guontntco guontntoc guonctton guoncttno guonctotn guonctont guonctnot guonctnto
guonctton guoncttno guonctotn guonctont guonctnot guonctnto guoncottn guoncotnt guoncottn guoncotnt guoncontt
guoncontt guoncntot guoncntto guoncnott guoncnott guoncntot guoncntto guonnttco guonnttoc guonntcto guonntcot
guonntoct guonntotc guonnttco guonnttoc guonntcto guonntcot guonntoct guonntotc guonnctto guonnctot guonnctto
guonnctot guonncott guonncott guonnotct guonnottc guonnoctt guonnoctt guonnotct guonnottc guonottnc guonottcn
guonotntc guonotnct guonotcnt guonotctn guonottnc guonottcn guonotntc guonotnct guonotcnt guonotctn guononttc
guonontct guononttc guonontct guononctt guononctt guonoctnt guonocttn guonocntt guonocntt guonoctnt guonocttn
guontotnc guontotcn guontontc guontonct guontocnt guontoctn guonttonc guonttocn guonttnoc guonttnco guonttcno
guonttcon guontntoc guontntco guontnotc guontnoct guontncot guontncto guontctno guontcton guontcnto guontcnot
guontcont guontcotn guonttonc guonttocn guonttnoc guonttnco guonttcno guonttcon guontotnc guontotcn guontontc
guontonct guontocnt guontoctn guontnotc guontnoct guontntoc guontntco guontncto guontncot guontcont guontcotn
guontcnot guontcnto guontctno guontcton guonnttoc guonnttco guonntotc guonntoct guonntcot guonntcto guonnttoc
guonnttco guonntotc guonntoct guonntcot guonntcto guonnottc guonnotct guonnottc guonnotct guonnoctt guonnoctt
guonnctot guonnctto guonncott guonncott guonnctot guonnctto guoncttno guonctton guonctnto guonctnot guonctont
guonctotn guoncttno guonctton guonctnto guonctnot guonctont guonctotn guoncntto guoncntot guoncntto guoncntot
guoncnott guoncnott guoncotnt guoncottn guoncontt guoncontt guoncotnt guoncottn guncotton guncottno guncototn
guncotont guncotnot guncotnto guncotton guncottno guncototn guncotont guncotnot guncotnto guncoottn guncootnt
guncoottn guncootnt guncoontt guncoontt guncontot guncontto gunconott gunconott guncontot guncontto gunctoton
gunctotno gunctootn gunctoont gunctonot gunctonto guncttoon guncttono guncttoon guncttono guncttnoo guncttnoo
gunctoton gunctotno gunctootn gunctoont gunctonot gunctonto gunctntoo gunctntoo gunctnoto gunctnoot gunctnoot
gunctnoto guncttoon guncttono guncttoon guncttono guncttnoo guncttnoo gunctoton gunctotno gunctootn gunctoont
gunctonot gunctonto gunctootn gunctoont gunctoton gunctotno gunctonto gunctonot gunctnoot gunctnoto gunctnoot
gunctnoto gunctntoo gunctntoo guncotton guncottno guncototn guncotont guncotnot guncotnto guncotton guncottno
guncototn guncotont guncotnot guncotnto guncoottn guncootnt guncoottn guncootnt guncoontt guncoontt guncontot
guncontto gunconott gunconott guncontot guncontto guncnttoo guncnttoo guncntoto guncntoot guncntoot guncntoto
guncnttoo guncnttoo guncntoto guncntoot guncntoot guncntoto guncnotto guncnotot guncnotto guncnotot guncnoott
guncnoott guncnotot guncnotto guncnoott guncnoott guncnotot guncnotto gunoctton gunocttno gunoctotn gunoctont
