easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

wecker

redimensioned

rahall

keelhauled

yusdrum

mitar

propargyl

flaxbush

apneumatosis

cyanoderma

praestamusque

continuately

sturr

supergenual

equake

sbradley

plumieride

bonairly


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: geechee
cipher variations:
hffdiff iggejgg jhhfkhh kiiglii ljjhmjj
mkkinkk nlljoll ommkpmm pnnlqnn qoomroo
rppnspp sqqotqq trrpurr ussqvss vttrwtt
wuusxuu xvvtyvv ywwuzww zxxvaxx ayywbyy
bzzxczz caaydaa dbbzebb eccafcc fddbgdd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: geechee
Cipher: tvvxsvv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: geechee
Cipher: AABBA AABAA AABAA AAABA AABBB AABAA AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: geechee
cipher variations:
hffdifftnnhwnnfvvlkvvrddpydddlltmllpttxattnjjfcjjzrrjqrr
lzznezzxhhrshhjppvgppvxxzuxxiggejgguooixoogwwmlwwseeqzee
emmunmmquuybuuokkgdkkasskrssmaaofaayiistiikqqwhqqwyyavyy
jhhfkhhvppjypphxxnmxxtffrafffnnvonnrvvzcvvpllhellbttlstt
nbbpgbbzjjtujjlrrxirrxzzbwzzkiigliiwqqkzqqiyyonyyuggsbgg
goowpooswwadwwqmmifmmcuumtuuoccqhccakkuvkkmssyjssyaacxaa
ljjhmjjxrrlarrjzzpozzvhhtchhhppxqpptxxbexxrnnjgnndvvnuvv
pddriddbllvwllnttzkttzbbdybbmkkinkkyssmbsskaaqpaawiiudii
iqqyrqquyycfyysookhooewwovwwqeesjeecmmwxmmouualuuaccezcc
nlljollzttncttlbbrqbbxjjvejjjrrzsrrvzzdgzztpplippfxxpwxx
rfftkffdnnxynnpvvbmvvbddfaddommkpmmauuoduumccsrccykkwfkk
kssatsswaaehaauqqmjqqgyyqxyysggulggeooyzooqwwcnwwceegbee
pnnlqnnbvvpevvnddtsddzllxglllttbuttxbbfibbvrrnkrrhzzryzz
thhvmhhfppzapprxxdoxxdffhcffqoomroocwwqfwwoeeuteeammyhmm
muucvuuyccgjccwssolssiaaszaauiiwniigqqabqqsyyepyyeggidgg
rppnsppdxxrgxxpffvuffbnnzinnnvvdwvvzddhkddxttpmttjbbtabb
vjjxojjhrrbcrrtzzfqzzfhhjehhsqqotqqeyyshyyqggwvggcooajoo
owwexwwaeeileeyuuqnuukccubccwkkypkkisscdssuaagraagiikfii
trrpurrfzztizzrhhxwhhdppbkpppxxfyxxbffjmffzvvrovvlddvcdd
xllzqlljttdettvbbhsbbhjjlgjjussqvssgaaujaasiiyxiieqqclqq
qyygzyycggknggawwspwwmeewdeeymmarmmkuuefuuwccitccikkmhkk
vttrwtthbbvkbbtjjzyjjfrrdmrrrzzhazzdhhlohhbxxtqxxnffxeff
znnbsnnlvvfgvvxddjuddjllnillwuusxuuiccwlccukkazkkgssenss
saaibaaeiimpiicyyuryyoggyfggaooctoomwwghwwyeekveekmmojmm
xvvtyvvjddxmddvllballhttfotttbbjcbbfjjnqjjdzzvszzphhzghh
bppduppnxxhixxzfflwfflnnpknnywwuzwwkeeyneewmmcbmmiuugpuu
ucckdccgkkorkkeaawtaaqiiahiicqqevqqoyyijyyaggmxggmooqloo
zxxvaxxlffzoffxnndcnnjvvhqvvvddleddhllpsllfbbxubbrjjbijj
drrfwrrpzzjkzzbhhnyhhnpprmppayywbyymggapggyooedookwwirww
weemfeeimmqtmmgccyvccskkcjkkessgxssqaaklaaciioziioqqsnqq
bzzxczznhhbqhhzppfepplxxjsxxxffngffjnnrunnhddzwddtlldkll
ftthyttrbblmbbdjjpajjprrtorrcaaydaaoiicriiaqqgfqqmyyktyy
yggohggkoosvooieeaxeeummelmmguuizuusccmnccekkqbkkqssupss
dbbzebbpjjdsjjbrrhgrrnzzluzzzhhpihhlpptwppjffbyffvnnfmnn
hvvjavvtddnoddfllrcllrttvqtteccafccqkketkkcssihssoaamvaa
aiiqjiimqquxqqkggczggwoognooiwwkbwwueeopeegmmsdmmsuuwruu
fddbgddrllfulldttjittpbbnwbbbjjrkjjnrrvyrrlhhdahhxpphopp
jxxlcxxvffpqffhnntenntvvxsvvgeecheesmmgvmmeuukjuuqccoxcc
ckkslkkosswzssmiiebiiyqqipqqkyymdyywggqrggiooufoouwwytww

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: geechee
Cipher: trrpurr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: geechee
Cipher: 22515131325151

Extended Methods:
Method #1

Plaintext: geechee
method variations:
mkkhnkkrppnsppwuusxuubzzxczz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
g e e c h e e 
2 5 5 3 3 5 5 
2 1 1 1 2 1 1 
They are then read out in rows:
25533552111211
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: geechee
Cipher: wpxkafa

Read more ...
Method #3

Plaintext: geechee
method variations:
wvllwvf vllwvfw llwvfwv
lwvfwvl wvfwvll vfwvllw
fwvllwv

