easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

inhorruitque

wheaton

glassworker

markology

undependableness

separatively

tributer

veinwork

luteciums

lectureships

quiverunt

agensoe

ensteel

dicatis

speaned

biflex

trooping

jonahs


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: gehret
cipher variations:
hfisfu igjtgv jhkuhw kilvix ljmwjy
mknxkz nloyla ompzmb pnqanc qorbod
rpscpe sqtdqf truerg usvfsh vtwgti
wuxhuj xvyivk ywzjwl zxakxm ayblyn
bzcmzo cadnap dbeobq ecfpcr fdgqds

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: gehret
Cipher: tvsivg

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: gehret
Cipher: AABBA AABAA AABBB BAAAA AABAA BAABA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: gehret
cipher variations:
hfisfutnwangfvkivsrdyqdedlmylqptagtcnjcwjazrqerm
lzemzyxhsuhkjpgcpwvxukxiigjtgvuoxbohgwljwtsezref
emnzmrqubhudokdxkbasrfsnmafnazyitvilkqhdqxwyvlyj
jhkuhwvpycpihxmkxutfasfgfnoansrvcivepleylcbtsgto
nbgobazjuwjmlrieryxzwmzkkilvixwqzdqjiynlyvugbtgh
gopbotswdjwfqmfzmdcuthupochpcbakvxknmsjfszyaxnal
ljmwjyxraerkjzomzwvhcuhihpqcputxekxgrnganedvuivq
pdiqdcblwylontkgtazbyobmmknxkzysbfslkapnaxwidvij
iqrdqvuyflyhsohbofewvjwrqejredcmxzmpoulhubaczpcn
nloylaztcgtmlbqobyxjewjkjrserwvzgmzitpicpgfxwkxs
rfksfednyanqpvmivcbdaqdoompzmbaudhunmcrpczykfxkl
kstfsxwahnajuqjdqhgyxlytsgltgfeozborqwnjwdcebrep
pnqancbveivondsqdazlgylmltugtyxbiobkvrkerihzymzu
thmuhgfpacpsrxokxedfcsfqqorbodcwfjwpoetrebamhzmn
muvhuzycjpclwslfsjiaznavuinvihgqbdqtsyplyfegdtgr
rpscpedxgkxqpfusfcbnianonvwivazdkqdmxtmgtkjbaobw
vjowjihrcerutzqmzgfheuhssqtdqfeyhlyrqgvtgdcojbop
owxjwbaelrenyunhulkcbpcxwkpxkjisdfsvuarnahgifvit
truergfzimzsrhwuhedpkcpqpxykxcbfmsfozvoivmldcqdy
xlqylkjtegtwvbsobihjgwjuusvfshgajnatsixvifeqldqr
qyzlydcgntgpawpjwnmedrezymrzmlkufhuxwctpcjikhxkv
vtwgtihbkobutjywjgfrmersrzamzedhouhqbxqkxonfesfa
znsanmlvgivyxduqdkjliylwwuxhujiclpcvukzxkhgsnfst
sabnafeipvircyrlypogftgbaotbonmwhjwzyevrelkmjzmx
xvyivkjdmqdwvlaylihtogtutbcobgfjqwjsdzsmzqphguhc
bpucponxikxazfwsfmlnkanyywzjwlkenrexwmbzmjiuphuv
ucdpchgkrxkteatnarqihvidcqvdqpoyjlybagxtgnmolboz
zxakxmlfosfyxncankjvqivwvdeqdihlsylufbuobsrjiwje
drwerqpzkmzcbhyuhonpmcpaayblynmgptgzyodbolkwrjwx
wefrejimtzmvgcvpctskjxkfesxfsrqalnadcizvipoqndqb
bzcmzonhquhazpecpmlxskxyxfgsfkjnuanwhdwqdutlkylg
ftygtsrbmobedjawjqproerccadnapoirvibaqfdqnmytlyz
yghtglkovboxiexrevumlzmhguzhutscnpcfekbxkrqspfsd
dbeobqpjswjcbrgeronzumzazhiuhmlpwcpyjfysfwvnmani
hvaivutdoqdgflcylsrtqgteecfpcrqktxkdcshfspoavnab
aijvinmqxdqzkgztgxwonbojiwbjwvueprehgmdzmtsurhuf
fdgqdsrluyledtigtqpbwobcbjkwjonryeralhauhyxpocpk
jxckxwvfqsfihneanutvsivggehretsmvzmfeujhurqcxpcd
cklxkposzfsbmibvizyqpdqlkydlyxwgrtgjiofbovuwtjwh

