easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

kjerulf

caruthers

demiurgic

oyama

clarets

karates

swapan

dorloo

gangplanks

lacunae

boyadgian

geise

undisplanted

inarguable

bciaix

floodwood

sanitise

shoppes


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: ginning
cipher variations:
hjoojoh ikppkpi jlqqlqj kmrrmrk lnssnsl
mottotm npuupun oqvvqvo prwwrwp qsxxsxq
rtyytyr suzzuzs tvaavat uwbbwbu vxccxcv
wyddydw xzeezex yaffafy zbggbgz achhcha
bdiidib cejjejc dfkkfkd egllgle fhmmhmf

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: ginning
Cipher: trmmrmt

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: ginning
Cipher: AABBA ABAAA ABBAA ABBAA ABAAA ABBAA AABBA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: ginning
cipher variations:
hjoojohtzoozotfpoopofrfoofordvoovodploolopnrooronzhoohoz
lxooxolxnoonoxjdoodojvtootovikppkpiuappapugqppqpgsgppgps
ewppwpeqmppmpqosppspoaippipamyppypmyoppopykeppepkwuppupw
jlqqlqjvbqqbqvhrqqrqhthqqhqtfxqqxqfrnqqnqrptqqtqpbjqqjqb
nzqqzqnzpqqpqzlfqqfqlxvqqvqxkmrrmrkwcrrcrwisrrsriuirriru
gyrryrgsorrorsqurrurqckrrkrcoarraroaqrrqramgrrgrmywrrwry
lnssnslxdssdsxjtsstsjvjssjsvhzsszshtpsspstrvssvsrdlsslsd
pbssbspbrssrsbnhsshsnzxssxszmottotmyettetykuttutkwkttktw
iattatiuqttqtuswttwtsemttmteqcttctqcsttstcoittitoayttyta
npuupunzfuufuzlvuuvulxluuluxjbuubujvruuruvtxuuxutfnuunuf
rduudurdtuutudpjuujupbzuuzuboqvvqvoagvvgvamwvvwvmymvvmvy
kcvvcvkwsvvsvwuyvvyvugovvovgsevvevseuvvuveqkvvkvqcavvavc
prwwrwpbhwwhwbnxwwxwnznwwnwzldwwdwlxtwwtwxvzwwzwvhpwwpwh
tfwwfwtfvwwvwfrlwwlwrdbwwbwdqsxxsxqcixxixcoyxxyxoaoxxoxa
mexxexmyuxxuxywaxxaxwiqxxqxiugxxgxugwxxwxgsmxxmxsecxxcxe
rtyytyrdjyyjydpzyyzypbpyypybnfyyfynzvyyvyzxbyybyxjryyryj
vhyyhyvhxyyxyhtnyynytfdyydyfsuzzuzsekzzkzeqazzazqcqzzqzc
ogzzgzoawzzwzayczzczykszzszkwizzizwiyzzyziuozzozugezzezg
tvaavatflaalafrbaabardraaradphaahapbxaaxabzdaadazltaatal
xjaajaxjzaazajvpaapavhfaafahuwbbwbugmbbmbgscbbcbsesbbsbe
qibbibqcybbybcaebbebamubbubmykbbkbykabbabkwqbbqbwigbbgbi
vxccxcvhnccnchtdccdctftcctcfrjccjcrdzcczcdbfccfcbnvccvcn
zlcclczlbccbclxrccrcxjhcchcjwyddydwioddodiueddeduguddudg
skddkdseaddadecgddgdcowddwdoamddmdamcddcdmysddsdykiddidk
xzeezexjpeepejvfeefevhveevehtleeletfbeebefdheehedpxeexep
bneenebndeedenzteetezljeejelyaffafykqffqfkwgffgfwiwffwfi
umffmfugcffcfgeiffifeqyffyfqcoffofcoeffefoauffufamkffkfm
zbggbgzlrggrglxhgghgxjxggxgjvnggngvhdggdghfjggjgfrzggzgr
dpggpgdpfggfgpbvggvgbnlgglgnachhchamshhshmyihhihykyhhyhk
wohhohwiehhehigkhhkhgsahhahseqhhqheqghhghqcwhhwhcomhhmho
bdiidibntiitinzjiijizlziizilxpiipixjfiifijhliilihtbiibit
friirifrhiihirdxiixidpniinipcejjejcoujjujoakjjkjamajjajm
yqjjqjykgjjgjkimjjmjiucjjcjugsjjsjgsijjijseyjjyjeqojjojq
dfkkfkdpvkkvkpblkklkbnbkkbknzrkkrkzlhkkhkljnkknkjvdkkdkv
htkktkhtjkkjktfzkkzkfrpkkpkregllgleqwllwlqcmllmlcocllclo
asllslamillilmkollolkwellelwiulluliukllklugallalgsqllqls
fhmmhmfrxmmxmrdnmmnmdpdmmdmpbtmmtmbnjmmjmnlpmmpmlxfmmfmx
jvmmvmjvlmmlmvhbmmbmhtrmmrmtginningsynnynseonnoneqennenq
cunnuncoknnknomqnnqnmygnngnykwnnwnkwmnnmnwicnncniusnnsnu

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: ginning
Cipher: tvaavat

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: ginning
Cipher: 22423333423322

Extended Methods:
Method #1

Plaintext: ginning
method variations:
mossosmrtxxtxrwyccycwbdhhdhb

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
g i n n i n g 
2 4 3 3 4 3 2 
2 2 3 3 2 3 2 
They are then read out in rows:
24334322233232
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: ginning
Cipher: rnogmhh

Read more ...
Method #3

Plaintext: ginning
method variations:
rmnsmhg mnsmhgr nsmhgrm
smhgrmn mhgrmns hgrmnsm
grmnsmh

