easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

epics

northings

daiquiri

longwoodensis

ormer

unappeasedness

intersecting

unbossed

intererit

donacidae

exspectabamque

beshame

curarentque

polycythemic

hpsdesis

hearne

nowell

instituisseque


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: googol
cipher variations:
hpphpm iqqiqn jrrjro kssksp lttltq
muumur nvvnvs owwowt pxxpxu qyyqyv
rzzrzw saasax tbbtby uccucz vddvda
weeweb xffxfc yggygd zhhzhe aiiaif
bjjbjg ckkckh dlldli emmemj fnnfnk

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: googol
Cipher: tlltlo

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: googol
Cipher: AABBA ABBAB ABBAB AABBA ABBAB ABABA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: googol
cipher variations:
hpphpmtrrtrifttftervvrvadxxdxwpzzpzsnddndkzffzfg
lhhlhcxjjxjyjlljluvnnvnqiqqiqnussusjguugufswwswb
eyyeyxqaaqatoeeoelaggaghmiimidykkykzkmmkmvwoowor
jrrjrovttvtkhvvhvgtxxtxcfzzfzyrbbrbupffpfmbhhbhi
njjnjezllzlalnnlnwxppxpsksskspwuuwuliwwiwhuyyuyd
gaagazsccscvqggqgnciicijokkokfammambmoomoxyqqyqt
lttltqxvvxvmjxxjxivzzvzehbbhbatddtdwrhhrhodjjdjk
pllplgbnnbncnppnpyzrrzrumuumurywwywnkyykyjwaawaf
iccicbueeuexsiisipekkeklqmmqmhcoocodoqqoqzassasv
nvvnvszxxzxolzzlzkxbbxbgjddjdcvffvfytjjtjqfllflm
rnnrnidppdpeprrprabttbtwowwowtayyaypmaamalyccych
keekedwggwgzukkukrgmmgmnsoosojeqqeqfqssqsbcuucux
pxxpxubzzbzqnbbnbmzddzdilfflfexhhxhavllvlshnnhno
tpptpkfrrfrgrttrtcdvvdvyqyyqyvcaacaroccocnaeeaej
mggmgfyiiyibwmmwmtiooiopuqquqlgssgshsuusudewwewz
rzzrzwdbbdbspddpdobffbfknhhnhgzjjzjcxnnxnujppjpq
vrrvrmhtthtitvvtvefxxfxasaasaxeccectqeeqepcggcgl
oiioihakkakdyooyovkqqkqrwsswsniuuiujuwwuwfgyygyb
tbbtbyfddfdurffrfqdhhdhmpjjpjibllblezppzpwlrrlrs
xttxtojvvjvkvxxvxghzzhzcuccuczgeegevsggsgreiiein
qkkqkjcmmcmfaqqaqxmssmstyuuyupkwwkwlwyywyhiaaiad
vddvdahffhfwthhthsfjjfjorllrlkdnndngbrrbrynttntu
zvvzvqlxxlxmxzzxzijbbjbeweewebiggigxuiiuitgkkgkp
smmsmleooeohcsscszouuouvawwawrmyymynyaayajkcckcf
xffxfcjhhjhyvjjvjuhllhlqtnntnmfppfpidttdtapvvpvw
bxxbxsnzznzozbbzbklddldgyggygdkiikizwkkwkvimmimr
uoouongqqgqjeuueubqwwqwxcyycytoaaoapaccaclmeemeh
zhhzheljjljaxllxlwjnnjnsvppvpohrrhrkfvvfvcrxxrxy
dzzdzupbbpbqbddbdmnffnfiaiiaifmkkmkbymmymxkookot
wqqwqpissislgwwgwdsyysyzeaaeavqccqcrceecenoggogj
bjjbjgnllnlcznnznylpplpuxrrxrqjttjtmhxxhxetzztza
fbbfbwrddrdsdffdfophhphkckkckhommomdaooaozmqqmqv
yssysrkuukuniyyiyfuaauabgccgcxseeseteggegpqiiqil
dlldlipnnpnebppbpanrrnrwzttztslvvlvojzzjzgvbbvbc
hddhdytfftfufhhfhqrjjrjmemmemjqooqofcqqcqbossosx
auuautmwwmwpkaakahwccwcdieeiezuggugvgiigirskkskn
fnnfnkrpprpgdrrdrcpttptybvvbvunxxnxqlbblbixddxde
jffjfavhhvhwhjjhjstlltlogoogolsqqsqhessesdquuquz
cwwcwvoyyoyrmccmcjyeeyefkggkgbwiiwixikkiktummump