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: geechee

all 5040 cipher variations:
geechee geechee geecehe geeceeh geeceeh geecehe geehcee geehcee geehece geeheec geeheec
geehece geeehce geeehec geeeche geeeceh geeeech geeeehc geeehec geeehce geeeehc geeeech
geeeceh geeeche gecehee gecehee geceehe geceeeh geceeeh geceehe gecheee gecheee gecheee
gecheee gecheee gecheee gecehee gecehee geceehe geceeeh geceeeh geceehe gecehee gecehee
geceehe geceeeh geceeeh geceehe gehceee gehceee gehceee gehceee gehceee gehceee gehecee
gehecee geheece geheeec geheeec geheece geheece geheeec gehecee gehecee geheece geheeec
geheeec geheece geheeec geheece gehecee gehecee geechee geechee geecehe geeceeh geeceeh
geecehe geehcee geehcee geehece geeheec geeheec geehece geeehce geeehec geeeche geeeceh
geeeech geeeehc geeehec geeehce geeeehc geeeech geeeceh geeeche geechee geechee geecehe
geeceeh geeceeh geecehe geehcee geehcee geehece geeheec geeheec geehece geeehce geeehec
geeeche geeeceh geeeech geeeehc geeehec geeehce geeeehc geeeech geeeceh geeeche geechee
geechee geecehe geeceeh geeceeh geecehe geehcee geehcee geehece geeheec geeheec geehece
geeehce geeehec geeeche geeeceh geeeech geeeehc geeehec geeehce geeeehc geeeech geeeceh
geeeche gecehee gecehee geceehe geceeeh geceeeh geceehe gecheee gecheee gecheee gecheee
gecheee gecheee gecehee gecehee geceehe geceeeh geceeeh geceehe gecehee gecehee geceehe
geceeeh geceeeh geceehe gehceee gehceee gehceee gehceee gehceee gehceee gehecee gehecee
geheece geheeec geheeec geheece geheece geheeec gehecee gehecee geheece geheeec geheeec
geheece geheeec geheece gehecee gehecee geechee geechee geecehe geeceeh geeceeh geecehe
geehcee geehcee geehece geeheec geeheec geehece geeehce geeehec geeeche geeeceh geeeech
geeeehc geeehec geeehce geeeehc geeeech geeeceh geeeche geechee geechee geecehe geeceeh
geeceeh geecehe geehcee geehcee geehece geeheec geeheec geehece geeehce geeehec geeeche
geeeceh geeeech geeeehc geeehec geeehce geeeehc geeeech geeeceh geeeche gceehee gceehee
gceeehe gceeeeh gceeeeh gceeehe gceheee gceheee gceheee gceheee gceheee gceheee gceehee
gceehee gceeehe gceeeeh gceeeeh gceeehe gceehee gceehee gceeehe gceeeeh gceeeeh gceeehe
gceehee gceehee gceeehe gceeeeh gceeeeh gceeehe gceheee gceheee gceheee gceheee gceheee
gceheee gceehee gceehee gceeehe gceeeeh gceeeeh gceeehe gceehee gceehee gceeehe gceeeeh
gceeeeh gceeehe gcheeee gcheeee gcheeee gcheeee gcheeee gcheeee gcheeee gcheeee gcheeee
gcheeee gcheeee gcheeee gcheeee gcheeee gcheeee gcheeee gcheeee gcheeee gcheeee gcheeee
gcheeee gcheeee gcheeee gcheeee gceehee gceehee gceeehe gceeeeh gceeeeh gceeehe gceheee
gceheee gceheee gceheee gceheee gceheee gceehee gceehee gceeehe gceeeeh gceeeeh gceeehe
gceehee gceehee gceeehe gceeeeh gceeeeh gceeehe gceehee gceehee gceeehe gceeeeh gceeeeh
gceeehe gceheee gceheee gceheee gceheee gceheee gceheee gceehee gceehee gceeehe gceeeeh
gceeeeh gceeehe gceehee gceehee gceeehe gceeeeh gceeeeh gceeehe gheceee gheceee gheceee
gheceee gheceee gheceee gheecee gheecee gheeece gheeeec gheeeec gheeece gheeece gheeeec
gheecee gheecee gheeece gheeeec gheeeec gheeece gheeeec gheeece gheecee gheecee ghceeee
ghceeee ghceeee ghceeee ghceeee ghceeee ghceeee ghceeee ghceeee ghceeee ghceeee ghceeee
ghceeee ghceeee ghceeee ghceeee ghceeee ghceeee ghceeee ghceeee ghceeee ghceeee ghceeee
ghceeee gheceee gheceee gheceee gheceee gheceee gheceee gheecee gheecee gheeece gheeeec
gheeeec gheeece gheeece gheeeec gheecee gheecee gheeece gheeeec gheeeec gheeece gheeeec
gheeece gheecee gheecee gheceee gheceee gheceee gheceee gheceee gheceee gheecee gheecee
gheeece gheeeec gheeeec gheeece gheeece gheeeec gheecee gheecee gheeece gheeeec gheeeec
gheeece gheeeec gheeece gheecee gheecee gheceee gheceee gheceee gheceee gheceee gheceee
gheecee gheecee gheeece gheeeec gheeeec gheeece gheeece gheeeec gheecee gheecee gheeece
gheeeec gheeeec gheeece gheeeec gheeece gheecee gheecee geechee geechee geecehe geeceeh
geeceeh geecehe geehcee geehcee geehece geeheec geeheec geehece geeehce geeehec geeeche
geeeceh geeeech geeeehc geeehec geeehce geeeehc geeeech geeeceh geeeche gecehee gecehee
geceehe geceeeh geceeeh geceehe gecheee gecheee gecheee gecheee gecheee gecheee gecehee
gecehee geceehe geceeeh geceeeh geceehe gecehee gecehee geceehe geceeeh geceeeh geceehe
gehceee gehceee gehceee gehceee gehceee gehceee gehecee gehecee geheece geheeec geheeec
geheece geheece geheeec gehecee gehecee geheece geheeec geheeec geheece geheeec geheece
gehecee gehecee geechee geechee geecehe geeceeh geeceeh geecehe geehcee geehcee geehece
geeheec geeheec geehece geeehce geeehec geeeche geeeceh geeeech geeeehc geeehec geeehce
geeeehc geeeech geeeceh geeeche geechee geechee geecehe geeceeh geeceeh geecehe geehcee
geehcee geehece geeheec geeheec geehece geeehce geeehec geeeche geeeceh geeeech geeeehc
geeehec geeehce geeeehc geeeech geeeceh geeeche geechee geechee geecehe geeceeh geeceeh
geecehe geehcee geehcee geehece geeheec geeheec geehece geeehce geeehec geeeche geeeceh
geeeech geeeehc geeehec geeehce geeeehc geeeech geeeceh geeeche gecehee gecehee geceehe
geceeeh geceeeh geceehe gecheee gecheee gecheee gecheee gecheee gecheee gecehee gecehee
geceehe geceeeh geceeeh geceehe gecehee gecehee geceehe geceeeh geceeeh geceehe gehceee
gehceee gehceee gehceee gehceee gehceee gehecee gehecee geheece geheeec geheeec geheece
geheece geheeec gehecee gehecee geheece geheeec geheeec geheece geheeec geheece gehecee
gehecee geechee geechee geecehe geeceeh geeceeh geecehe geehcee geehcee geehece geeheec
geeheec geehece geeehce geeehec geeeche geeeceh geeeech geeeehc geeehec geeehce geeeehc
geeeech geeeceh geeeche geechee geechee geecehe geeceeh geeceeh geecehe geehcee geehcee
geehece geeheec geeheec geehece geeehce geeehec geeeche geeeceh geeeech geeeehc geeehec