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: ginning

all 5040 cipher variations:
ginning ginnign ginnnig ginnngi ginngni ginngin gininng giningn gininng giningn ginignn
ginignn ginning ginnign ginnnig ginnngi ginngni ginngin ginginn ginginn gingnin gingnni
gingnni gingnin ginning ginnign ginnnig ginnngi ginngni ginngin gininng giningn gininng
giningn ginignn ginignn ginning ginnign ginnnig ginnngi ginngni ginngin ginginn ginginn
gingnin gingnni gingnni gingnin giinnng giinngn giinnng giinngn giingnn giingnn giinnng
giinngn giinnng giinngn giingnn giingnn giinnng giinngn giinnng giinngn giingnn giingnn
giignnn giignnn giignnn giignnn giignnn giignnn ginning ginnign ginnnig ginnngi ginngni
ginngin gininng giningn gininng giningn ginignn ginignn ginning ginnign ginnnig ginnngi
ginngni ginngin ginginn ginginn gingnin gingnni gingnni gingnin gigninn gigninn gignnin
gignnni gignnni gignnin giginnn giginnn giginnn giginnn giginnn giginnn gigninn gigninn
gignnin gignnni gignnni gignnin gigninn gigninn gignnin gignnni gignnni gignnin gnining
gninign gninnig gninngi gningni gningin gniinng gniingn gniinng gniingn gniignn gniignn
gnining gninign gninnig gninngi gningni gningin gniginn gniginn gnignin gnignni gnignni
gnignin gnniing gnniign gnninig gnningi gnnigni gnnigin gnniing gnniign gnninig gnningi
gnnigni gnnigin gnnniig gnnnigi gnnniig gnnnigi gnnngii gnnngii gnngini gnngiin gnngnii
gnngnii gnngini gnngiin gnining gninign gninnig gninngi gningni gningin gniinng gniingn
gniinng gniingn gniignn gniignn gnining gninign gninnig gninngi gningni gningin gniginn
gniginn gnignin gnignni gnignni gnignin gnnniig gnnnigi gnnniig gnnnigi gnnngii gnnngii
gnninig gnningi gnniing gnniign gnnigin gnnigni gnniing gnniign gnninig gnningi gnnigni
gnnigin gnngiin gnngini gnngiin gnngini gnngnii gnngnii gngnini gngniin gngnnii gngnnii
gngnini gngniin gnginni gnginin gnginni gnginin gngiinn gngiinn gngnini gngniin gngnnii
gngnnii gngnini gngniin gngiinn gngiinn gnginin gnginni gnginni gnginin gnniing gnniign
gnninig gnningi gnnigni gnnigin gnniing gnniign gnninig gnningi gnnigni gnnigin gnnniig
gnnnigi gnnniig gnnnigi gnnngii gnnngii gnngini gnngiin gnngnii gnngnii gnngini gnngiin
gnining gninign gninnig gninngi gningni gningin gniinng gniingn gniinng gniingn gniignn
gniignn gnining gninign gninnig gninngi gningni gningin gniginn gniginn gnignin gnignni
gnignni gnignin gniinng gniingn gniinng gniingn gniignn gniignn gnining gninign gninnig
gninngi gningni gningin gninnig gninngi gnining gninign gningin gningni gnignni gnignin
gnignni gnignin gniginn gniginn gnniing gnniign gnninig gnningi gnnigni gnnigin gnniing
gnniign gnninig gnningi gnnigni gnnigin gnnniig gnnnigi gnnniig gnnnigi gnnngii gnnngii
gnngini gnngiin gnngnii gnngnii gnngini gnngiin gngiinn gngiinn gnginin gnginni gnginni
gnginin gngiinn gngiinn gnginin gnginni gnginni gnginin gngniin gngnini gngniin gngnini
gngnnii gngnnii gngnini gngniin gngnnii gngnnii gngnini gngniin ginning ginnign ginnnig
ginnngi ginngni ginngin gininng giningn gininng giningn ginignn ginignn ginning ginnign
ginnnig ginnngi ginngni ginngin ginginn ginginn gingnin gingnni gingnni gingnin ginning
ginnign ginnnig ginnngi ginngni ginngin gininng giningn gininng giningn ginignn ginignn
ginning ginnign ginnnig ginnngi ginngni ginngin ginginn ginginn gingnin gingnni gingnni
gingnin giinnng giinngn giinnng giinngn giingnn giingnn giinnng giinngn giinnng giinngn
giingnn giingnn giinnng giinngn giinnng giinngn giingnn giingnn giignnn giignnn giignnn
giignnn giignnn giignnn ginning ginnign ginnnig ginnngi ginngni ginngin gininng giningn
gininng giningn ginignn ginignn ginning ginnign ginnnig ginnngi ginngni ginngin ginginn
ginginn gingnin gingnni gingnni gingnin gigninn gigninn gignnin gignnni gignnni gignnin
giginnn giginnn giginnn giginnn giginnn giginnn gigninn gigninn gignnin gignnni gignnni
gignnin gigninn gigninn gignnin gignnni gignnni gignnin gnnniig gnnnigi gnnniig gnnnigi
gnnngii gnnngii gnninig gnningi gnniing gnniign gnnigin gnnigni gnniing gnniign gnninig
gnningi gnnigni gnnigin gnngiin gnngini gnngiin gnngini gnngnii gnngnii gnnniig gnnnigi
gnnniig gnnnigi gnnngii gnnngii gnninig gnningi gnniing gnniign gnnigin gnnigni gnniing
gnniign gnninig gnningi gnnigni gnnigin gnngiin gnngini gnngiin gnngini gnngnii gnngnii
gninnig gninngi gnining gninign gningin gningni gninnig gninngi gnining gninign gningin
gningni gniinng gniingn gniinng gniingn gniignn gniignn gnignin gnignni gniginn gniginn
gnignin gnignni gnining gninign gninnig gninngi gningni gningin gniinng gniingn gniinng
gniingn gniignn gniignn gnining gninign gninnig gninngi gningni gningin gniginn gniginn
gnignin gnignni gnignni gnignin gngniin gngnini gngniin gngnini gngnnii gngnnii gnginin
gnginni gngiinn gngiinn gnginin gnginni gngiinn gngiinn gnginin gnginni gnginni gnginin
gngniin gngnini gngniin gngnini gngnnii gngnnii ggnnini ggnniin ggnnnii ggnnnii ggnnini
ggnniin ggninni ggninin ggninni ggninin ggniinn ggniinn ggnnini ggnniin ggnnnii ggnnnii
ggnnini ggnniin ggniinn ggniinn ggninin ggninni ggninni ggninin ggnnini ggnniin ggnnnii
ggnnnii ggnnini ggnniin ggninni ggninin ggninni ggninin ggniinn ggniinn ggnnini ggnniin
ggnnnii ggnnnii ggnnini ggnniin ggniinn ggniinn ggninin ggninni ggninni ggninin gginnni
gginnin gginnni gginnin ggininn ggininn gginnni gginnin gginnni gginnin ggininn ggininn
gginnni gginnin gginnni gginnin ggininn ggininn ggiinnn ggiinnn ggiinnn ggiinnn ggiinnn
ggiinnn ggnnini ggnniin ggnnnii ggnnnii ggnnini ggnniin ggninni ggninin ggninni ggninin
ggniinn ggniinn ggnnini ggnniin ggnnnii ggnnnii ggnnini ggnniin ggniinn ggniinn ggninin
ggninni ggninni ggninin ggininn ggininn gginnin gginnni gginnni gginnin ggiinnn ggiinnn
ggiinnn ggiinnn ggiinnn ggiinnn ggininn ggininn gginnin gginnni gginnni gginnin ggininn