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: googol
Cipher: tbbtby

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: googol
Cipher: 224343224313

Extended Methods:
Method #1

Plaintext: googol
method variations:
mttmtqryyryvwddwdabiibif

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
g o o g o l 
2 4 4 2 4 1 
2 3 3 2 3 3 
They are then read out in rows:
244241233233
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: googol
Cipher: ridmhn

Read more ...
Method #3

Plaintext: googol
method variations:
rshrch shrchr hrchrs
rchrsh chrshr hrshrc

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: googol

all 720 cipher variations:
googol googlo gooogl gooolg goolog goolgo gogool gogolo gogool gogolo gogloo
gogloo googol googlo gooogl gooolg goolog goolgo golgoo golgoo gologo goloog
goloog gologo googol googlo gooogl gooolg goolog goolgo gogool gogolo gogool
gogolo gogloo gogloo googol googlo gooogl gooolg goolog goolgo golgoo golgoo
gologo goloog goloog gologo ggoool ggoolo ggoool ggoolo ggoloo ggoloo ggoool
ggoolo ggoool ggoolo ggoloo ggoloo ggoool ggoolo ggoool ggoolo ggoloo ggoloo
gglooo gglooo gglooo gglooo gglooo gglooo googol googlo gooogl gooolg goolog
goolgo gogool gogolo gogool gogolo gogloo gogloo googol googlo gooogl gooolg
goolog goolgo golgoo golgoo gologo goloog goloog gologo glogoo glogoo gloogo
glooog glooog gloogo glgooo glgooo glgooo glgooo glgooo glgooo glogoo glogoo
gloogo glooog glooog gloogo glogoo glogoo gloogo glooog glooog gloogo ogogol
ogoglo ogoogl ogoolg ogolog ogolgo oggool oggolo oggool oggolo oggloo oggloo
ogogol ogoglo ogoogl ogoolg ogolog ogolgo oglgoo oglgoo oglogo ogloog ogloog
oglogo ooggol oogglo oogogl oogolg ooglog ooglgo ooggol oogglo oogogl oogolg
ooglog ooglgo oooggl oooglg oooggl oooglg ooolgg ooolgg oolgog oolggo oologg
oologg oolgog oolggo ogogol ogoglo ogoogl ogoolg ogolog ogolgo oggool oggolo
oggool oggolo oggloo oggloo ogogol ogoglo ogoogl ogoolg ogolog ogolgo oglgoo
oglgoo oglogo ogloog ogloog oglogo oooggl oooglg oooggl oooglg ooolgg ooolgg
oogogl oogolg ooggol oogglo ooglgo ooglog ooggol oogglo oogogl oogolg ooglog
ooglgo oolggo oolgog oolggo oolgog oologg oologg ologog ologgo oloogg oloogg
ologog ologgo olgoog olgogo olgoog olgogo olggoo olggoo ologog ologgo oloogg
oloogg ologog ologgo olggoo olggoo olgogo olgoog olgoog olgogo ooggol oogglo
oogogl oogolg ooglog ooglgo ooggol oogglo oogogl oogolg ooglog ooglgo oooggl
oooglg oooggl oooglg ooolgg ooolgg oolgog oolggo oologg oologg oolgog oolggo
ogogol ogoglo ogoogl ogoolg ogolog ogolgo oggool oggolo oggool oggolo oggloo
oggloo ogogol ogoglo ogoogl ogoolg ogolog ogolgo oglgoo oglgoo oglogo ogloog
ogloog oglogo oggool oggolo oggool oggolo oggloo oggloo ogogol ogoglo ogoogl
ogoolg ogolog ogolgo ogoogl ogoolg ogogol ogoglo ogolgo ogolog ogloog oglogo
ogloog oglogo oglgoo oglgoo ooggol oogglo oogogl oogolg ooglog ooglgo ooggol