gunoctnot gunoctnto gunoctton gunocttno gunoctotn gunoctont gunoctnot gunoctnto gunocottn gunocotnt gunocottn
gunocotnt gunocontt gunocontt gunocntot gunocntto gunocnott gunocnott gunocntot gunocntto gunotcton gunotctno
gunotcotn gunotcont gunotcnot gunotcnto gunottcon gunottcno gunottocn gunottonc gunottnoc gunottnco gunototcn
gunototnc gunotoctn gunotocnt gunotonct gunotontc gunotntoc gunotntco gunotnotc gunotnoct gunotncot gunotncto
gunottcon gunottcno gunottocn gunottonc gunottnoc gunottnco gunotcton gunotctno gunotcotn gunotcont gunotcnot
gunotcnto gunotoctn gunotocnt gunototcn gunototnc gunotontc gunotonct gunotncot gunotncto gunotnoct gunotnotc
gunotntoc gunotntco gunoottcn gunoottnc gunootctn gunootcnt gunootnct gunootntc gunoottcn gunoottnc gunootctn
gunootcnt gunootnct gunootntc gunoocttn gunooctnt gunoocttn gunooctnt gunoocntt gunoocntt gunoontct gunoonttc
gunoonctt gunoonctt gunoontct gunoonttc gunonttoc gunonttco gunontotc gunontoct gunontcot gunontcto gunonttoc
gunonttco gunontotc gunontoct gunontcot gunontcto gunonottc gunonotct gunonottc gunonotct gunonoctt gunonoctt
gunonctot gunonctto gunoncott gunoncott gunonctot gunonctto guntocton guntoctno guntocotn guntocont guntocnot
guntocnto guntotcon guntotcno guntotocn guntotonc guntotnoc guntotnco guntootcn guntootnc guntooctn guntoocnt
guntoonct guntoontc guntontoc guntontco guntonotc guntonoct guntoncot guntoncto guntcoton guntcotno guntcootn
guntcoont guntconot guntconto guntctoon guntctono guntctoon guntctono guntctnoo guntctnoo guntcoton guntcotno
guntcootn guntcoont guntconot guntconto guntcntoo guntcntoo guntcnoto guntcnoot guntcnoot guntcnoto gunttcoon
gunttcono gunttcoon gunttcono gunttcnoo gunttcnoo gunttocon gunttocno gunttoocn gunttoonc gunttonoc gunttonco
gunttoocn gunttoonc gunttocon gunttocno gunttonco gunttonoc gunttnooc gunttnoco gunttnooc gunttnoco gunttncoo
gunttncoo guntocton guntoctno guntocotn guntocont guntocnot guntocnto guntotcon guntotcno guntotocn guntotonc
guntotnoc guntotnco guntootcn guntootnc guntooctn guntoocnt guntoonct guntoontc guntontoc guntontco guntonotc
guntonoct guntoncot guntoncto guntnctoo guntnctoo guntncoto guntncoot guntncoot guntncoto guntntcoo guntntcoo
guntntoco guntntooc guntntooc guntntoco guntnotco guntnotoc guntnocto guntnocot guntnooct guntnootc guntnotoc
guntnotco guntnootc guntnooct guntnocot guntnocto guntotcon guntotcno guntotocn guntotonc guntotnoc guntotnco
guntocton guntoctno guntocotn guntocont guntocnot guntocnto guntooctn guntoocnt guntootcn guntootnc guntoontc
guntoonct guntoncot guntoncto guntonoct guntonotc guntontoc guntontco gunttocon gunttocno gunttoocn gunttoonc
gunttonoc gunttonco gunttcoon gunttcono gunttcoon gunttcono gunttcnoo gunttcnoo gunttocon gunttocno gunttoocn
gunttoonc gunttonoc gunttonco gunttncoo gunttncoo gunttnoco gunttnooc gunttnooc gunttnoco guntctoon guntctono
guntctoon guntctono guntctnoo guntctnoo guntcoton guntcotno guntcootn guntcoont guntconot guntconto guntcootn
guntcoont guntcoton guntcotno guntconto guntconot guntcnoot guntcnoto guntcnoot guntcnoto guntcntoo guntcntoo