ggininn gginnin gginnni gginnni gginnin ignning ignnign ignnnig ignnngi ignngni ignngin
igninng igningn igninng igningn ignignn ignignn ignning ignnign ignnnig ignnngi ignngni
ignngin ignginn ignginn igngnin igngnni igngnni igngnin ignning ignnign ignnnig ignnngi
ignngni ignngin igninng igningn igninng igningn ignignn ignignn ignning ignnign ignnnig
ignnngi ignngni ignngin ignginn ignginn igngnin igngnni igngnni igngnin iginnng iginngn
iginnng iginngn igingnn igingnn iginnng iginngn iginnng iginngn igingnn igingnn iginnng
iginngn iginnng iginngn igingnn igingnn igignnn igignnn igignnn igignnn igignnn igignnn
ignning ignnign ignnnig ignnngi ignngni ignngin igninng igningn igninng igningn ignignn
ignignn ignning ignnign ignnnig ignnngi ignngni ignngin ignginn ignginn igngnin igngnni
igngnni igngnin iggninn iggninn iggnnin iggnnni iggnnni iggnnin igginnn igginnn igginnn
igginnn igginnn igginnn iggninn iggninn iggnnin iggnnni iggnnni iggnnin iggninn iggninn
iggnnin iggnnni iggnnni iggnnin ingning ingnign ingnnig ingnngi ingngni ingngin inginng
ingingn inginng ingingn ingignn ingignn ingning ingnign ingnnig ingnngi ingngni ingngin
ingginn ingginn inggnin inggnni inggnni inggnin innging inngign inngnig inngngi innggni
innggin innigng inniggn inningg inningg innigng inniggn innnigg innnigg innngig innnggi
innnggi innngig innging inngign inngnig inngngi innggni innggin iningng ininggn ininngg
ininngg iningng ininggn inignng inigngn inignng inigngn iniggnn iniggnn iningng ininggn
ininngg ininngg iningng ininggn iniggnn iniggnn inigngn inignng inignng inigngn innnigg
innnigg innngig innnggi innnggi innngig inningg inningg innigng inniggn inniggn innigng
innging inngign inngnig inngngi innggni innggin inngign innging innggin innggni inngngi
inngnig ingning ingnign ingnnig ingnngi ingngni ingngin inginng ingingn inginng ingingn
ingignn ingignn ingning ingnign ingnnig ingnngi ingngni ingngin ingginn ingginn inggnin
inggnni inggnni inggnin innging inngign inngnig inngngi innggni innggin innigng inniggn
inningg inningg innigng inniggn innnigg innnigg innngig innnggi innnggi innngig innging
inngign inngnig inngngi innggni innggin ingning ingnign ingnnig ingnngi ingngni ingngin
inginng ingingn inginng ingingn ingignn ingignn ingning ingnign ingnnig ingnngi ingngni
ingngin ingginn ingginn inggnin inggnni inggnni inggnin inignng inigngn inignng inigngn
iniggnn iniggnn iningng ininggn ininngg ininngg iningng ininggn ininngg ininngg iningng
ininggn ininggn iningng inignng inigngn inignng inigngn iniggnn iniggnn innging inngign
inngnig inngngi innggni innggin innigng inniggn inningg inningg innigng inniggn innnigg
innnigg innngig innnggi innnggi innngig innging inngign inngnig inngngi innggni innggin
ingginn ingginn inggnin inggnni inggnni inggnin ingignn ingignn ingingn inginng inginng
ingingn ingnign ingning ingngin ingngni ingnngi ingnnig ingning ingnign ingnnig ingnngi
ingngni ingngin iinngng iinnggn iinnngg iinnngg iinngng iinnggn iingnng iingngn iingnng
iingngn iinggnn iinggnn iinngng iinnggn iinnngg iinnngg iinngng iinnggn iinggnn iinggnn
iingngn iingnng iingnng iingngn iinngng iinnggn iinnngg iinnngg iinngng iinnggn iingnng
iingngn iingnng iingngn iinggnn iinggnn iinngng iinnggn iinnngg iinnngg iinngng iinnggn
iinggnn iinggnn iingngn iingnng iingnng iingngn iignnng iignngn iignnng iignngn iigngnn
iigngnn iignnng iignngn iignnng iignngn iigngnn iigngnn iignnng iignngn iignnng iignngn
iigngnn iigngnn iiggnnn iiggnnn iiggnnn iiggnnn iiggnnn iiggnnn iinngng iinnggn iinnngg
iinnngg iinngng iinnggn iingnng iingngn iingnng iingngn iinggnn iinggnn iinngng iinnggn
iinnngg iinnngg iinngng iinnggn iinggnn iinggnn iingngn iingnng iingnng iingngn iigngnn
iigngnn iignngn iignnng iignnng iignngn iiggnnn iiggnnn iiggnnn iiggnnn iiggnnn iiggnnn
iigngnn iigngnn iignngn iignnng iignnng iignngn iigngnn iigngnn iignngn iignnng iignnng
iignngn innnigg innnigg innngig innnggi innnggi innngig inningg inningg innigng inniggn
inniggn innigng innging inngign inngnig inngngi innggni innggin inngign innging innggin
innggni inngngi inngnig innnigg innnigg innngig innnggi innnggi innngig inningg inningg
innigng inniggn inniggn innigng innging inngign inngnig inngngi innggni innggin inngign
innging innggin innggni inngngi inngnig ininngg ininngg iningng ininggn ininggn iningng
ininngg ininngg iningng ininggn ininggn iningng inignng inigngn inignng inigngn iniggnn
iniggnn inigngn inignng iniggnn iniggnn inigngn inignng ingning ingnign ingnnig ingnngi
ingngni ingngin inginng ingingn inginng ingingn ingignn ingignn ingning ingnign ingnnig
ingnngi ingngni ingngin ingginn ingginn inggnin inggnni inggnni inggnin ingnign ingning
ingngin ingngni ingnngi ingnnig ingingn inginng ingignn ingignn ingingn inginng ingginn
ingginn inggnin inggnni inggnni inggnin ingnign ingning ingngin ingngni ingnngi ingnnig
ignning ignnign ignnnig ignnngi ignngni ignngin igninng igningn igninng igningn ignignn
ignignn ignning ignnign ignnnig ignnngi ignngni ignngin ignginn ignginn igngnin igngnni
igngnni igngnin ignning ignnign ignnnig ignnngi ignngni ignngin igninng igningn igninng
igningn ignignn ignignn ignning ignnign ignnnig ignnngi ignngni ignngin ignginn ignginn
igngnin igngnni igngnni igngnin iginnng iginngn iginnng iginngn igingnn igingnn iginnng
iginngn iginnng iginngn igingnn igingnn iginnng iginngn iginnng iginngn igingnn igingnn
igignnn igignnn igignnn igignnn igignnn igignnn ignning ignnign ignnnig ignnngi ignngni
ignngin igninng igningn igninng igningn ignignn ignignn ignning ignnign ignnnig ignnngi
ignngni ignngin ignginn ignginn igngnin igngnni igngnni igngnin iggninn iggninn iggnnin
iggnnni iggnnni iggnnin igginnn igginnn igginnn igginnn igginnn igginnn iggninn iggninn