geeehce geeeehc geeeech geeeceh geeeche egechee egechee egecehe egeceeh egeceeh egecehe
egehcee egehcee egehece egeheec egeheec egehece egeehce egeehec egeeche egeeceh egeeech
egeeehc egeehec egeehce egeeehc egeeech egeeceh egeeche egcehee egcehee egceehe egceeeh
egceeeh egceehe egcheee egcheee egcheee egcheee egcheee egcheee egcehee egcehee egceehe
egceeeh egceeeh egceehe egcehee egcehee egceehe egceeeh egceeeh egceehe eghceee eghceee
eghceee eghceee eghceee eghceee eghecee eghecee egheece egheeec egheeec egheece egheece
egheeec eghecee eghecee egheece egheeec egheeec egheece egheeec egheece eghecee eghecee
egechee egechee egecehe egeceeh egeceeh egecehe egehcee egehcee egehece egeheec egeheec
egehece egeehce egeehec egeeche egeeceh egeeech egeeehc egeehec egeehce egeeehc egeeech
egeeceh egeeche egechee egechee egecehe egeceeh egeceeh egecehe egehcee egehcee egehece
egeheec egeheec egehece egeehce egeehec egeeche egeeceh egeeech egeeehc egeehec egeehce
egeeehc egeeech egeeceh egeeche eegchee eegchee eegcehe eegceeh eegceeh eegcehe eeghcee
eeghcee eeghece eegheec eegheec eeghece eegehce eegehec eegeche eegeceh eegeech eegeehc
eegehec eegehce eegeehc eegeech eegeceh eegeche eecghee eecghee eecgehe eecgeeh eecgeeh
eecgehe eechgee eechgee eechege eecheeg eecheeg eechege eecehge eeceheg eeceghe eecegeh
eeceegh eeceehg eeceheg eecehge eeceehg eeceegh eecegeh eeceghe eehcgee eehcgee eehcege
eehceeg eehceeg eehcege eehgcee eehgcee eehgece eehgeec eehgeec eehgece eehegce eehegec
eehecge eeheceg eeheecg eeheegc eehegec eehegce eeheegc eeheecg eeheceg eehecge eeechge
eeecheg eeecghe eeecgeh eeecegh eeecehg eeehcge eeehceg eeehgce eeehgec eeehegc eeehecg
eeeghce eeeghec eeegche eeegceh eeegech eeegehc eeeehgc eeeehcg eeeeghc eeeegch eeeecgh
eeeechg eeecheg eeechge eeecehg eeecegh eeecgeh eeecghe eeehceg eeehcge eeehecg eeehegc
eeehgec eeehgce eeeehcg eeeehgc eeeechg eeeecgh eeeegch eeeeghc eeeghec eeeghce eeegehc
eeegech eeegceh eeegche eceghee eceghee ecegehe ecegeeh ecegeeh ecegehe ecehgee ecehgee
ecehege eceheeg eceheeg ecehege eceehge eceeheg eceeghe eceegeh eceeegh eceeehg eceeheg
eceehge eceeehg eceeegh eceegeh eceeghe ecgehee ecgehee ecgeehe ecgeeeh ecgeeeh ecgeehe
ecgheee ecgheee ecgheee ecgheee ecgheee ecgheee ecgehee ecgehee ecgeehe ecgeeeh ecgeeeh
ecgeehe ecgehee ecgehee ecgeehe ecgeeeh ecgeeeh ecgeehe echgeee echgeee echgeee echgeee
echgeee echgeee echegee echegee echeege echeeeg echeeeg echeege echeege echeeeg echegee
echegee echeege echeeeg echeeeg echeege echeeeg echeege echegee echegee eceghee eceghee
ecegehe ecegeeh ecegeeh ecegehe ecehgee ecehgee ecehege eceheeg eceheeg ecehege eceehge
eceeheg eceeghe eceegeh eceeegh eceeehg eceeheg eceehge eceeehg eceeegh eceegeh eceeghe
eceghee eceghee ecegehe ecegeeh ecegeeh ecegehe ecehgee ecehgee ecehege eceheeg eceheeg
ecehege eceehge eceeheg eceeghe eceegeh eceeegh eceeehg eceeheg eceehge eceeehg eceeegh
eceegeh eceeghe ehecgee ehecgee ehecege eheceeg eheceeg ehecege ehegcee ehegcee ehegece
ehegeec ehegeec ehegece eheegce eheegec eheecge eheeceg eheeecg eheeegc eheegec eheegce
eheeegc eheeecg eheeceg eheecge ehcegee ehcegee ehceege ehceeeg ehceeeg ehceege ehcgeee
ehcgeee ehcgeee ehcgeee ehcgeee ehcgeee ehcegee ehcegee ehceege ehceeeg ehceeeg ehceege
ehcegee ehcegee ehceege ehceeeg ehceeeg ehceege ehgceee ehgceee ehgceee ehgceee ehgceee
ehgceee ehgecee ehgecee ehgeece ehgeeec ehgeeec ehgeece ehgeece ehgeeec ehgecee ehgecee
ehgeece ehgeeec ehgeeec ehgeece ehgeeec ehgeece ehgecee ehgecee ehecgee ehecgee ehecege
eheceeg eheceeg ehecege ehegcee ehegcee ehegece ehegeec ehegeec ehegece eheegce eheegec
eheecge eheeceg eheeecg eheeegc eheegec eheegce eheeegc eheeecg eheeceg eheecge ehecgee
ehecgee ehecege eheceeg eheceeg ehecege ehegcee ehegcee ehegece ehegeec ehegeec ehegece
eheegce eheegec eheecge eheeceg eheeecg eheeegc eheegec eheegce eheeegc eheeecg eheeceg
eheecge eeechge eeecheg eeecghe eeecgeh eeecegh eeecehg eeehcge eeehceg eeehgce eeehgec
eeehegc eeehecg eeeghce eeeghec eeegche eeegceh eeegech eeegehc eeeehgc eeeehcg eeeeghc
eeeegch eeeecgh eeeechg eecehge eeceheg eeceghe eecegeh eeceegh eeceehg eechege eecheeg
eechgee eechgee eechege eecheeg eecghee eecghee eecgehe eecgeeh eecgeeh eecgehe eecehge
eeceheg eeceghe eecegeh eeceegh eeceehg eehcege eehceeg eehcgee eehcgee eehcege eehceeg
eehecge eeheceg eehegce eehegec eeheegc eeheecg eehgece eehgeec eehgcee eehgcee eehgece
eehgeec eeheegc eeheecg eehegec eehegce eehecge eeheceg eegchee eegchee eegcehe eegceeh
eegceeh eegcehe eeghcee eeghcee eeghece eegheec eegheec eeghece eegehce eegehec eegeche
eegeceh eegeech eegeehc eegehec eegehce eegeehc eegeech eegeceh eegeche eeechge eeecheg
eeecghe eeecgeh eeecegh eeecehg eeehcge eeehceg eeehgce eeehgec eeehegc eeehecg eeeghce
eeeghec eeegche eeegceh eeegech eeegehc eeeehgc eeeehcg eeeeghc eeeegch eeeecgh eeeechg
eeecheg eeechge eeecehg eeecegh eeecgeh eeecghe eeehceg eeehcge eeehecg eeehegc eeehgec
eeehgce eeeehcg eeeehgc eeeechg eeeecgh eeeegch eeeeghc eeeghec eeeghce eeegehc eeegech
eeegceh eeegche eeceheg eecehge eeceehg eeceegh eecegeh eeceghe eecheeg eechege eecheeg
eechege eechgee eechgee eeceheg eecehge eeceehg eeceegh eecegeh eeceghe eecghee eecghee
eecgehe eecgeeh eecgeeh eecgehe eehceeg eehcege eehceeg eehcege eehcgee eehcgee eeheceg
eehecge eeheecg eeheegc eehegec eehegce eeheecg eeheegc eeheceg eehecge eehegce eehegec
eehgeec eehgece eehgeec eehgece eehgcee eehgcee eeecheg eeechge eeecehg eeecegh eeecgeh
eeecghe eeehceg eeehcge eeehecg eeehegc eeehgec eeehgce eeeehcg eeeehgc eeeechg eeeecgh
eeeegch eeeeghc eeeghec eeeghce eeegehc eeegech eeegceh eeegche eegchee eegchee eegcehe
eegceeh eegceeh eegcehe eeghcee eeghcee eeghece eegheec eegheec eeghece eegehce eegehec
