easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

tariny

repetitory

trichloromethyl

nestled

randn

angarola

tetrabromophthalic

groundly

tolosatiumque

biteable

laborage

horatique

ostracum

indebted

electromerism

volpes

seders

apelike


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: gillig
cipher variations:
hjmmjh iknnki jloolj kmppmk lnqqnl
morrom npsspn oqttqo pruurp qsvvsq
rtwwtr suxxus tvyyvt uwzzwu vxaaxv
wybbyw xzcczx yadday zbeebz acffca
bdggdb cehhec dfiifd egjjge fhkkhf

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: gillig
Cipher: troort

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: gillig
Cipher: AABBA ABAAA ABABA ABABA ABAAA AABBA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: gillig
cipher variations:
hjmmjhtziiztfpeepfrfaafrdvwwvdplsslpnrkkrnzhgghz
lxccxlxnyynxjduudjvtqqtviknnkiuajjaugqffqgsgbbgs
ewxxweqmttmqosllsoaihhiamyddymyozzoykevvekwurruw
jlooljvbkkbvhrggrhthcchtfxyyxfrnuunrptmmtpbjiijb
nzeeznzpaapzlfwwflxvssvxkmppmkwcllcwishhsiuiddiu
gyzzygsovvosqunnuqckjjkcoaffaoaqbbqamgxxgmywttwy
lnqqnlxdmmdxjtiitjvjeejvhzaazhtpwwptrvoovrdlkkld
pbggbpbrccrbnhyyhnzxuuxzmorromyenneykujjukwkffkw
iabbaiuqxxquswppwsemllmeqchhcqcsddscoizzioayvvya
npsspnzfoofzlvkkvlxlgglxjbccbjvryyrvtxqqxtfnmmnf
rdiidrdteetdpjaajpbzwwzboqttqoagppgamwllwmymhhmy
kcddckwszzswuyrryugonnogsejjeseuffueqkbbkqcaxxac
pruurpbhqqhbnxmmxnzniinzldeedlxtaatxvzsszvhpooph
tfkkftfvggvfrlcclrdbyybdqsvvsqcirricoynnyoaojjoa
meffemyubbuywattawiqppqiugllgugwhhwgsmddmseczzce
rtwwtrdjssjdpzoozpbpkkpbnfggfnzvccvzxbuubxjrqqrj
vhmmhvhxiixhtneentfdaadfsuxxusekttkeqappaqcqllqc
oghhgoawddwaycvvcyksrrskwinniwiyjjyiuoffougebbeg
tvyyvtfluulfrbqqbrdrmmrdphiihpbxeexbzdwwdzltsstl
xjoojxjzkkzjvpggpvhfccfhuwzzwugmvvmgscrrcsesnnse
qijjiqcyffycaexxeamuttumykppkykallakwqhhqwigddgi
vxaaxvhnwwnhtdssdtftootfrjkkjrdzggzdbfyyfbnvuuvn
zlqqlzlbmmblxriirxjheehjwybbywioxxoiuetteuguppug
skllkseahhaecgzzgcowvvwoamrrmamcnncmysjjsykiffik
xzcczxjpyypjvfuufvhvqqvhtlmmltfbiibfdhaahdpxwwxp
bnssnbndoodnztkktzljggjlyaddaykqzzqkwgvvgwiwrrwi
umnnmugcjjcgeibbieqyxxyqcottocoeppeoaulluamkhhkm
zbeebzlraarlxhwwhxjxssxjvnoonvhdkkdhfjccjfrzyyzr
dpuupdpfqqfpbvmmvbnliilnacffcamsbbsmyixxiykyttyk
woppowielleigkddkgsazzaseqvvqeqgrrgqcwnnwcomjjmo
bdggdbntcctnzjyyjzlzuuzlxpqqpxjfmmfjhleelhtbaabt
frwwrfrhsshrdxooxdpnkknpcehhecoudduoakzzkamavvam
yqrrqykgnngkimffmiucbbcugsxxsgsittiseyppyeqolloq
dfiifdpveevpblaalbnbwwbnzrssrzlhoohljnggnjvdccdv
htyythtjuujtfzqqzfrpmmpregjjgeqwffwqcmbbmcocxxco
asttsamippimkohhokweddewiuzzuiukvvkugarragsqnnqs
fhkkhfrxggxrdnccndpdyydpbtuutbnjqqjnlpiiplxfeefx
jvaavjvlwwlvhbssbhtroortgilligsyhhyseoddoeqezzeq
cuvvucokrrkomqjjqmygffgykwbbwkwmxxmwicttciusppsu