iggnnin iggnnni iggnnni iggnnin iggninn iggninn iggnnin iggnnni iggnnni iggnnin nigning
nignign nignnig nignngi nigngni nigngin niginng nigingn niginng nigingn nigignn nigignn
nigning nignign nignnig nignngi nigngni nigngin nigginn nigginn niggnin niggnni niggnni
niggnin ninging ningign ningnig ningngi ninggni ninggin ninigng niniggn niningg niningg
ninigng niniggn ninnigg ninnigg ninngig ninnggi ninnggi ninngig ninging ningign ningnig
ningngi ninggni ninggin niingng niinggn niinngg niinngg niingng niinggn niignng niigngn
niignng niigngn niiggnn niiggnn niingng niinggn niinngg niinngg niingng niinggn niiggnn
niiggnn niigngn niignng niignng niigngn ninnigg ninnigg ninngig ninnggi ninnggi ninngig
niningg niningg ninigng niniggn niniggn ninigng ninging ningign ningnig ningngi ninggni
ninggin ningign ninging ninggin ninggni ningngi ningnig nigning nignign nignnig nignngi
nigngni nigngin niginng nigingn niginng nigingn nigignn nigignn nigning nignign nignnig
nignngi nigngni nigngin nigginn nigginn niggnin niggnni niggnni niggnin ngining nginign
nginnig nginngi ngingni ngingin ngiinng ngiingn ngiinng ngiingn ngiignn ngiignn ngining
nginign nginnig nginngi ngingni ngingin ngiginn ngiginn ngignin ngignni ngignni ngignin
ngniing ngniign ngninig ngningi ngnigni ngnigin ngniing ngniign ngninig ngningi ngnigni
ngnigin ngnniig ngnnigi ngnniig ngnnigi ngnngii ngnngii ngngini ngngiin ngngnii ngngnii
ngngini ngngiin ngining nginign nginnig nginngi ngingni ngingin ngiinng ngiingn ngiinng
ngiingn ngiignn ngiignn ngining nginign nginnig nginngi ngingni ngingin ngiginn ngiginn
ngignin ngignni ngignni ngignin ngnniig ngnnigi ngnniig ngnnigi ngnngii ngnngii ngninig
ngningi ngniing ngniign ngnigin ngnigni ngniing ngniign ngninig ngningi ngnigni ngnigin
ngngiin ngngini ngngiin ngngini ngngnii ngngnii nggnini nggniin nggnnii nggnnii nggnini
nggniin ngginni ngginin ngginni ngginin nggiinn nggiinn nggnini nggniin nggnnii nggnnii
nggnini nggniin nggiinn nggiinn ngginin ngginni ngginni ngginin nngiing nngiign nnginig
nngingi nngigni nngigin nngiing nngiign nnginig nngingi nngigni nngigin nngniig nngnigi
nngniig nngnigi nngngii nngngii nnggini nnggiin nnggnii nnggnii nnggini nnggiin nniging
nnigign nnignig nnigngi nniggni nniggin nniigng nniiggn nniingg nniingg nniigng nniiggn
nninigg nninigg nningig nninggi nninggi nningig nniging nnigign nnignig nnigngi nniggni
nniggin nniigng nniiggn nniingg nniingg nniigng nniiggn nniging nnigign nnignig nnigngi
nniggni nniggin nningig nninggi nninigg nninigg nningig nninggi nniggni nniggin nnigngi
nnignig nniging nnigign nnniigg nnniigg nnnigig nnniggi nnniggi nnnigig nnniigg nnniigg
nnnigig nnniggi nnniggi nnnigig nnngiig nnngigi nnngiig nnngigi nnnggii nnnggii nnngigi
nnngiig nnnggii nnnggii nnngigi nnngiig nngiing nngiign nnginig nngingi nngigni nngigin
nngiing nngiign nnginig nngingi nngigni nngigin nngniig nngnigi nngniig nngnigi nngngii
nngngii nnggini nnggiin nnggnii nnggnii nnggini nnggiin nigning nignign nignnig nignngi
nigngni nigngin niginng nigingn niginng nigingn nigignn nigignn nigning nignign nignnig
nignngi nigngni nigngin nigginn nigginn niggnin niggnni niggnni niggnin ninging ningign
ningnig ningngi ninggni ninggin ninigng niniggn niningg niningg ninigng niniggn ninnigg
ninnigg ninngig ninnggi ninnggi ninngig ninging ningign ningnig ningngi ninggni ninggin
niingng niinggn niinngg niinngg niingng niinggn niignng niigngn niignng niigngn niiggnn
niiggnn niingng niinggn niinngg niinngg niingng niinggn niiggnn niiggnn niigngn niignng
niignng niigngn ninnigg ninnigg ninngig ninnggi ninnggi ninngig niningg niningg ninigng
niniggn niniggn ninigng ninging ningign ningnig ningngi ninggni ninggin ningign ninging
ninggin ninggni ningngi ningnig nigning nignign nignnig nignngi nigngni nigngin niginng
nigingn niginng nigingn nigignn nigignn nigning nignign nignnig nignngi nigngni nigngin
nigginn nigginn niggnin niggnni niggnni niggnin nngniig nngnigi nngniig nngnigi nngngii
nngngii nnginig nngingi nngiing nngiign nngigin nngigni nngiing nngiign nnginig nngingi
nngigni nngigin nnggiin nnggini nnggiin nnggini nnggnii nnggnii nnngiig nnngigi nnngiig
nnngigi nnnggii nnnggii nnnigig nnniggi nnniigg nnniigg nnnigig nnniggi nnniigg nnniigg
nnnigig nnniggi nnniggi nnnigig nnngiig nnngigi nnngiig nnngigi nnnggii nnnggii nningig
nninggi nninigg nninigg nningig nninggi nnignig nnigngi nniging nnigign nniggin nniggni
nniigng nniiggn nniingg nniingg nniigng nniiggn nniggin nniggni nnigign nniging nnignig
nnigngi nninigg nninigg nningig nninggi nninggi nningig nniingg nniingg nniigng nniiggn
nniiggn nniigng nniging nnigign nnignig nnigngi nniggni nniggin nnigign nniging nniggin
nniggni nnigngi nnignig nngniig nngnigi nngniig nngnigi nngngii nngngii nnginig nngingi
nngiing nngiign nngigin nngigni nngiing nngiign nnginig nngingi nngigni nngigin nnggiin
nnggini nnggiin nnggini nnggnii nnggnii nggnini nggniin nggnnii nggnnii nggnini nggniin
ngginni ngginin ngginni ngginin nggiinn nggiinn nggnini nggniin nggnnii nggnnii nggnini
nggniin nggiinn nggiinn ngginin ngginni ngginni ngginin ngngini ngngiin ngngnii ngngnii
ngngini ngngiin ngnigni ngnigin ngningi ngninig ngniing ngniign ngnnigi ngnniig ngnngii
ngnngii ngnnigi ngnniig ngniing ngniign ngninig ngningi ngnigni ngnigin ngingni ngingin
nginngi nginnig ngining nginign ngignni ngignin ngignni ngignin ngiginn ngiginn ngingni
ngingin nginngi nginnig ngining nginign ngiignn ngiignn ngiingn ngiinng ngiinng ngiingn
ngnnigi ngnniig ngnngii ngnngii ngnnigi ngnniig ngningi ngninig ngnigni ngnigin ngniign
ngniing ngngini ngngiin ngngnii ngngnii ngngini ngngiin ngniign ngniing ngnigin ngnigni
ngningi ngninig ngining nginign nginnig nginngi ngingni ngingin ngiinng ngiingn ngiinng
ngiingn ngiignn ngiignn ngining nginign nginnig nginngi ngingni ngingin ngiginn ngiginn