eegeche eegeceh eegeech eegeehc eegehec eegehce eegeehc eegeech eegeceh eegeche eegchee
eegchee eegcehe eegceeh eegceeh eegcehe eeghcee eeghcee eeghece eegheec eegheec eeghece
eegehce eegehec eegeche eegeceh eegeech eegeehc eegehec eegehce eegeehc eegeech eegeceh
eegeche eecghee eecghee eecgehe eecgeeh eecgeeh eecgehe eechgee eechgee eechege eecheeg
eecheeg eechege eecehge eeceheg eeceghe eecegeh eeceegh eeceehg eeceheg eecehge eeceehg
eeceegh eecegeh eeceghe eehcgee eehcgee eehcege eehceeg eehceeg eehcege eehgcee eehgcee
eehgece eehgeec eehgeec eehgece eehegce eehegec eehecge eeheceg eeheecg eeheegc eehegec
eehegce eeheegc eeheecg eeheceg eehecge eeechge eeecheg eeecghe eeecgeh eeecegh eeecehg
eeehcge eeehceg eeehgce eeehgec eeehegc eeehecg eeeghce eeeghec eeegche eeegceh eeegech
eeegehc eeeehgc eeeehcg eeeeghc eeeegch eeeecgh eeeechg eeecheg eeechge eeecehg eeecegh
eeecgeh eeecghe eeehceg eeehcge eeehecg eeehegc eeehgec eeehgce eeeehcg eeeehgc eeeechg
eeeecgh eeeegch eeeeghc eeeghec eeeghce eeegehc eeegech eeegceh eeegche egechee egechee
egecehe egeceeh egeceeh egecehe egehcee egehcee egehece egeheec egeheec egehece egeehce
egeehec egeeche egeeceh egeeech egeeehc egeehec egeehce egeeehc egeeech egeeceh egeeche
egcehee egcehee egceehe egceeeh egceeeh egceehe egcheee egcheee egcheee egcheee egcheee
egcheee egcehee egcehee egceehe egceeeh egceeeh egceehe egcehee egcehee egceehe egceeeh
egceeeh egceehe eghceee eghceee eghceee eghceee eghceee eghceee eghecee eghecee egheece
egheeec egheeec egheece egheece egheeec eghecee eghecee egheece egheeec egheeec egheece
egheeec egheece eghecee eghecee egechee egechee egecehe egeceeh egeceeh egecehe egehcee
egehcee egehece egeheec egeheec egehece egeehce egeehec egeeche egeeceh egeeech egeeehc
egeehec egeehce egeeehc egeeech egeeceh egeeche egechee egechee egecehe egeceeh egeceeh
egecehe egehcee egehcee egehece egeheec egeheec egehece egeehce egeehec egeeche egeeceh
egeeech egeeehc egeehec egeehce egeeehc egeeech egeeceh egeeche ecgehee ecgehee ecgeehe
ecgeeeh ecgeeeh ecgeehe ecgheee ecgheee ecgheee ecgheee ecgheee ecgheee ecgehee ecgehee
ecgeehe ecgeeeh ecgeeeh ecgeehe ecgehee ecgehee ecgeehe ecgeeeh ecgeeeh ecgeehe eceghee
eceghee ecegehe ecegeeh ecegeeh ecegehe ecehgee ecehgee ecehege eceheeg eceheeg ecehege
eceehge eceeheg eceeghe eceegeh eceeegh eceeehg eceeheg eceehge eceeehg eceeegh eceegeh
eceeghe echegee echegee echeege echeeeg echeeeg echeege echgeee echgeee echgeee echgeee
echgeee echgeee echegee echegee echeege echeeeg echeeeg echeege echegee echegee echeege
echeeeg echeeeg echeege eceehge eceeheg eceeghe eceegeh eceeegh eceeehg ecehege eceheeg
ecehgee ecehgee ecehege eceheeg eceghee eceghee ecegehe ecegeeh ecegeeh ecegehe eceehge
eceeheg eceeghe eceegeh eceeegh eceeehg eceeheg eceehge eceeehg eceeegh eceegeh eceeghe
eceheeg ecehege eceheeg ecehege ecehgee ecehgee eceeheg eceehge eceeehg eceeegh eceegeh
eceeghe eceghee eceghee ecegehe ecegeeh ecegeeh ecegehe ehgceee ehgceee ehgceee ehgceee
ehgceee ehgceee ehgecee ehgecee ehgeece ehgeeec ehgeeec ehgeece ehgeece ehgeeec ehgecee
ehgecee ehgeece ehgeeec ehgeeec ehgeece ehgeeec ehgeece ehgecee ehgecee ehcgeee ehcgeee
ehcgeee ehcgeee ehcgeee ehcgeee ehcegee ehcegee ehceege ehceeeg ehceeeg ehceege ehceege
ehceeeg ehcegee ehcegee ehceege ehceeeg ehceeeg ehceege ehceeeg ehceege ehcegee ehcegee
ehecgee ehecgee ehecege eheceeg eheceeg ehecege ehegcee ehegcee ehegece ehegeec ehegeec
ehegece eheegce eheegec eheecge eheeceg eheeecg eheeegc eheegec eheegce eheeegc eheeecg
eheeceg eheecge ehecege eheceeg ehecgee ehecgee ehecege eheceeg eheecge eheeceg eheegce
eheegec eheeegc eheeecg ehegece ehegeec ehegcee ehegcee ehegece ehegeec eheeegc eheeecg
eheegec eheegce eheecge eheeceg eheceeg ehecege eheceeg ehecege ehecgee ehecgee eheeceg
eheecge eheeecg eheeegc eheegec eheegce eheeecg eheeegc eheeceg eheecge eheegce eheegec
ehegeec ehegece ehegeec ehegece ehegcee ehegcee eegchee eegchee eegcehe eegceeh eegceeh
eegcehe eeghcee eeghcee eeghece eegheec eegheec eeghece eegehce eegehec eegeche eegeceh
eegeech eegeehc eegehec eegehce eegeehc eegeech eegeceh eegeche eecghee eecghee eecgehe
eecgeeh eecgeeh eecgehe eechgee eechgee eechege eecheeg eecheeg eechege eecehge eeceheg
eeceghe eecegeh eeceegh eeceehg eeceheg eecehge eeceehg eeceegh eecegeh eeceghe eehcgee
eehcgee eehcege eehceeg eehceeg eehcege eehgcee eehgcee eehgece eehgeec eehgeec eehgece
eehegce eehegec eehecge eeheceg eeheecg eeheegc eehegec eehegce eeheegc eeheecg eeheceg
eehecge eeechge eeecheg eeecghe eeecgeh eeecegh eeecehg eeehcge eeehceg eeehgce eeehgec
eeehegc eeehecg eeeghce eeeghec eeegche eeegceh eeegech eeegehc eeeehgc eeeehcg eeeeghc
eeeegch eeeecgh eeeechg eeecheg eeechge eeecehg eeecegh eeecgeh eeecghe eeehceg eeehcge
eeehecg eeehegc eeehgec eeehgce eeeehcg eeeehgc eeeechg eeeecgh eeeegch eeeeghc eeeghec
eeeghce eeegehc eeegech eeegceh eeegche eegchee eegchee eegcehe eegceeh eegceeh eegcehe
eeghcee eeghcee eeghece eegheec eegheec eeghece eegehce eegehec eegeche eegeceh eegeech
eegeehc eegehec eegehce eegeehc eegeech eegeceh eegeche eecghee eecghee eecgehe eecgeeh
eecgeeh eecgehe eechgee eechgee eechege eecheeg eecheeg eechege eecehge eeceheg eeceghe
eecegeh eeceegh eeceehg eeceheg eecehge eeceehg eeceegh eecegeh eeceghe eehcgee eehcgee
eehcege eehceeg eehceeg eehcege eehgcee eehgcee eehgece eehgeec eehgeec eehgece eehegce
eehegec eehecge eeheceg eeheecg eeheegc eehegec eehegce eeheegc eeheecg eeheceg eehecge
eeechge eeecheg eeecghe eeecgeh eeecegh eeecehg eeehcge eeehceg eeehgce eeehgec eeehegc
eeehecg eeeghce eeeghec eeegche eeegceh eeegech eeegehc eeeehgc eeeehcg eeeeghc eeeegch
eeeecgh eeeechg eeecheg eeechge eeecehg eeecegh eeecgeh eeecghe eeehceg eeehcge eeehecg
eeehegc eeehgec eeehgce eeeehcg eeeehgc eeeechg eeeecgh eeeegch eeeeghc eeeghec eeeghce