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: gehret
Cipher: truerg

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: gehret
Cipher: 225132245144

Extended Methods:
Method #1

Plaintext: gehret
method variations:
mknwkyrpsbpdwuxguibzcmzo

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
g e h r e t 
2 5 3 2 5 4 
2 1 2 4 1 4 
They are then read out in rows:
253254212414
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: gehret
Cipher: whubrq

Read more ...
Method #3

Plaintext: gehret
method variations:
wlgyqi lgyqiw gyqiwl
yqiwlg qiwlgy iwlgyq

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: gehret

all 720 cipher variations:
gehret gehrte gehert gehetr gehter gehtre gerhet gerhte gereht gereth gerteh
gerthe geerht geerth geehrt geehtr geethr geetrh getreh getrhe geterh getehr
gether gethre gheret gherte gheert gheetr gheter ghetre ghreet ghrete ghreet
ghrete ghrtee ghrtee gheret gherte gheert gheetr gheter ghetre ghtree ghtree
ghtere ghteer ghteer ghtere grheet grhete grheet grhete grhtee grhtee grehet
grehte greeht greeth greteh grethe greeht greeth grehet grehte grethe greteh
grteeh grtehe grteeh grtehe grthee grthee gehret gehrte gehert gehetr gehter
gehtre gerhet gerhte gereht gereth gerteh gerthe geerht geerth geehrt geehtr
geethr geetrh getreh getrhe geterh getehr gether gethre gthree gthree gthere
gtheer gtheer gthere gtrhee gtrhee gtrehe gtreeh gtreeh gtrehe gterhe gtereh
gtehre gteher gteehr gteerh gtereh gterhe gteerh gteehr gteher gtehre eghret
eghrte eghert eghetr eghter eghtre egrhet egrhte egreht egreth egrteh egrthe
egerht egerth egehrt egehtr egethr egetrh egtreh egtrhe egterh egtehr egther
egthre ehgret ehgrte ehgert ehgetr ehgter ehgtre ehrget ehrgte ehregt ehretg
ehrteg ehrtge ehergt ehertg ehegrt ehegtr ehetgr ehetrg ehtreg ehtrge ehterg
ehtegr ehtger ehtgre erhget erhgte erhegt erhetg erhteg erhtge erghet erghte
ergeht ergeth ergteh ergthe ereght eregth erehgt erehtg erethg eretgh ertgeh
ertghe ertegh ertehg ertheg erthge eehrgt eehrtg eehgrt eehgtr eehtgr eehtrg
eerhgt eerhtg eerght eergth eertgh eerthg eegrht eegrth eeghrt eeghtr eegthr
eegtrh eetrgh eetrhg eetgrh eetghr eethgr eethrg ethreg ethrge etherg ethegr
ethger ethgre etrheg etrhge etrehg etregh etrgeh etrghe eterhg etergh etehrg
etehgr eteghr etegrh etgreh etgrhe etgerh etgehr etgher etghre hegret hegrte
hegert hegetr hegter hegtre herget hergte heregt heretg herteg hertge heergt
heertg heegrt heegtr heetgr heetrg hetreg hetrge heterg hetegr hetger hetgre
hgeret hgerte hgeert hgeetr hgeter hgetre hgreet hgrete hgreet hgrete hgrtee
hgrtee hgeret hgerte hgeert hgeetr hgeter hgetre hgtree hgtree hgtere hgteer
hgteer hgtere hrgeet hrgete hrgeet hrgete hrgtee hrgtee hreget hregte hreegt
hreetg hreteg hretge hreegt hreetg hreget hregte hretge hreteg hrteeg hrtege
hrteeg hrtege hrtgee hrtgee hegret hegrte hegert hegetr hegter hegtre herget