ngignin ngignni ngignni ngignin ninging ningign ningnig ningngi ninggni ninggin ninigng
niniggn niningg niningg ninigng niniggn ninnigg ninnigg ninngig ninnggi ninnggi ninngig
ninging ningign ningnig ningngi ninggni ninggin nigning nignign nignnig nignngi nigngni
nigngin niginng nigingn niginng nigingn nigignn nigignn nigning nignign nignnig nignngi
nigngni nigngin nigginn nigginn niggnin niggnni niggnni niggnin niignng niigngn niignng
niigngn niiggnn niiggnn niingng niinggn niinngg niinngg niingng niinggn niinngg niinngg
niingng niinggn niinggn niingng niignng niigngn niignng niigngn niiggnn niiggnn ninging
ningign ningnig ningngi ninggni ninggin ninigng niniggn niningg niningg ninigng niniggn
ninnigg ninnigg ninngig ninnggi ninnggi ninngig ninging ningign ningnig ningngi ninggni
ninggin nigginn nigginn niggnin niggnni niggnni niggnin nigignn nigignn nigingn niginng
niginng nigingn nignign nigning nigngin nigngni nignngi nignnig nigning nignign nignnig
nignngi nigngni nigngin nniging nnigign nnignig nnigngi nniggni nniggin nniigng nniiggn
nniingg nniingg nniigng nniiggn nninigg nninigg nningig nninggi nninggi nningig nniging
nnigign nnignig nnigngi nniggni nniggin nngiing nngiign nnginig nngingi nngigni nngigin
nngiing nngiign nnginig nngingi nngigni nngigin nngniig nngnigi nngniig nngnigi nngngii
nngngii nnggini nnggiin nnggnii nnggnii nnggini nnggiin nniging nnigign nnignig nnigngi
nniggni nniggin nniigng nniiggn nniingg nniingg nniigng nniiggn nninigg nninigg nningig
nninggi nninggi nningig nniging nnigign nnignig nnigngi nniggni nniggin nnngiig nnngigi
nnngiig nnngigi nnnggii nnnggii nnnigig nnniggi nnniigg nnniigg nnnigig nnniggi nnniigg
nnniigg nnnigig nnniggi nnniggi nnnigig nnngiig nnngigi nnngiig nnngigi nnnggii nnnggii
nnggini nnggiin nnggnii nnggnii nnggini nnggiin nngigni nngigin nngingi nnginig nngiing
nngiign nngnigi nngniig nngngii nngngii nngnigi nngniig nngiing nngiign nnginig nngingi
nngigni nngigin ngniing ngniign ngninig ngningi ngnigni ngnigin ngniing ngniign ngninig
ngningi ngnigni ngnigin ngnniig ngnnigi ngnniig ngnnigi ngnngii ngnngii ngngini ngngiin
ngngnii ngngnii ngngini ngngiin ngining nginign nginnig nginngi ngingni ngingin ngiinng
ngiingn ngiinng ngiingn ngiignn ngiignn ngining nginign nginnig nginngi ngingni ngingin
ngiginn ngiginn ngignin ngignni ngignni ngignin ngiinng ngiingn ngiinng ngiingn ngiignn
ngiignn ngining nginign nginnig nginngi ngingni ngingin nginnig nginngi ngining nginign
ngingin ngingni ngignni ngignin ngignni ngignin ngiginn ngiginn ngniing ngniign ngninig
ngningi ngnigni ngnigin ngniing ngniign ngninig ngningi ngnigni ngnigin ngnniig ngnnigi
ngnniig ngnnigi ngnngii ngnngii ngngini ngngiin ngngnii ngngnii ngngini ngngiin nggiinn
nggiinn ngginin ngginni ngginni ngginin nggiinn nggiinn ngginin ngginni ngginni ngginin
nggniin nggnini nggniin nggnini nggnnii nggnnii nggnini nggniin nggnnii nggnnii nggnini
nggniin ninging ningign ningnig ningngi ninggni ninggin ninigng niniggn niningg niningg
ninigng niniggn ninnigg ninnigg ninngig ninnggi ninnggi ninngig ninging ningign ningnig
ningngi ninggni ninggin nigning nignign nignnig nignngi nigngni nigngin niginng nigingn
niginng nigingn nigignn nigignn nigning nignign nignnig nignngi nigngni nigngin nigginn
nigginn niggnin niggnni niggnni niggnin niignng niigngn niignng niigngn niiggnn niiggnn
niingng niinggn niinngg niinngg niingng niinggn niinngg niinngg niingng niinggn niinggn
niingng niignng niigngn niignng niigngn niiggnn niiggnn ninging ningign ningnig ningngi
ninggni ninggin ninigng niniggn niningg niningg ninigng niniggn ninnigg ninnigg ninngig
ninnggi ninnggi ninngig ninging ningign ningnig ningngi ninggni ninggin nigginn nigginn
niggnin niggnni niggnni niggnin nigignn nigignn nigingn niginng niginng nigingn nignign
nigning nigngin nigngni nignngi nignnig nigning nignign nignnig nignngi nigngni nigngin
nnngiig nnngigi nnngiig nnngigi nnnggii nnnggii nnnigig nnniggi nnniigg nnniigg nnnigig
nnniggi nnniigg nnniigg nnnigig nnniggi nnniggi nnnigig nnngiig nnngigi nnngiig nnngigi
nnnggii nnnggii nngniig nngnigi nngniig nngnigi nngngii nngngii nnginig nngingi nngiing
nngiign nngigin nngigni nngiing nngiign nnginig nngingi nngigni nngigin nnggiin nnggini
nnggiin nnggini nnggnii nnggnii nnignig nnigngi nniging nnigign nniggin nniggni nningig
nninggi nninigg nninigg nningig nninggi nniingg nniingg nniigng nniiggn nniiggn nniigng
nnignig nnigngi nniging nnigign nniggin nniggni nniging nnigign nnignig nnigngi nniggni
nniggin nniigng nniiggn nniingg nniingg nniigng nniiggn nninigg nninigg nningig nninggi
nninggi nningig nniging nnigign nnignig nnigngi nniggni nniggin nnggiin nnggini nnggiin
nnggini nnggnii nnggnii nngigin nngigni nngiign nngiing nnginig nngingi nngiign nngiing
nngigin nngigni nngingi nnginig nngniig nngnigi nngniig nngnigi nngngii nngngii ngngini
ngngiin ngngnii ngngnii ngngini ngngiin ngnigni ngnigin ngningi ngninig ngniing ngniign
ngnnigi ngnniig ngnngii ngnngii ngnnigi ngnniig ngniing ngniign ngninig ngningi ngnigni
ngnigin nggnini nggniin nggnnii nggnnii nggnini nggniin ngginni ngginin ngginni ngginin
nggiinn nggiinn nggnini nggniin nggnnii nggnnii nggnini nggniin nggiinn nggiinn ngginin
ngginni ngginni ngginin ngignni ngignin ngignni ngignin ngiginn ngiginn ngingni ngingin
nginngi nginnig ngining nginign nginngi nginnig ngingni ngingin nginign ngining ngiinng
ngiingn ngiinng ngiingn ngiignn ngiignn ngngini ngngiin ngngnii ngngnii ngngini ngngiin
ngnigni ngnigin ngningi ngninig ngniing ngniign ngnnigi ngnniig ngnngii ngnngii ngnnigi
ngnniig ngniing ngniign ngninig ngningi ngnigni ngnigin ngiginn ngiginn ngignin ngignni
ngignni ngignin ngiignn ngiignn ngiingn ngiinng ngiinng ngiingn nginign ngining ngingin
ngingni nginngi nginnig ngining nginign nginnig nginngi ngingni ngingin iinngng iinnggn