eeegehc eeegech eeegceh eeegche ceeghee ceeghee ceegehe ceegeeh ceegeeh ceegehe ceehgee
ceehgee ceehege ceeheeg ceeheeg ceehege ceeehge ceeeheg ceeeghe ceeegeh ceeeegh ceeeehg
ceeeheg ceeehge ceeeehg ceeeegh ceeegeh ceeeghe cegehee cegehee cegeehe cegeeeh cegeeeh
cegeehe cegheee cegheee cegheee cegheee cegheee cegheee cegehee cegehee cegeehe cegeeeh
cegeeeh cegeehe cegehee cegehee cegeehe cegeeeh cegeeeh cegeehe cehgeee cehgeee cehgeee
cehgeee cehgeee cehgeee cehegee cehegee ceheege ceheeeg ceheeeg ceheege ceheege ceheeeg
cehegee cehegee ceheege ceheeeg ceheeeg ceheege ceheeeg ceheege cehegee cehegee ceeghee
ceeghee ceegehe ceegeeh ceegeeh ceegehe ceehgee ceehgee ceehege ceeheeg ceeheeg ceehege
ceeehge ceeeheg ceeeghe ceeegeh ceeeegh ceeeehg ceeeheg ceeehge ceeeehg ceeeegh ceeegeh
ceeeghe ceeghee ceeghee ceegehe ceegeeh ceegeeh ceegehe ceehgee ceehgee ceehege ceeheeg
ceeheeg ceehege ceeehge ceeeheg ceeeghe ceeegeh ceeeegh ceeeehg ceeeheg ceeehge ceeeehg
ceeeegh ceeegeh ceeeghe ceeghee ceeghee ceegehe ceegeeh ceegeeh ceegehe ceehgee ceehgee
ceehege ceeheeg ceeheeg ceehege ceeehge ceeeheg ceeeghe ceeegeh ceeeegh ceeeehg ceeeheg
ceeehge ceeeehg ceeeegh ceeegeh ceeeghe cegehee cegehee cegeehe cegeeeh cegeeeh cegeehe
cegheee cegheee cegheee cegheee cegheee cegheee cegehee cegehee cegeehe cegeeeh cegeeeh
cegeehe cegehee cegehee cegeehe cegeeeh cegeeeh cegeehe cehgeee cehgeee cehgeee cehgeee
cehgeee cehgeee cehegee cehegee ceheege ceheeeg ceheeeg ceheege ceheege ceheeeg cehegee
cehegee ceheege ceheeeg ceheeeg ceheege ceheeeg ceheege cehegee cehegee ceeghee ceeghee
ceegehe ceegeeh ceegeeh ceegehe ceehgee ceehgee ceehege ceeheeg ceeheeg ceehege ceeehge
ceeeheg ceeeghe ceeegeh ceeeegh ceeeehg ceeeheg ceeehge ceeeehg ceeeegh ceeegeh ceeeghe
ceeghee ceeghee ceegehe ceegeeh ceegeeh ceegehe ceehgee ceehgee ceehege ceeheeg ceeheeg
ceehege ceeehge ceeeheg ceeeghe ceeegeh ceeeegh ceeeehg ceeeheg ceeehge ceeeehg ceeeegh
ceeegeh ceeeghe cgeehee cgeehee cgeeehe cgeeeeh cgeeeeh cgeeehe cgeheee cgeheee cgeheee
cgeheee cgeheee cgeheee cgeehee cgeehee cgeeehe cgeeeeh cgeeeeh cgeeehe cgeehee cgeehee
cgeeehe cgeeeeh cgeeeeh cgeeehe cgeehee cgeehee cgeeehe cgeeeeh cgeeeeh cgeeehe cgeheee
cgeheee cgeheee cgeheee cgeheee cgeheee cgeehee cgeehee cgeeehe cgeeeeh cgeeeeh cgeeehe
cgeehee cgeehee cgeeehe cgeeeeh cgeeeeh cgeeehe cgheeee cgheeee cgheeee cgheeee cgheeee
cgheeee cgheeee cgheeee cgheeee cgheeee cgheeee cgheeee cgheeee cgheeee cgheeee cgheeee
cgheeee cgheeee cgheeee cgheeee cgheeee cgheeee cgheeee cgheeee cgeehee cgeehee cgeeehe
cgeeeeh cgeeeeh cgeeehe cgeheee cgeheee cgeheee cgeheee cgeheee cgeheee cgeehee cgeehee
cgeeehe cgeeeeh cgeeeeh cgeeehe cgeehee cgeehee cgeeehe cgeeeeh cgeeeeh cgeeehe cgeehee
cgeehee cgeeehe cgeeeeh cgeeeeh cgeeehe cgeheee cgeheee cgeheee cgeheee cgeheee cgeheee
cgeehee cgeehee cgeeehe cgeeeeh cgeeeeh cgeeehe cgeehee cgeehee cgeeehe cgeeeeh cgeeeeh
cgeeehe chegeee chegeee chegeee chegeee chegeee chegeee cheegee cheegee cheeege cheeeeg
cheeeeg cheeege cheeege cheeeeg cheegee cheegee cheeege cheeeeg cheeeeg cheeege cheeeeg
cheeege cheegee cheegee chgeeee chgeeee chgeeee chgeeee chgeeee chgeeee chgeeee chgeeee
chgeeee chgeeee chgeeee chgeeee chgeeee chgeeee chgeeee chgeeee chgeeee chgeeee chgeeee
chgeeee chgeeee chgeeee chgeeee chgeeee chegeee chegeee chegeee chegeee chegeee chegeee
cheegee cheegee cheeege cheeeeg cheeeeg cheeege cheeege cheeeeg cheegee cheegee cheeege
cheeeeg cheeeeg cheeege cheeeeg cheeege cheegee cheegee chegeee chegeee chegeee chegeee
chegeee chegeee cheegee cheegee cheeege cheeeeg cheeeeg cheeege cheeege cheeeeg cheegee
cheegee cheeege cheeeeg cheeeeg cheeege cheeeeg cheeege cheegee cheegee chegeee chegeee
chegeee chegeee chegeee chegeee cheegee cheegee cheeege cheeeeg cheeeeg cheeege cheeege
cheeeeg cheegee cheegee cheeege cheeeeg cheeeeg cheeege cheeeeg cheeege cheegee cheegee
ceeghee ceeghee ceegehe ceegeeh ceegeeh ceegehe ceehgee ceehgee ceehege ceeheeg ceeheeg
ceehege ceeehge ceeeheg ceeeghe ceeegeh ceeeegh ceeeehg ceeeheg ceeehge ceeeehg ceeeegh
ceeegeh ceeeghe cegehee cegehee cegeehe cegeeeh cegeeeh cegeehe cegheee cegheee cegheee
cegheee cegheee cegheee cegehee cegehee cegeehe cegeeeh cegeeeh cegeehe cegehee cegehee
cegeehe cegeeeh cegeeeh cegeehe cehgeee cehgeee cehgeee cehgeee cehgeee cehgeee cehegee
cehegee ceheege ceheeeg ceheeeg ceheege ceheege ceheeeg cehegee cehegee ceheege ceheeeg
ceheeeg ceheege ceheeeg ceheege cehegee cehegee ceeghee ceeghee ceegehe ceegeeh ceegeeh
ceegehe ceehgee ceehgee ceehege ceeheeg ceeheeg ceehege ceeehge ceeeheg ceeeghe ceeegeh
ceeeegh ceeeehg ceeeheg ceeehge ceeeehg ceeeegh ceeegeh ceeeghe ceeghee ceeghee ceegehe
ceegeeh ceegeeh ceegehe ceehgee ceehgee ceehege ceeheeg ceeheeg ceehege ceeehge ceeeheg
ceeeghe ceeegeh ceeeegh ceeeehg ceeeheg ceeehge ceeeehg ceeeegh ceeegeh ceeeghe ceeghee
ceeghee ceegehe ceegeeh ceegeeh ceegehe ceehgee ceehgee ceehege ceeheeg ceeheeg ceehege
ceeehge ceeeheg ceeeghe ceeegeh ceeeegh ceeeehg ceeeheg ceeehge ceeeehg ceeeegh ceeegeh
ceeeghe cegehee cegehee cegeehe cegeeeh cegeeeh cegeehe cegheee cegheee cegheee cegheee
cegheee cegheee cegehee cegehee cegeehe cegeeeh cegeeeh cegeehe cegehee cegehee cegeehe
cegeeeh cegeeeh cegeehe cehgeee cehgeee cehgeee cehgeee cehgeee cehgeee cehegee cehegee
ceheege ceheeeg ceheeeg ceheege ceheege ceheeeg cehegee cehegee ceheege ceheeeg ceheeeg
ceheege ceheeeg ceheege cehegee cehegee ceeghee ceeghee ceegehe ceegeeh ceegeeh ceegehe
ceehgee ceehgee ceehege ceeheeg ceeheeg ceehege ceeehge ceeeheg ceeeghe ceeegeh ceeeegh
ceeeehg ceeeheg ceeehge ceeeehg ceeeegh ceeegeh ceeeghe ceeghee ceeghee ceegehe ceegeeh
ceegeeh ceegehe ceehgee ceehgee ceehege ceeheeg ceeheeg ceehege ceeehge ceeeheg ceeeghe
ceeegeh ceeeegh ceeeehg ceeeheg ceeehge ceeeehg ceeeegh ceeegeh ceeeghe heecgee heecgee