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: gillig
Cipher: tvyyvt

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: gillig
Cipher: 224213134222

Extended Methods:
Method #1

Plaintext: gillig
method variations:
moqqomrtvvtrwyaaywbdffdb

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
g i l l i g 
2 4 1 1 4 2 
2 2 3 3 2 2 
They are then read out in rows:
241142223322
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: gillig
Cipher: raigng

Read more ...
Method #3

Plaintext: gillig
method variations:
rbcsgg bcsggr csggrb
sggrbc ggrbcs grbcsg

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: gillig

all 720 cipher variations:
gillig gillgi gililg giligl gilgil gilgli gillig gillgi gililg giligl gilgil
gilgli giillg giilgl giillg giilgl giigll giigll giglil giglli gigill gigill
giglil giglli glilig glilgi gliilg gliigl gligil gligli glliig glligi glliig
glligi gllgii gllgii glilig glilgi gliilg gliigl gligil gligli glglii glglii
glgili glgiil glgiil glgili glliig glligi glliig glligi gllgii gllgii glilig
glilgi gliilg gliigl gligil gligli gliilg gliigl glilig glilgi gligli gligil
glgiil glgili glgiil glgili glglii glglii gillig gillgi gililg giligl gilgil
gilgli gillig gillgi gililg giligl gilgil gilgli giillg giilgl giillg giilgl
giigll giigll giglil giglli gigill gigill giglil giglli ggllii ggllii gglili
ggliil ggliil gglili ggllii ggllii gglili ggliil ggliil gglili ggilli ggilil
ggilli ggilil ggiill ggiill ggilil ggilli ggiill ggiill ggilil ggilli igllig
igllgi iglilg igligl iglgil iglgli igllig igllgi iglilg igligl iglgil iglgli
igillg igilgl igillg igilgl igigll igigll igglil igglli iggill iggill igglil
igglli ilglig ilglgi ilgilg ilgigl ilggil ilggli illgig illggi illigg illigg
illgig illggi ililgg ililgg iliglg iliggl iliggl iliglg ilglig ilglgi ilgilg
ilgigl ilggil ilggli illgig illggi illigg illigg illgig illggi ilglig ilglgi
ilgilg ilgigl ilggil ilggli iliglg iliggl ililgg ililgg iliglg iliggl ilggil
ilggli ilgigl ilgilg ilglig ilglgi iillgg iillgg iilglg iilggl iilggl iilglg
iillgg iillgg iilglg iilggl iilggl iilglg iigllg iiglgl iigllg iiglgl iiggll
iiggll iiglgl iigllg iiggll iiggll iiglgl iigllg igllig igllgi iglilg igligl
iglgil iglgli igllig igllgi iglilg igligl iglgil iglgli igillg igilgl igillg
igilgl igigll igigll igglil igglli iggill iggill igglil igglli liglig liglgi
ligilg ligigl liggil liggli lilgig lilggi liligg liligg lilgig lilggi liilgg
liilgg liiglg liiggl liiggl liiglg liglig liglgi ligilg ligigl liggil liggli
lgilig lgilgi lgiilg lgiigl lgigil lgigli lgliig lgligi lgliig lgligi lglgii
lglgii lgilig lgilgi lgiilg lgiigl lgigil lgigli lgglii lgglii lggili lggiil
lggiil lggili llgiig llgigi llgiig llgigi llggii llggii lligig lliggi lliigg
lliigg lligig lliggi lliigg lliigg lligig lliggi lliggi lligig llgiig llgigi
llgiig llgigi llggii llggii liglig liglgi ligilg ligigl liggil liggli lilgig