iinnngg iinnngg iinngng iinnggn iingnng iingngn iingnng iingngn iinggnn iinggnn iinngng
iinnggn iinnngg iinnngg iinngng iinnggn iinggnn iinggnn iingngn iingnng iingnng iingngn
iinngng iinnggn iinnngg iinnngg iinngng iinnggn iingnng iingngn iingnng iingngn iinggnn
iinggnn iinngng iinnggn iinnngg iinnngg iinngng iinnggn iinggnn iinggnn iingngn iingnng
iingnng iingngn iignnng iignngn iignnng iignngn iigngnn iigngnn iignnng iignngn iignnng
iignngn iigngnn iigngnn iignnng iignngn iignnng iignngn iigngnn iigngnn iiggnnn iiggnnn
iiggnnn iiggnnn iiggnnn iiggnnn iinngng iinnggn iinnngg iinnngg iinngng iinnggn iingnng
iingngn iingnng iingngn iinggnn iinggnn iinngng iinnggn iinnngg iinnngg iinngng iinnggn
iinggnn iinggnn iingngn iingnng iingnng iingngn iigngnn iigngnn iignngn iignnng iignnng
iignngn iiggnnn iiggnnn iiggnnn iiggnnn iiggnnn iiggnnn iigngnn iigngnn iignngn iignnng
iignnng iignngn iigngnn iigngnn iignngn iignnng iignnng iignngn iningng ininggn ininngg
ininngg iningng ininggn inignng inigngn inignng inigngn iniggnn iniggnn iningng ininggn
ininngg ininngg iningng ininggn iniggnn iniggnn inigngn inignng inignng inigngn innigng
inniggn inningg inningg innigng inniggn innging inngign inngnig inngngi innggni innggin
innngig innnggi innnigg innnigg innngig innnggi innggni innggin inngngi inngnig innging
inngign ingning ingnign ingnnig ingnngi ingngni ingngin inginng ingingn inginng ingingn
ingignn ingignn ingning ingnign ingnnig ingnngi ingngni ingngin ingginn ingginn inggnin
inggnni inggnni inggnin innngig innnggi innnigg innnigg innngig innnggi inngnig inngngi
innging inngign innggin innggni innigng inniggn inningg inningg innigng inniggn innggin
innggni inngign innging inngnig inngngi ingngni ingngin ingnngi ingnnig ingning ingnign
inggnni inggnin inggnni inggnin ingginn ingginn ingngni ingngin ingnngi ingnnig ingning
ingnign ingignn ingignn ingingn inginng inginng ingingn innigng inniggn inningg inningg
innigng inniggn innging inngign inngnig inngngi innggni innggin innngig innnggi innnigg
innnigg innngig innnggi innggni innggin inngngi inngnig innging inngign iningng ininggn
ininngg ininngg iningng ininggn inignng inigngn inignng inigngn iniggnn iniggnn iningng
ininggn ininngg ininngg iningng ininggn iniggnn iniggnn inigngn inignng inignng inigngn
inginng ingingn inginng ingingn ingignn ingignn ingning ingnign ingnnig ingnngi ingngni
ingngin ingnnig ingnngi ingning ingnign ingngin ingngni inggnni inggnin inggnni inggnin
ingginn ingginn innigng inniggn inningg inningg innigng inniggn innging inngign inngnig
inngngi innggni innggin innngig innnggi innnigg innnigg innngig innnggi innggni innggin
inngngi inngnig innging inngign ingignn ingignn ingingn inginng inginng ingingn ingginn
ingginn inggnin inggnni inggnni inggnin ingngin ingngni ingnign ingning ingnnig ingnngi
ingngni ingngin ingnngi ingnnig ingning ingnign ignning ignnign ignnnig ignnngi ignngni
ignngin igninng igningn igninng igningn ignignn ignignn ignning ignnign ignnnig ignnngi
ignngni ignngin ignginn ignginn igngnin igngnni igngnni igngnin ignning ignnign ignnnig
ignnngi ignngni ignngin igninng igningn igninng igningn ignignn ignignn ignning ignnign
ignnnig ignnngi ignngni ignngin ignginn ignginn igngnin igngnni igngnni igngnin iginnng
iginngn iginnng iginngn igingnn igingnn iginnng iginngn iginnng iginngn igingnn igingnn
iginnng iginngn iginnng iginngn igingnn igingnn igignnn igignnn igignnn igignnn igignnn
igignnn ignning ignnign ignnnig ignnngi ignngni ignngin igninng igningn igninng igningn
ignignn ignignn ignning ignnign ignnnig ignnngi ignngni ignngin ignginn ignginn igngnin
igngnni igngnni igngnin iggninn iggninn iggnnin iggnnni iggnnni iggnnin igginnn igginnn
igginnn igginnn igginnn igginnn iggninn iggninn iggnnin iggnnni iggnnni iggnnin iggninn
iggninn iggnnin iggnnni iggnnni iggnnin innngig innnggi innnigg innnigg innngig innnggi
inngnig inngngi innging inngign innggin innggni innigng inniggn inningg inningg innigng
inniggn innggin innggni inngign innging inngnig inngngi innngig innnggi innnigg innnigg
innngig innnggi inngnig inngngi innging inngign innggin innggni innigng inniggn inningg
inningg innigng inniggn innggin innggni inngign innging inngnig inngngi ingnnig ingnngi
ingning ingnign ingngin ingngni ingnnig ingnngi ingning ingnign ingngin ingngni inginng
ingingn inginng ingingn ingignn ingignn inggnin inggnni ingginn ingginn inggnin inggnni
iningng ininggn ininngg ininngg iningng ininggn inignng inigngn inignng inigngn iniggnn
iniggnn iningng ininggn ininngg ininngg iningng ininggn iniggnn iniggnn inigngn inignng
inignng inigngn ingngin ingngni ingnign ingning ingnnig ingnngi inggnin inggnni ingginn
ingginn inggnin inggnni ingignn ingignn ingingn inginng inginng ingingn ingngin ingngni
ingnign ingning ingnnig ingnngi ignngni ignngin ignnngi ignnnig ignning ignnign igngnni
igngnin igngnni igngnin ignginn ignginn ignngni ignngin ignnngi ignnnig ignning ignnign
ignignn ignignn igningn igninng igninng igningn ignngni ignngin ignnngi ignnnig ignning
ignnign igngnni igngnin igngnni igngnin ignginn ignginn ignngni ignngin ignnngi ignnnig
ignning ignnign ignignn ignignn igningn igninng igninng igningn iggnnni iggnnin iggnnni
iggnnin iggninn iggninn iggnnni iggnnin iggnnni iggnnin iggninn iggninn iggnnni iggnnin
iggnnni iggnnin iggninn iggninn igginnn igginnn igginnn igginnn igginnn igginnn ignngni
ignngin ignnngi ignnnig ignning ignnign igngnni igngnin igngnni igngnin ignginn ignginn
ignngni ignngin ignnngi ignnnig ignning ignnign ignignn ignignn igningn igninng igninng
igningn igingnn igingnn iginngn iginnng iginnng iginngn igignnn igignnn igignnn igignnn
igignnn igignnn igingnn igingnn iginngn iginnng iginnng iginngn igingnn igingnn iginngn