heecege heeceeg heeceeg heecege heegcee heegcee heegece heegeec heegeec heegece heeegce
heeegec heeecge heeeceg heeeecg heeeegc heeegec heeegce heeeegc heeeecg heeeceg heeecge
hecegee hecegee heceege heceeeg heceeeg heceege hecgeee hecgeee hecgeee hecgeee hecgeee
hecgeee hecegee hecegee heceege heceeeg heceeeg heceege hecegee hecegee heceege heceeeg
heceeeg heceege hegceee hegceee hegceee hegceee hegceee hegceee hegecee hegecee hegeece
hegeeec hegeeec hegeece hegeece hegeeec hegecee hegecee hegeece hegeeec hegeeec hegeece
hegeeec hegeece hegecee hegecee heecgee heecgee heecege heeceeg heeceeg heecege heegcee
heegcee heegece heegeec heegeec heegece heeegce heeegec heeecge heeeceg heeeecg heeeegc
heeegec heeegce heeeegc heeeecg heeeceg heeecge heecgee heecgee heecege heeceeg heeceeg
heecege heegcee heegcee heegece heegeec heegeec heegece heeegce heeegec heeecge heeeceg
heeeecg heeeegc heeegec heeegce heeeegc heeeecg heeeceg heeecge heecgee heecgee heecege
heeceeg heeceeg heecege heegcee heegcee heegece heegeec heegeec heegece heeegce heeegec
heeecge heeeceg heeeecg heeeegc heeegec heeegce heeeegc heeeecg heeeceg heeecge hecegee
hecegee heceege heceeeg heceeeg heceege hecgeee hecgeee hecgeee hecgeee hecgeee hecgeee
hecegee hecegee heceege heceeeg heceeeg heceege hecegee hecegee heceege heceeeg heceeeg
heceege hegceee hegceee hegceee hegceee hegceee hegceee hegecee hegecee hegeece hegeeec
hegeeec hegeece hegeece hegeeec hegecee hegecee hegeece hegeeec hegeeec hegeece hegeeec
hegeece hegecee hegecee heecgee heecgee heecege heeceeg heeceeg heecege heegcee heegcee
heegece heegeec heegeec heegece heeegce heeegec heeecge heeeceg heeeecg heeeegc heeegec
heeegce heeeegc heeeecg heeeceg heeecge heecgee heecgee heecege heeceeg heeceeg heecege
heegcee heegcee heegece heegeec heegeec heegece heeegce heeegec heeecge heeeceg heeeecg
heeeegc heeegec heeegce heeeegc heeeecg heeeceg heeecge hceegee hceegee hceeege hceeeeg
hceeeeg hceeege hcegeee hcegeee hcegeee hcegeee hcegeee hcegeee hceegee hceegee hceeege
hceeeeg hceeeeg hceeege hceegee hceegee hceeege hceeeeg hceeeeg hceeege hceegee hceegee
hceeege hceeeeg hceeeeg hceeege hcegeee hcegeee hcegeee hcegeee hcegeee hcegeee hceegee
hceegee hceeege hceeeeg hceeeeg hceeege hceegee hceegee hceeege hceeeeg hceeeeg hceeege
hcgeeee hcgeeee hcgeeee hcgeeee hcgeeee hcgeeee hcgeeee hcgeeee hcgeeee hcgeeee hcgeeee
hcgeeee hcgeeee hcgeeee hcgeeee hcgeeee hcgeeee hcgeeee hcgeeee hcgeeee hcgeeee hcgeeee
hcgeeee hcgeeee hceegee hceegee hceeege hceeeeg hceeeeg hceeege hcegeee hcegeee hcegeee
hcegeee hcegeee hcegeee hceegee hceegee hceeege hceeeeg hceeeeg hceeege hceegee hceegee
hceeege hceeeeg hceeeeg hceeege hceegee hceegee hceeege hceeeeg hceeeeg hceeege hcegeee
hcegeee hcegeee hcegeee hcegeee hcegeee hceegee hceegee hceeege hceeeeg hceeeeg hceeege
hceegee hceegee hceeege hceeeeg hceeeeg hceeege hgeceee hgeceee hgeceee hgeceee hgeceee
hgeceee hgeecee hgeecee hgeeece hgeeeec hgeeeec hgeeece hgeeece hgeeeec hgeecee hgeecee
hgeeece hgeeeec hgeeeec hgeeece hgeeeec hgeeece hgeecee hgeecee hgceeee hgceeee hgceeee
hgceeee hgceeee hgceeee hgceeee hgceeee hgceeee hgceeee hgceeee hgceeee hgceeee hgceeee
hgceeee hgceeee hgceeee hgceeee hgceeee hgceeee hgceeee hgceeee hgceeee hgceeee hgeceee
hgeceee hgeceee hgeceee hgeceee hgeceee hgeecee hgeecee hgeeece hgeeeec hgeeeec hgeeece
hgeeece hgeeeec hgeecee hgeecee hgeeece hgeeeec hgeeeec hgeeece hgeeeec hgeeece hgeecee
hgeecee hgeceee hgeceee hgeceee hgeceee hgeceee hgeceee hgeecee hgeecee hgeeece hgeeeec
hgeeeec hgeeece hgeeece hgeeeec hgeecee hgeecee hgeeece hgeeeec hgeeeec hgeeece hgeeeec
hgeeece hgeecee hgeecee hgeceee hgeceee hgeceee hgeceee hgeceee hgeceee hgeecee hgeecee
hgeeece hgeeeec hgeeeec hgeeece hgeeece hgeeeec hgeecee hgeecee hgeeece hgeeeec hgeeeec
hgeeece hgeeeec hgeeece hgeecee hgeecee heecgee heecgee heecege heeceeg heeceeg heecege
heegcee heegcee heegece heegeec heegeec heegece heeegce heeegec heeecge heeeceg heeeecg
heeeegc heeegec heeegce heeeegc heeeecg heeeceg heeecge hecegee hecegee heceege heceeeg
heceeeg heceege hecgeee hecgeee hecgeee hecgeee hecgeee hecgeee hecegee hecegee heceege
heceeeg heceeeg heceege hecegee hecegee heceege heceeeg heceeeg heceege hegceee hegceee
hegceee hegceee hegceee hegceee hegecee hegecee hegeece hegeeec hegeeec hegeece hegeece
hegeeec hegecee hegecee hegeece hegeeec hegeeec hegeece hegeeec hegeece hegecee hegecee
heecgee heecgee heecege heeceeg heeceeg heecege heegcee heegcee heegece heegeec heegeec
heegece heeegce heeegec heeecge heeeceg heeeecg heeeegc heeegec heeegce heeeegc heeeecg
heeeceg heeecge heecgee heecgee heecege heeceeg heeceeg heecege heegcee heegcee heegece
heegeec heegeec heegece heeegce heeegec heeecge heeeceg heeeecg heeeegc heeegec heeegce
heeeegc heeeecg heeeceg heeecge heecgee heecgee heecege heeceeg heeceeg heecege heegcee
heegcee heegece heegeec heegeec heegece heeegce heeegec heeecge heeeceg heeeecg heeeegc
heeegec heeegce heeeegc heeeecg heeeceg heeecge hecegee hecegee heceege heceeeg heceeeg
heceege hecgeee hecgeee hecgeee hecgeee hecgeee hecgeee hecegee hecegee heceege heceeeg
heceeeg heceege hecegee hecegee heceege heceeeg heceeeg heceege hegceee hegceee hegceee
hegceee hegceee hegceee hegecee hegecee hegeece hegeeec hegeeec hegeece hegeece hegeeec
hegecee hegecee hegeece hegeeec hegeeec hegeece hegeeec hegeece hegecee hegecee heecgee
heecgee heecege heeceeg heeceeg heecege heegcee heegcee heegece heegeec heegeec heegece
heeegce heeegec heeecge heeeceg heeeecg heeeegc heeegec heeegce heeeegc heeeecg heeeceg
heeecge heecgee heecgee heecege heeceeg heeceeg heecege heegcee heegcee heegece heegeec
heegeec heegece heeegce heeegec heeecge heeeceg heeeecg heeeegc heeegec heeegce heeeegc