hergte heregt heretg herteg hertge heergt heertg heegrt heegtr heetgr heetrg
hetreg hetrge heterg hetegr hetger hetgre htgree htgree htgere htgeer htgeer
htgere htrgee htrgee htrege htreeg htreeg htrege hterge htereg htegre hteger
hteegr hteerg htereg hterge hteerg hteegr hteger htegre rehget rehgte rehegt
rehetg rehteg rehtge reghet reghte regeht regeth regteh regthe reeght reegth
reehgt reehtg reethg reetgh retgeh retghe retegh retehg retheg rethge rheget
rhegte rheegt rheetg rheteg rhetge rhgeet rhgete rhgeet rhgete rhgtee rhgtee
rheget rhegte rheegt rheetg rheteg rhetge rhtgee rhtgee rhtege rhteeg rhteeg
rhtege rgheet rghete rgheet rghete rghtee rghtee rgehet rgehte rgeeht rgeeth
rgeteh rgethe rgeeht rgeeth rgehet rgehte rgethe rgeteh rgteeh rgtehe rgteeh
rgtehe rgthee rgthee rehget rehgte rehegt rehetg rehteg rehtge reghet reghte
regeht regeth regteh regthe reeght reegth reehgt reehtg reethg reetgh retgeh
retghe retegh retehg retheg rethge rthgee rthgee rthege rtheeg rtheeg rthege
rtghee rtghee rtgehe rtgeeh rtgeeh rtgehe rteghe rtegeh rtehge rteheg rteehg
rteegh rtegeh rteghe rteegh rteehg rteheg rtehge eehrgt eehrtg eehgrt eehgtr
eehtgr eehtrg eerhgt eerhtg eerght eergth eertgh eerthg eegrht eegrth eeghrt
eeghtr eegthr eegtrh eetrgh eetrhg eetgrh eetghr eethgr eethrg ehergt ehertg
ehegrt ehegtr ehetgr ehetrg ehregt ehretg ehrget ehrgte ehrtge ehrteg ehgret
ehgrte ehgert ehgetr ehgter ehgtre ehtrge ehtreg ehtgre ehtger ehtegr ehterg
erhegt erhetg erhget erhgte erhtge erhteg erehgt erehtg ereght eregth eretgh
erethg ergeht ergeth erghet erghte ergthe ergteh ertegh ertehg ertgeh ertghe
erthge ertheg eghret eghrte eghert eghetr eghter eghtre egrhet egrhte egreht
egreth egrteh egrthe egerht egerth egehrt egehtr egethr egetrh egtreh egtrhe
egterh egtehr egther egthre ethrge ethreg ethgre ethger ethegr etherg etrhge
etrheg etrghe etrgeh etregh etrehg etgrhe etgreh etghre etgher etgehr etgerh
etergh eterhg etegrh eteghr etehgr etehrg tehreg tehrge teherg tehegr tehger
tehgre terheg terhge terehg teregh tergeh terghe teerhg teergh teehrg teehgr
teeghr teegrh tegreh tegrhe tegerh tegehr tegher teghre thereg therge theerg
theegr theger thegre threeg threge threeg threge thrgee thrgee thereg therge
theerg theegr theger thegre thgree thgree thgere thgeer thgeer thgere trheeg
trhege trheeg trhege trhgee trhgee treheg trehge treehg treegh tregeh treghe
treehg treegh treheg trehge treghe tregeh trgeeh trgehe trgeeh trgehe trghee
trghee tehreg tehrge teherg tehegr tehger tehgre terheg terhge terehg teregh
tergeh terghe teerhg teergh teehrg teehgr teeghr teegrh tegreh tegrhe tegerh
tegehr tegher teghre tghree tghree tghere tgheer tgheer tghere tgrhee tgrhee
tgrehe tgreeh tgreeh tgrehe tgerhe tgereh tgehre tgeher tgeehr tgeerh tgereh
tgerhe tgeerh tgeehr tgeher tgehre

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us