iginnng iginnng iginngn ninnigg ninnigg ninngig ninnggi ninnggi ninngig niningg niningg
ninigng niniggn niniggn ninigng ninging ningign ningnig ningngi ninggni ninggin ningign
ninging ninggin ninggni ningngi ningnig ninnigg ninnigg ninngig ninnggi ninnggi ninngig
niningg niningg ninigng niniggn niniggn ninigng ninging ningign ningnig ningngi ninggni
ninggin ningign ninging ninggin ninggni ningngi ningnig niinngg niinngg niingng niinggn
niinggn niingng niinngg niinngg niingng niinggn niinggn niingng niignng niigngn niignng
niigngn niiggnn niiggnn niigngn niignng niiggnn niiggnn niigngn niignng nigning nignign
nignnig nignngi nigngni nigngin niginng nigingn niginng nigingn nigignn nigignn nigning
nignign nignnig nignngi nigngni nigngin nigginn nigginn niggnin niggnni niggnni niggnin
nignign nigning nigngin nigngni nignngi nignnig nigingn niginng nigignn nigignn nigingn
niginng nigginn nigginn niggnin niggnni niggnni niggnin nignign nigning nigngin nigngni
nignngi nignnig nninigg nninigg nningig nninggi nninggi nningig nniingg nniingg nniigng
nniiggn nniiggn nniigng nniging nnigign nnignig nnigngi nniggni nniggin nnigign nniging
nniggin nniggni nnigngi nnignig nnniigg nnniigg nnnigig nnniggi nnniggi nnnigig nnniigg
nnniigg nnnigig nnniggi nnniggi nnnigig nnngiig nnngigi nnngiig nnngigi nnnggii nnnggii
nnngigi nnngiig nnnggii nnnggii nnngigi nnngiig nninigg nninigg nningig nninggi nninggi
nningig nniingg nniingg nniigng nniiggn nniiggn nniigng nniging nnigign nnignig nnigngi
nniggni nniggin nnigign nniging nniggin nniggni nnigngi nnignig nngniig nngnigi nngniig
nngnigi nngngii nngngii nnginig nngingi nngiing nngiign nngigin nngigni nngiing nngiign
nnginig nngingi nngigni nngigin nnggiin nnggini nnggiin nnggini nnggnii nnggnii nngnigi
nngniig nngngii nngngii nngnigi nngniig nngingi nnginig nngigni nngigin nngiign nngiing
nnggini nnggiin nnggnii nnggnii nnggini nnggiin nngiign nngiing nngigin nngigni nngingi
nnginig nnniigg nnniigg nnnigig nnniggi nnniggi nnnigig nnniigg nnniigg nnnigig nnniggi
nnniggi nnnigig nnngiig nnngigi nnngiig nnngigi nnnggii nnnggii nnngigi nnngiig nnnggii
nnnggii nnngigi nnngiig nninigg nninigg nningig nninggi nninggi nningig nniingg nniingg
nniigng nniiggn nniiggn nniigng nniging nnigign nnignig nnigngi nniggni nniggin nnigign
nniging nniggin nniggni nnigngi nnignig nniingg nniingg nniigng nniiggn nniiggn nniigng
nninigg nninigg nningig nninggi nninggi nningig nnignig nnigngi nniging nnigign nniggin
nniggni nnigngi nnignig nniggni nniggin nnigign nniging nngiing nngiign nnginig nngingi
nngigni nngigin nngiing nngiign nnginig nngingi nngigni nngigin nngniig nngnigi nngniig
nngnigi nngngii nngngii nnggini nnggiin nnggnii nnggnii nnggini nnggiin nngiign nngiing
nngigin nngigni nngingi nnginig nngiign nngiing nngigin nngigni nngingi nnginig nnggiin
nnggini nnggiin nnggini nnggnii nnggnii nngnigi nngniig nngngii nngngii nngnigi nngniig
ninnigg ninnigg ninngig ninnggi ninnggi ninngig niningg niningg ninigng niniggn niniggn
ninigng ninging ningign ningnig ningngi ninggni ninggin ningign ninging ninggin ninggni
ningngi ningnig ninnigg ninnigg ninngig ninnggi ninnggi ninngig niningg niningg ninigng
niniggn niniggn ninigng ninging ningign ningnig ningngi ninggni ninggin ningign ninging
ninggin ninggni ningngi ningnig niinngg niinngg niingng niinggn niinggn niingng niinngg
niinngg niingng niinggn niinggn niingng niignng niigngn niignng niigngn niiggnn niiggnn
niigngn niignng niiggnn niiggnn niigngn niignng nigning nignign nignnig nignngi nigngni
nigngin niginng nigingn niginng nigingn nigignn nigignn nigning nignign nignnig nignngi
nigngni nigngin nigginn nigginn niggnin niggnni niggnni niggnin nignign nigning nigngin
nigngni nignngi nignnig nigingn niginng nigignn nigignn nigingn niginng nigginn nigginn
niggnin niggnni niggnni niggnin nignign nigning nigngin nigngni nignngi nignnig ngnniig
ngnnigi ngnniig ngnnigi ngnngii ngnngii ngninig ngningi ngniing ngniign ngnigin ngnigni
ngniing ngniign ngninig ngningi ngnigni ngnigin ngngiin ngngini ngngiin ngngini ngngnii
ngngnii ngnniig ngnnigi ngnniig ngnnigi ngnngii ngnngii ngninig ngningi ngniing ngniign
ngnigin ngnigni ngniing ngniign ngninig ngningi ngnigni ngnigin ngngiin ngngini ngngiin
ngngini ngngnii ngngnii nginnig nginngi ngining nginign ngingin ngingni nginnig nginngi
ngining nginign ngingin ngingni ngiinng ngiingn ngiinng ngiingn ngiignn ngiignn ngignin
ngignni ngiginn ngiginn ngignin ngignni ngining nginign nginnig nginngi ngingni ngingin
ngiinng ngiingn ngiinng ngiingn ngiignn ngiignn ngining nginign nginnig nginngi ngingni
ngingin ngiginn ngiginn ngignin ngignni ngignni ngignin nggniin nggnini nggniin nggnini
nggnnii nggnnii ngginin ngginni nggiinn nggiinn ngginin ngginni nggiinn nggiinn ngginin
ngginni ngginni ngginin nggniin nggnini nggniin nggnini nggnnii nggnnii ngnnigi ngnniig
ngnngii ngnngii ngnnigi ngnniig ngningi ngninig ngnigni ngnigin ngniign ngniing ngngini
ngngiin ngngnii ngngnii ngngini ngngiin ngniign ngniing ngnigin ngnigni ngningi ngninig
ngnnigi ngnniig ngnngii ngnngii ngnnigi ngnniig ngningi ngninig ngnigni ngnigin ngniign
ngniing ngngini ngngiin ngngnii ngngnii ngngini ngngiin ngniign ngniing ngnigin ngnigni
ngningi ngninig nginngi nginnig ngingni ngingin nginign ngining nginngi nginnig ngingni
ngingin nginign ngining ngignni ngignin ngignni ngignin ngiginn ngiginn ngiingn ngiinng
ngiignn ngiignn ngiingn ngiinng nggnini nggniin nggnnii nggnnii nggnini nggniin ngginni
ngginin ngginni ngginin nggiinn nggiinn nggnini nggniin nggnnii nggnnii nggnini nggniin
nggiinn nggiinn ngginin ngginni ngginni ngginin nginign ngining ngingin ngingni nginngi
nginnig ngiingn ngiinng ngiignn ngiignn ngiingn ngiinng ngiginn ngiginn ngignin ngignni
ngignni ngignin nginign ngining ngingin ngingni nginngi nginnig ginning ginnign ginnnig