lilggi liligg liligg lilgig lilggi liilgg liilgg liiglg liiggl liiggl liiglg
liglig liglgi ligilg ligigl liggil liggli lgglii lgglii lggili lggiil lggiil
lggili lglgii lglgii lgligi lgliig lgliig lgligi lgilgi lgilig lgigli lgigil
lgiigl lgiilg lgilig lgilgi lgiilg lgiigl lgigil lgigli lilgig lilggi liligg
liligg lilgig lilggi liglig liglgi ligilg ligigl liggil liggli liiglg liiggl
liilgg liilgg liiglg liiggl liggil liggli ligigl ligilg liglig liglgi lligig
lliggi lliigg lliigg lligig lliggi llgiig llgigi llgiig llgigi llggii llggii
lligig lliggi lliigg lliigg lligig lliggi llggii llggii llgigi llgiig llgiig
llgigi lgliig lgligi lgliig lgligi lglgii lglgii lgilig lgilgi lgiilg lgiigl
lgigil lgigli lgiilg lgiigl lgilig lgilgi lgigli lgigil lggiil lggili lggiil
lggili lgglii lgglii lilgig lilggi liligg liligg lilgig lilggi liglig liglgi
ligilg ligigl liggil liggli liiglg liiggl liilgg liilgg liiglg liiggl liggil
liggli ligigl ligilg liglig liglgi lglgii lglgii lgligi lgliig lgliig lgligi
lgglii lgglii lggili lggiil lggiil lggili lgigli lgigil lgilgi lgilig lgiilg
lgiigl lgigil lgigli lgiigl lgiilg lgilig lgilgi iillgg iillgg iilglg iilggl
iilggl iilglg iillgg iillgg iilglg iilggl iilggl iilglg iigllg iiglgl iigllg
iiglgl iiggll iiggll iiglgl iigllg iiggll iiggll iiglgl iigllg ililgg ililgg
iliglg iliggl iliggl iliglg illigg illigg illgig illggi illggi illgig ilglig
ilglgi ilgilg ilgigl ilggil ilggli ilglgi ilglig ilggli ilggil ilgigl ilgilg
illigg illigg illgig illggi illggi illgig ililgg ililgg iliglg iliggl iliggl
iliglg ilgilg ilgigl ilglig ilglgi ilggli ilggil ilgigl ilgilg ilggil ilggli
ilglgi ilglig igllig igllgi iglilg igligl iglgil iglgli igllig igllgi iglilg
igligl iglgil iglgli igillg igilgl igillg igilgl igigll igigll igglil igglli
iggill iggill igglil igglli igllgi igllig iglgli iglgil igligl iglilg igllgi
igllig iglgli iglgil igligl iglilg igglli igglil igglli igglil iggill iggill
igilgl igillg igigll igigll igilgl igillg gillig gillgi gililg giligl gilgil
gilgli gillig gillgi gililg giligl gilgil gilgli giillg giilgl giillg giilgl
giigll giigll giglil giglli gigill gigill giglil giglli glilig glilgi gliilg
gliigl gligil gligli glliig glligi glliig glligi gllgii gllgii glilig glilgi
gliilg gliigl gligil gligli glglii glglii glgili glgiil glgiil glgili glliig
glligi glliig glligi gllgii gllgii glilig glilgi gliilg gliigl gligil gligli
gliilg gliigl glilig glilgi gligli gligil glgiil glgili glgiil glgili glglii
glglii gillig gillgi gililg giligl gilgil gilgli gillig gillgi gililg giligl
gilgil gilgli giillg giilgl giillg giilgl giigll giigll giglil giglli gigill
gigill giglil giglli ggllii ggllii gglili ggliil ggliil gglili ggllii ggllii
gglili ggliil ggliil gglili ggilli ggilil ggilli ggilil ggiill ggiill ggilil
ggilli ggiill ggiill ggilil ggilli

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us