heeeecg heeeceg heeecge eeechge eeecheg eeecghe eeecgeh eeecegh eeecehg eeehcge eeehceg
eeehgce eeehgec eeehegc eeehecg eeeghce eeeghec eeegche eeegceh eeegech eeegehc eeeehgc
eeeehcg eeeeghc eeeegch eeeecgh eeeechg eecehge eeceheg eeceghe eecegeh eeceegh eeceehg
eechege eecheeg eechgee eechgee eechege eecheeg eecghee eecghee eecgehe eecgeeh eecgeeh
eecgehe eecehge eeceheg eeceghe eecegeh eeceegh eeceehg eehcege eehceeg eehcgee eehcgee
eehcege eehceeg eehecge eeheceg eehegce eehegec eeheegc eeheecg eehgece eehgeec eehgcee
eehgcee eehgece eehgeec eeheegc eeheecg eehegec eehegce eehecge eeheceg eegchee eegchee
eegcehe eegceeh eegceeh eegcehe eeghcee eeghcee eeghece eegheec eegheec eeghece eegehce
eegehec eegeche eegeceh eegeech eegeehc eegehec eegehce eegeehc eegeech eegeceh eegeche
eeechge eeecheg eeecghe eeecgeh eeecegh eeecehg eeehcge eeehceg eeehgce eeehgec eeehegc
eeehecg eeeghce eeeghec eeegche eeegceh eeegech eeegehc eeeehgc eeeehcg eeeeghc eeeegch
eeeecgh eeeechg eeechge eeecheg eeecghe eeecgeh eeecegh eeecehg eeehcge eeehceg eeehgce
eeehgec eeehegc eeehecg eeeghce eeeghec eeegche eeegceh eeegech eeegehc eeeehgc eeeehcg
eeeeghc eeeegch eeeecgh eeeechg eecehge eeceheg eeceghe eecegeh eeceegh eeceehg eechege
eecheeg eechgee eechgee eechege eecheeg eecghee eecghee eecgehe eecgeeh eecgeeh eecgehe
eecehge eeceheg eeceghe eecegeh eeceegh eeceehg eehcege eehceeg eehcgee eehcgee eehcege
eehceeg eehecge eeheceg eehegce eehegec eeheegc eeheecg eehgece eehgeec eehgcee eehgcee
eehgece eehgeec eeheegc eeheecg eehegec eehegce eehecge eeheceg eegchee eegchee eegcehe
eegceeh eegceeh eegcehe eeghcee eeghcee eeghece eegheec eegheec eeghece eegehce eegehec
eegeche eegeceh eegeech eegeehc eegehec eegehce eegeehc eegeech eegeceh eegeche eeechge
eeecheg eeecghe eeecgeh eeecegh eeecehg eeehcge eeehceg eeehgce eeehgec eeehegc eeehecg
eeeghce eeeghec eeegche eeegceh eeegech eeegehc eeeehgc eeeehcg eeeeghc eeeegch eeeecgh
eeeechg eceehge eceeheg eceeghe eceegeh eceeegh eceeehg ecehege eceheeg ecehgee ecehgee
ecehege eceheeg eceghee eceghee ecegehe ecegeeh ecegeeh ecegehe eceehge eceeheg eceeghe
eceegeh eceeegh eceeehg eceehge eceeheg eceeghe eceegeh eceeegh eceeehg ecehege eceheeg
ecehgee ecehgee ecehege eceheeg eceghee eceghee ecegehe ecegeeh ecegeeh ecegehe eceehge
eceeheg eceeghe eceegeh eceeegh eceeehg echeege echeeeg echegee echegee echeege echeeeg
echeege echeeeg echegee echegee echeege echeeeg echgeee echgeee echgeee echgeee echgeee
echgeee echeege echeeeg echegee echegee echeege echeeeg ecgehee ecgehee ecgeehe ecgeeeh
ecgeeeh ecgeehe ecgheee ecgheee ecgheee ecgheee ecgheee ecgheee ecgehee ecgehee ecgeehe
ecgeeeh ecgeeeh ecgeehe ecgehee ecgehee ecgeehe ecgeeeh ecgeeeh ecgeehe eceehge eceeheg
eceeghe eceegeh eceeegh eceeehg ecehege eceheeg ecehgee ecehgee ecehege eceheeg eceghee
eceghee ecegehe ecegeeh ecegeeh ecegehe eceehge eceeheg eceeghe eceegeh eceeegh eceeehg
ehecege eheceeg ehecgee ehecgee ehecege eheceeg eheecge eheeceg eheegce eheegec eheeegc
eheeecg ehegece ehegeec ehegcee ehegcee ehegece ehegeec eheeegc eheeecg eheegec eheegce
eheecge eheeceg ehceege ehceeeg ehcegee ehcegee ehceege ehceeeg ehceege ehceeeg ehcegee
ehcegee ehceege ehceeeg ehcgeee ehcgeee ehcgeee ehcgeee ehcgeee ehcgeee ehceege ehceeeg
ehcegee ehcegee ehceege ehceeeg ehecege eheceeg ehecgee ehecgee ehecege eheceeg eheecge
eheeceg eheegce eheegec eheeegc eheeecg ehegece ehegeec ehegcee ehegcee ehegece ehegeec
eheeegc eheeecg eheegec eheegce eheecge eheeceg ehgceee ehgceee ehgceee ehgceee ehgceee
ehgceee ehgecee ehgecee ehgeece ehgeeec ehgeeec ehgeece ehgeece ehgeeec ehgecee ehgecee
ehgeece ehgeeec ehgeeec ehgeece ehgeeec ehgeece ehgecee ehgecee ehecege eheceeg ehecgee
ehecgee ehecege eheceeg eheecge eheeceg eheegce eheegec eheeegc eheeecg ehegece ehegeec
ehegcee ehegcee ehegece ehegeec eheeegc eheeecg eheegec eheegce eheecge eheeceg egechee
egechee egecehe egeceeh egeceeh egecehe egehcee egehcee egehece egeheec egeheec egehece
egeehce egeehec egeeche egeeceh egeeech egeeehc egeehec egeehce egeeehc egeeech egeeceh
egeeche egcehee egcehee egceehe egceeeh egceeeh egceehe egcheee egcheee egcheee egcheee
egcheee egcheee egcehee egcehee egceehe egceeeh egceeeh egceehe egcehee egcehee egceehe
egceeeh egceeeh egceehe eghceee eghceee eghceee eghceee eghceee eghceee eghecee eghecee
egheece egheeec egheeec egheece egheece egheeec eghecee eghecee egheece egheeec egheeec
egheece egheeec egheece eghecee eghecee egechee egechee egecehe egeceeh egeceeh egecehe
egehcee egehcee egehece egeheec egeheec egehece egeehce egeehec egeeche egeeceh egeeech
egeeehc egeehec egeehce egeeehc egeeech egeeceh egeeche egechee egechee egecehe egeceeh
egeceeh egecehe egehcee egehcee egehece egeheec egeheec egehece egeehce egeehec egeeche
egeeceh egeeech egeeehc egeehec egeehce egeeehc egeeech egeeceh egeeche eeechge eeecheg
eeecghe eeecgeh eeecegh eeecehg eeehcge eeehceg eeehgce eeehgec eeehegc eeehecg eeeghce
eeeghec eeegche eeegceh eeegech eeegehc eeeehgc eeeehcg eeeeghc eeeegch eeeecgh eeeechg
eecehge eeceheg eeceghe eecegeh eeceegh eeceehg eechege eecheeg eechgee eechgee eechege
eecheeg eecghee eecghee eecgehe eecgeeh eecgeeh eecgehe eecehge eeceheg eeceghe eecegeh
eeceegh eeceehg eehcege eehceeg eehcgee eehcgee eehcege eehceeg eehecge eeheceg eehegce
eehegec eeheegc eeheecg eehgece eehgeec eehgcee eehgcee eehgece eehgeec eeheegc eeheecg
eehegec eehegce eehecge eeheceg eegchee eegchee eegcehe eegceeh eegceeh eegcehe eeghcee
eeghcee eeghece eegheec eegheec eeghece eegehce eegehec eegeche eegeceh eegeech eegeehc
eegehec eegehce eegeehc eegeech eegeceh eegeche eeechge eeecheg eeecghe eeecgeh eeecegh
eeecehg eeehcge eeehceg eeehgce eeehgec eeehegc eeehecg eeeghce eeeghec eeegche eeegceh
eeegech eeegehc eeeehgc eeeehcg eeeeghc eeeegch eeeecgh eeeechg eeecheg eeechge eeecehg