guntotcon guntotcno guntotocn guntotonc guntotnoc guntotnco guntocton guntoctno guntocotn guntocont guntocnot
guntocnto guntooctn guntoocnt guntootcn guntootnc guntoontc guntoonct guntoncot guntoncto guntonoct guntonotc
guntontoc guntontco guntntcoo guntntcoo guntntoco guntntooc guntntooc guntntoco guntnctoo guntnctoo guntncoto
guntncoot guntncoot guntncoto guntnocto guntnocot guntnotco guntnotoc guntnootc guntnooct guntnocot guntnocto
guntnooct guntnootc guntnotoc guntnotco gunoottcn gunoottnc gunootctn gunootcnt gunootnct gunootntc gunoottcn
gunoottnc gunootctn gunootcnt gunootnct gunootntc gunoocttn gunooctnt gunoocttn gunooctnt gunoocntt gunoocntt
gunoontct gunoonttc gunoonctt gunoonctt gunoontct gunoonttc gunototcn gunototnc gunotoctn gunotocnt gunotonct
gunotontc gunottocn gunottonc gunottcon gunottcno gunottnco gunottnoc gunotcton gunotctno gunotcotn gunotcont
gunotcnot gunotcnto gunotntco gunotntoc gunotncto gunotncot gunotnoct gunotnotc gunottocn gunottonc gunottcon
gunottcno gunottnco gunottnoc gunototcn gunototnc gunotoctn gunotocnt gunotonct gunotontc gunotcotn gunotcont
gunotcton gunotctno gunotcnto gunotcnot gunotnoct gunotnotc gunotncot gunotncto gunotntco gunotntoc gunoctton
gunocttno gunoctotn gunoctont gunoctnot gunoctnto gunoctton gunocttno gunoctotn gunoctont gunoctnot gunoctnto
gunocottn gunocotnt gunocottn gunocotnt gunocontt gunocontt gunocntot gunocntto gunocnott gunocnott gunocntot
gunocntto gunonttco gunonttoc gunontcto gunontcot gunontoct gunontotc gunonttco gunonttoc gunontcto gunontcot
gunontoct gunontotc gunonctto gunonctot gunonctto gunonctot gunoncott gunoncott gunonotct gunonottc gunonoctt
gunonoctt gunonotct gunonottc gunnottoc gunnottco gunnototc gunnotoct gunnotcot gunnotcto gunnottoc gunnottco
gunnototc gunnotoct gunnotcot gunnotcto gunnoottc gunnootct gunnoottc gunnootct gunnooctt gunnooctt gunnoctot
gunnoctto gunnocott gunnocott gunnoctot gunnoctto gunntotoc gunntotco gunntootc gunntooct gunntocot gunntocto
gunnttooc gunnttoco gunnttooc gunnttoco gunnttcoo gunnttcoo gunntotoc gunntotco gunntootc gunntooct gunntocot
gunntocto gunntctoo gunntctoo gunntcoto gunntcoot gunntcoot gunntcoto gunnttooc gunnttoco gunnttooc gunnttoco
gunnttcoo gunnttcoo gunntotoc gunntotco gunntootc gunntooct gunntocot gunntocto gunntootc gunntooct gunntotoc
gunntotco gunntocto gunntocot gunntcoot gunntcoto gunntcoot gunntcoto gunntctoo gunntctoo gunnottoc gunnottco
gunnototc gunnotoct gunnotcot gunnotcto gunnottoc gunnottco gunnototc gunnotoct gunnotcot gunnotcto gunnoottc
gunnootct gunnoottc gunnootct gunnooctt gunnooctt gunnoctot gunnoctto gunnocott gunnocott gunnoctot gunnoctto
gunncttoo gunncttoo gunnctoto gunnctoot gunnctoot gunnctoto gunncttoo gunncttoo gunnctoto gunnctoot gunnctoot
gunnctoto gunncotto gunncotot gunncotto gunncotot gunncoott gunncoott gunncotot gunncotto gunncoott gunncoott
gunncotot gunncotto

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us