ginnngi ginngni ginngin gininng giningn gininng giningn ginignn ginignn ginning ginnign
ginnnig ginnngi ginngni ginngin ginginn ginginn gingnin gingnni gingnni gingnin ginning
ginnign ginnnig ginnngi ginngni ginngin gininng giningn gininng giningn ginignn ginignn
ginning ginnign ginnnig ginnngi ginngni ginngin ginginn ginginn gingnin gingnni gingnni
gingnin giinnng giinngn giinnng giinngn giingnn giingnn giinnng giinngn giinnng giinngn
giingnn giingnn giinnng giinngn giinnng giinngn giingnn giingnn giignnn giignnn giignnn
giignnn giignnn giignnn ginning ginnign ginnnig ginnngi ginngni ginngin gininng giningn
gininng giningn ginignn ginignn ginning ginnign ginnnig ginnngi ginngni ginngin ginginn
ginginn gingnin gingnni gingnni gingnin gigninn gigninn gignnin gignnni gignnni gignnin
giginnn giginnn giginnn giginnn giginnn giginnn gigninn gigninn gignnin gignnni gignnni
gignnin gigninn gigninn gignnin gignnni gignnni gignnin gnining gninign gninnig gninngi
gningni gningin gniinng gniingn gniinng gniingn gniignn gniignn gnining gninign gninnig
gninngi gningni gningin gniginn gniginn gnignin gnignni gnignni gnignin gnniing gnniign
gnninig gnningi gnnigni gnnigin gnniing gnniign gnninig gnningi gnnigni gnnigin gnnniig
gnnnigi gnnniig gnnnigi gnnngii gnnngii gnngini gnngiin gnngnii gnngnii gnngini gnngiin
gnining gninign gninnig gninngi gningni gningin gniinng gniingn gniinng gniingn gniignn
gniignn gnining gninign gninnig gninngi gningni gningin gniginn gniginn gnignin gnignni
gnignni gnignin gnnniig gnnnigi gnnniig gnnnigi gnnngii gnnngii gnninig gnningi gnniing
gnniign gnnigin gnnigni gnniing gnniign gnninig gnningi gnnigni gnnigin gnngiin gnngini
gnngiin gnngini gnngnii gnngnii gngnini gngniin gngnnii gngnnii gngnini gngniin gnginni
gnginin gnginni gnginin gngiinn gngiinn gngnini gngniin gngnnii gngnnii gngnini gngniin
gngiinn gngiinn gnginin gnginni gnginni gnginin gnniing gnniign gnninig gnningi gnnigni
gnnigin gnniing gnniign gnninig gnningi gnnigni gnnigin gnnniig gnnnigi gnnniig gnnnigi
gnnngii gnnngii gnngini gnngiin gnngnii gnngnii gnngini gnngiin gnining gninign gninnig
gninngi gningni gningin gniinng gniingn gniinng gniingn gniignn gniignn gnining gninign
gninnig gninngi gningni gningin gniginn gniginn gnignin gnignni gnignni gnignin gniinng
gniingn gniinng gniingn gniignn gniignn gnining gninign gninnig gninngi gningni gningin
gninnig gninngi gnining gninign gningin gningni gnignni gnignin gnignni gnignin gniginn
gniginn gnniing gnniign gnninig gnningi gnnigni gnnigin gnniing gnniign gnninig gnningi
gnnigni gnnigin gnnniig gnnnigi gnnniig gnnnigi gnnngii gnnngii gnngini gnngiin gnngnii
gnngnii gnngini gnngiin gngiinn gngiinn gnginin gnginni gnginni gnginin gngiinn gngiinn
gnginin gnginni gnginni gnginin gngniin gngnini gngniin gngnini gngnnii gngnnii gngnini
gngniin gngnnii gngnnii gngnini gngniin ginning ginnign ginnnig ginnngi ginngni ginngin
gininng giningn gininng giningn ginignn ginignn ginning ginnign ginnnig ginnngi ginngni
ginngin ginginn ginginn gingnin gingnni gingnni gingnin ginning ginnign ginnnig ginnngi
ginngni ginngin gininng giningn gininng giningn ginignn ginignn ginning ginnign ginnnig
ginnngi ginngni ginngin ginginn ginginn gingnin gingnni gingnni gingnin giinnng giinngn
giinnng giinngn giingnn giingnn giinnng giinngn giinnng giinngn giingnn giingnn giinnng
giinngn giinnng giinngn giingnn giingnn giignnn giignnn giignnn giignnn giignnn giignnn
ginning ginnign ginnnig ginnngi ginngni ginngin gininng giningn gininng giningn ginignn
ginignn ginning ginnign ginnnig ginnngi ginngni ginngin ginginn ginginn gingnin gingnni
gingnni gingnin gigninn gigninn gignnin gignnni gignnni gignnin giginnn giginnn giginnn
giginnn giginnn giginnn gigninn gigninn gignnin gignnni gignnni gignnin gigninn gigninn
gignnin gignnni gignnni gignnin gnnniig gnnnigi gnnniig gnnnigi gnnngii gnnngii gnninig
gnningi gnniing gnniign gnnigin gnnigni gnniing gnniign gnninig gnningi gnnigni gnnigin
gnngiin gnngini gnngiin gnngini gnngnii gnngnii gnnniig gnnnigi gnnniig gnnnigi gnnngii
gnnngii gnninig gnningi gnniing gnniign gnnigin gnnigni gnniing gnniign gnninig gnningi
gnnigni gnnigin gnngiin gnngini gnngiin gnngini gnngnii gnngnii gninnig gninngi gnining
gninign gningin gningni gninnig gninngi gnining gninign gningin gningni gniinng gniingn
gniinng gniingn gniignn gniignn gnignin gnignni gniginn gniginn gnignin gnignni gnining
gninign gninnig gninngi gningni gningin gniinng gniingn gniinng gniingn gniignn gniignn
gnining gninign gninnig gninngi gningni gningin gniginn gniginn gnignin gnignni gnignni
gnignin gngniin gngnini gngniin gngnini gngnnii gngnnii gnginin gnginni gngiinn gngiinn
gnginin gnginni gngiinn gngiinn gnginin gnginni gnginni gnginin gngniin gngnini gngniin
gngnini gngnnii gngnnii ggnnini ggnniin ggnnnii ggnnnii ggnnini ggnniin ggninni ggninin
ggninni ggninin ggniinn ggniinn ggnnini ggnniin ggnnnii ggnnnii ggnnini ggnniin ggniinn
ggniinn ggninin ggninni ggninni ggninin ggnnini ggnniin ggnnnii ggnnnii ggnnini ggnniin
ggninni ggninin ggninni ggninin ggniinn ggniinn ggnnini ggnniin ggnnnii ggnnnii ggnnini
ggnniin ggniinn ggniinn ggninin ggninni ggninni ggninin gginnni gginnin gginnni gginnin
ggininn ggininn gginnni gginnin gginnni gginnin ggininn ggininn gginnni gginnin gginnni
gginnin ggininn ggininn ggiinnn ggiinnn ggiinnn ggiinnn ggiinnn ggiinnn ggnnini ggnniin
ggnnnii ggnnnii ggnnini ggnniin ggninni ggninin ggninni ggninin ggniinn ggniinn ggnnini
ggnniin ggnnnii ggnnnii ggnnini ggnniin ggniinn ggniinn ggninin ggninni ggninni ggninin
ggininn ggininn gginnin gginnni gginnni gginnin ggiinnn ggiinnn ggiinnn ggiinnn ggiinnn
ggiinnn ggininn ggininn gginnin gginnni gginnni gginnin ggininn ggininn gginnin gginnni
gginnni gginnin

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us