eeecegh eeecgeh eeecghe eeehceg eeehcge eeehecg eeehegc eeehgec eeehgce eeeehcg eeeehgc
eeeechg eeeecgh eeeegch eeeeghc eeeghec eeeghce eeegehc eeegech eeegceh eeegche eeceheg
eecehge eeceehg eeceegh eecegeh eeceghe eecheeg eechege eecheeg eechege eechgee eechgee
eeceheg eecehge eeceehg eeceegh eecegeh eeceghe eecghee eecghee eecgehe eecgeeh eecgeeh
eecgehe eehceeg eehcege eehceeg eehcege eehcgee eehcgee eeheceg eehecge eeheecg eeheegc
eehegec eehegce eeheecg eeheegc eeheceg eehecge eehegce eehegec eehgeec eehgece eehgeec
eehgece eehgcee eehgcee eeecheg eeechge eeecehg eeecegh eeecgeh eeecghe eeehceg eeehcge
eeehecg eeehegc eeehgec eeehgce eeeehcg eeeehgc eeeechg eeeecgh eeeegch eeeeghc eeeghec
eeeghce eeegehc eeegech eeegceh eeegche eegchee eegchee eegcehe eegceeh eegceeh eegcehe
eeghcee eeghcee eeghece eegheec eegheec eeghece eegehce eegehec eegeche eegeceh eegeech
eegeehc eegehec eegehce eegeehc eegeech eegeceh eegeche eeecheg eeechge eeecehg eeecegh
eeecgeh eeecghe eeehceg eeehcge eeehecg eeehegc eeehgec eeehgce eeeehcg eeeehgc eeeechg
eeeecgh eeeegch eeeeghc eeeghec eeeghce eeegehc eeegech eeegceh eeegche eeceheg eecehge
eeceehg eeceegh eecegeh eeceghe eecheeg eechege eecheeg eechege eechgee eechgee eeceheg
eecehge eeceehg eeceegh eecegeh eeceghe eecghee eecghee eecgehe eecgeeh eecgeeh eecgehe
eehceeg eehcege eehceeg eehcege eehcgee eehcgee eeheceg eehecge eeheecg eeheegc eehegec
eehegce eeheecg eeheegc eeheceg eehecge eehegce eehegec eehgeec eehgece eehgeec eehgece
eehgcee eehgcee eeecheg eeechge eeecehg eeecegh eeecgeh eeecghe eeehceg eeehcge eeehecg
eeehegc eeehgec eeehgce eeeehcg eeeehgc eeeechg eeeecgh eeeegch eeeeghc eeeghec eeeghce
eeegehc eeegech eeegceh eeegche eegchee eegchee eegcehe eegceeh eegceeh eegcehe eeghcee
eeghcee eeghece eegheec eegheec eeghece eegehce eegehec eegeche eegeceh eegeech eegeehc
eegehec eegehce eegeehc eegeech eegeceh eegeche eceeheg eceehge eceeehg eceeegh eceegeh
eceeghe eceheeg ecehege eceheeg ecehege ecehgee ecehgee eceeheg eceehge eceeehg eceeegh
eceegeh eceeghe eceghee eceghee ecegehe ecegeeh ecegeeh ecegehe eceeheg eceehge eceeehg
eceeegh eceegeh eceeghe eceheeg ecehege eceheeg ecehege ecehgee ecehgee eceeheg eceehge
eceeehg eceeegh eceegeh eceeghe eceghee eceghee ecegehe ecegeeh ecegeeh ecegehe echeeeg
echeege echeeeg echeege echegee echegee echeeeg echeege echeeeg echeege echegee echegee
echeeeg echeege echeeeg echeege echegee echegee echgeee echgeee echgeee echgeee echgeee
echgeee eceeheg eceehge eceeehg eceeegh eceegeh eceeghe eceheeg ecehege eceheeg ecehege
ecehgee ecehgee eceeheg eceehge eceeehg eceeegh eceegeh eceeghe eceghee eceghee ecegehe
ecegeeh ecegeeh ecegehe ecgehee ecgehee ecgeehe ecgeeeh ecgeeeh ecgeehe ecgheee ecgheee
ecgheee ecgheee ecgheee ecgheee ecgehee ecgehee ecgeehe ecgeeeh ecgeeeh ecgeehe ecgehee
ecgehee ecgeehe ecgeeeh ecgeeeh ecgeehe eheceeg ehecege eheceeg ehecege ehecgee ehecgee
eheeceg eheecge eheeecg eheeegc eheegec eheegce eheeecg eheeegc eheeceg eheecge eheegce
eheegec ehegeec ehegece ehegeec ehegece ehegcee ehegcee ehceeeg ehceege ehceeeg ehceege
ehcegee ehcegee ehceeeg ehceege ehceeeg ehceege ehcegee ehcegee ehceeeg ehceege ehceeeg
ehceege ehcegee ehcegee ehcgeee ehcgeee ehcgeee ehcgeee ehcgeee ehcgeee eheceeg ehecege
eheceeg ehecege ehecgee ehecgee eheeceg eheecge eheeecg eheeegc eheegec eheegce eheeecg
eheeegc eheeceg eheecge eheegce eheegec ehegeec ehegece ehegeec ehegece ehegcee ehegcee
eheceeg ehecege eheceeg ehecege ehecgee ehecgee eheeceg eheecge eheeecg eheeegc eheegec
eheegce eheeecg eheeegc eheeceg eheecge eheegce eheegec ehegeec ehegece ehegeec ehegece
ehegcee ehegcee ehgceee ehgceee ehgceee ehgceee ehgceee ehgceee ehgecee ehgecee ehgeece
ehgeeec ehgeeec ehgeece ehgeece ehgeeec ehgecee ehgecee ehgeece ehgeeec ehgeeec ehgeece
ehgeeec ehgeece ehgecee ehgecee eeecheg eeechge eeecehg eeecegh eeecgeh eeecghe eeehceg
eeehcge eeehecg eeehegc eeehgec eeehgce eeeehcg eeeehgc eeeechg eeeecgh eeeegch eeeeghc
eeeghec eeeghce eeegehc eeegech eeegceh eeegche eeceheg eecehge eeceehg eeceegh eecegeh
eeceghe eecheeg eechege eecheeg eechege eechgee eechgee eeceheg eecehge eeceehg eeceegh
eecegeh eeceghe eecghee eecghee eecgehe eecgeeh eecgeeh eecgehe eehceeg eehcege eehceeg
eehcege eehcgee eehcgee eeheceg eehecge eeheecg eeheegc eehegec eehegce eeheecg eeheegc
eeheceg eehecge eehegce eehegec eehgeec eehgece eehgeec eehgece eehgcee eehgcee eeecheg
eeechge eeecehg eeecegh eeecgeh eeecghe eeehceg eeehcge eeehecg eeehegc eeehgec eeehgce
eeeehcg eeeehgc eeeechg eeeecgh eeeegch eeeeghc eeeghec eeeghce eeegehc eeegech eeegceh
eeegche eegchee eegchee eegcehe eegceeh eegceeh eegcehe eeghcee eeghcee eeghece eegheec
eegheec eeghece eegehce eegehec eegeche eegeceh eegeech eegeehc eegehec eegehce eegeehc
eegeech eegeceh eegeche egechee egechee egecehe egeceeh egeceeh egecehe egehcee egehcee
egehece egeheec egeheec egehece egeehce egeehec egeeche egeeceh egeeech egeeehc egeehec
egeehce egeeehc egeeech egeeceh egeeche egcehee egcehee egceehe egceeeh egceeeh egceehe
egcheee egcheee egcheee egcheee egcheee egcheee egcehee egcehee egceehe egceeeh egceeeh
egceehe egcehee egcehee egceehe egceeeh egceeeh egceehe eghceee eghceee eghceee eghceee
eghceee eghceee eghecee eghecee egheece egheeec egheeec egheece egheece egheeec eghecee
eghecee egheece egheeec egheeec egheece egheeec egheece eghecee eghecee egechee egechee
egecehe egeceeh egeceeh egecehe egehcee egehcee egehece egeheec egeheec egehece egeehce
egeehec egeeche egeeceh egeeech egeeehc egeehec egeehce egeeehc egeeech egeeceh egeeche
egechee egechee egecehe egeceeh egeceeh egecehe egehcee egehcee egehece egeheec egeheec
egehece egeehce egeehec egeeche egeeceh egeeech egeeehc egeehec egeehce egeeehc egeeech
egeeceh egeeche

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us