oogglo oogogl oogolg ooglog ooglgo oooggl oooglg oooggl oooglg ooolgg ooolgg
oolgog oolggo oologg oologg oolgog oolggo olggoo olggoo olgogo olgoog olgoog
olgogo olggoo olggoo olgogo olgoog olgoog olgogo ologgo ologog ologgo ologog
oloogg oloogg ologog ologgo oloogg oloogg ologog ologgo googol googlo gooogl
gooolg goolog goolgo gogool gogolo gogool gogolo gogloo gogloo googol googlo
gooogl gooolg goolog goolgo golgoo golgoo gologo goloog goloog gologo googol
googlo gooogl gooolg goolog goolgo gogool gogolo gogool gogolo gogloo gogloo
googol googlo gooogl gooolg goolog goolgo golgoo golgoo gologo goloog goloog
gologo ggoool ggoolo ggoool ggoolo ggoloo ggoloo ggoool ggoolo ggoool ggoolo
ggoloo ggoloo ggoool ggoolo ggoool ggoolo ggoloo ggoloo gglooo gglooo gglooo
gglooo gglooo gglooo googol googlo gooogl gooolg goolog goolgo gogool gogolo
gogool gogolo gogloo gogloo googol googlo gooogl gooolg goolog goolgo golgoo
golgoo gologo goloog goloog gologo glogoo glogoo gloogo glooog glooog gloogo
glgooo glgooo glgooo glgooo glgooo glgooo glogoo glogoo gloogo glooog glooog
gloogo glogoo glogoo gloogo glooog glooog gloogo oooggl oooglg oooggl oooglg
ooolgg ooolgg oogogl oogolg ooggol oogglo ooglgo ooglog ooggol oogglo oogogl
oogolg ooglog ooglgo oolggo oolgog oolggo oolgog oologg oologg oooggl oooglg
oooggl oooglg ooolgg ooolgg oogogl oogolg ooggol oogglo ooglgo ooglog ooggol
oogglo oogogl oogolg ooglog ooglgo oolggo oolgog oolggo oolgog oologg oologg
ogoogl ogoolg ogogol ogoglo ogolgo ogolog ogoogl ogoolg ogogol ogoglo ogolgo
ogolog oggool oggolo oggool oggolo oggloo oggloo oglogo ogloog oglgoo oglgoo
oglogo ogloog ogogol ogoglo ogoogl ogoolg ogolog ogolgo oggool oggolo oggool
oggolo oggloo oggloo ogogol ogoglo ogoogl ogoolg ogolog ogolgo oglgoo oglgoo
oglogo ogloog ogloog oglogo ologgo ologog ologgo ologog oloogg oloogg olgogo
olgoog olggoo olggoo olgogo olgoog olggoo olggoo olgogo olgoog olgoog olgogo
ologgo ologog ologgo ologog oloogg oloogg loogog looggo looogg looogg loogog
looggo logoog logogo logoog logogo loggoo loggoo loogog looggo looogg looogg
loogog looggo loggoo loggoo logogo logoog logoog logogo loogog looggo looogg
looogg loogog looggo logoog logogo logoog logogo loggoo loggoo loogog looggo
looogg looogg loogog looggo loggoo loggoo logogo logoog logoog logogo lgooog
lgoogo lgooog lgoogo lgogoo lgogoo lgooog lgoogo lgooog lgoogo lgogoo lgogoo
lgooog lgoogo lgooog lgoogo lgogoo lgogoo lggooo lggooo lggooo lggooo lggooo
lggooo loogog looggo looogg looogg loogog looggo logoog logogo logoog logogo
loggoo loggoo loogog looggo looogg looogg loogog looggo loggoo loggoo logogo
logoog logoog logogo lgogoo lgogoo lgoogo lgooog lgooog lgoogo lggooo lggooo
lggooo lggooo lggooo lggooo lgogoo lgogoo lgoogo lgooog lgooog lgoogo lgogoo
lgogoo lgoogo lgooog lgooog lgoogo

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us