easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

radicalisms

querulous

tanaquilque

horologer

grigs

showiest

vestes

taito

vigorito

preaffiliate

makebate

hygrophytic

swidge

bioethics

gettis

colligium

predefinition

maresjew


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: ganner
cipher variations:
hboofs icppgt jdqqhu kerriv lfssjw
mgttkx nhuuly oivvmz pjwwna qkxxob
rlyypc smzzqd tnaare uobbsf vpcctg
wqdduh xreevi ysffwj ztggxk auhhyl
bviizm cwjjan dxkkbo eyllcp fzmmdq

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: ganner
Cipher: tzmmvi

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: ganner
Cipher: AABBA AAAAA ABBAA ABBAA AABAA BAAAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: ganner
cipher variations:
hboofstboonafboovirboodqdboolypbootgnboojwzboore
lboozmxboohujboopcvbooxkicppgtucppobgcppwjscpper
ecppmzqcppuhocppkxacppsfmcppanycppivkcppqdwcppyl
jdqqhuvdqqpchdqqxktdqqfsfdqqnardqqvipdqqlybdqqtg
ndqqbozdqqjwldqqrexdqqzmkerrivwerrqdierryluerrgt
gerrobserrwjqerrmzcerruhoerrcpaerrkxmerrsfyerran
lfssjwxfssrejfsszmvfsshuhfsspctfssxkrfssnadfssvi
pfssdqbfsslynfsstgzfssbomgttkxygttsfkgttanwgttiv
igttqdugttylsgttobegttwjqgttercgttmzogttuhagttcp
nhuulyzhuutglhuuboxhuujwjhuurevhuuzmthuupcfhuuxk
rhuufsdhuunaphuuvibhuudqoivvmzaivvuhmivvcpyivvkx
kivvsfwivvanuivvqdgivvylsivvgteivvobqivvwjcivver
pjwwnabjwwvinjwwdqzjwwlyljwwtgxjwwbovjwwrehjwwzm
tjwwhufjwwpcrjwwxkdjwwfsqkxxobckxxwjokxxerakxxmz
mkxxuhykxxcpwkxxsfikxxanukxxivgkxxqdskxxylekxxgt
rlyypcdlyyxkplyyfsblyynanlyyvizlyydqxlyytgjlyybo
vlyyjwhlyyretlyyzmflyyhusmzzqdemzzylqmzzgtcmzzob
omzzwjamzzerymzzuhkmzzcpwmzzkximzzsfumzzangmzziv
tnaarefnaazmrnaahudnaapcpnaaxkbnaafsznaavilnaadq
xnaalyjnaatgvnaabohnaajwuobbsfgobbansobbiveobbqd
qobbylcobbgtaobbwjmobberyobbmzkobbuhwobbcpiobbkx
vpcctghpccbotpccjwfpccrerpcczmdpcchubpccxknpccfs
zpccnalpccvixpccdqjpcclywqdduhiqddcpuqddkxgqddsf
sqddaneqddivcqddyloqddgtaqddobmqddwjyqdderkqddmz
xreevijreedqvreelyhreetgtreebofreejwdreezmpreehu
breepcnreexkzreefslreenaysffwjksfferwsffmzisffuh
usffcpgsffkxesffanqsffivcsffqdosffylasffgtmsffob
ztggxkltggfsxtggnajtggvivtggdqhtgglyftggbortggjw
dtggreptggzmbtgghuntggpcauhhylmuhhgtyuhhobkuhhwj
wuhheriuhhmzguhhcpsuhhkxeuhhsfquhhancuhhivouhhqd
bviizmnviihuzviipclviixkxviifsjviinahviidqtviily
fviitgrviibodviijwpviirecwjjanowjjivawjjqdmwjjyl
ywjjgtkwjjobiwjjeruwjjmzgwjjuhswjjcpewjjkxqwjjsf
dxkkbopxkkjwbxkkrenxkkzmzxkkhulxkkpcjxkkfsvxkkna
hxkkvitxkkdqfxkklyrxkktgeyllcpqyllkxcyllsfoyllan
ayllivmyllqdkyllgtwyllobiyllwjuyllergyllmzsylluh
fzmmdqrzmmlydzmmtgpzmmbobzmmjwnzmmrelzmmhuxzmmpc
jzmmxkvzmmfshzmmnatzmmvigannersannmzeannuhqanncp
cannkxoannsfmannivyannqdkannylwanngtiannobuannwj

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: ganner
Cipher: tnaare

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: ganner
Cipher: 221133335124

Extended Methods:
Method #1

Plaintext: ganner
method variations:
mfsskwrlxxpbwqccugbvhhzm

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
g a n n e r 
2 1 3 3 5 2 
2 1 3 3 1 4 
They are then read out in rows:
213352213314
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: ganner
Cipher: bnkbnq

Read more ...
Method #3

Plaintext: ganner
method variations:
blnxfi lnxfib nxfibl
xfibln fiblnx iblnxf

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: ganner

all 720 cipher variations:
ganner gannre ganenr ganern ganren ganrne ganner gannre ganenr ganern ganren
ganrne gaennr gaenrn gaennr gaenrn gaernn gaernn garnen garnne garenn garenn
garnen garnne gnaner gnanre gnaenr gnaern gnaren gnarne gnnaer gnnare gnnear
gnnera gnnrea gnnrae gnenar gnenra gneanr gnearn gneran gnerna gnrnea gnrnae
gnrena gnrean gnraen gnrane gnnaer gnnare gnnear gnnera gnnrea gnnrae gnaner
gnanre gnaenr gnaern gnaren gnarne gneanr gnearn gnenar gnenra gnerna gneran
gnraen gnrane gnrean gnrena gnrnea gnrnae gennar gennra genanr genarn genran
genrna gennar gennra genanr genarn genran genrna geannr geanrn geannr geanrn
gearnn gearnn gernan gernna gerann gerann gernan gernna grnnea grnnae grnena
grnean grnaen grnane grnnea grnnae grnena grnean grnaen grnane grenna grenan
grenna grenan greann greann granen granne graenn graenn granen granne agnner
agnnre agnenr agnern agnren agnrne agnner agnnre agnenr agnern agnren agnrne
agennr agenrn agennr agenrn agernn agernn agrnen agrnne agrenn agrenn agrnen
agrnne angner angnre angenr angern angren angrne annger anngre annegr annerg
annreg annrge anengr anenrg anegnr anegrn anergn anerng anrneg anrnge anreng
anregn anrgen anrgne annger anngre annegr annerg annreg annrge angner angnre
angenr angern angren angrne anegnr anegrn anengr anenrg anerng anergn anrgen
anrgne anregn anreng anrneg anrnge aenngr aennrg aengnr aengrn aenrgn aenrng
aenngr aennrg aengnr aengrn aenrgn aenrng aegnnr aegnrn aegnnr aegnrn aegrnn
aegrnn aerngn aernng aergnn aergnn aerngn aernng arnneg arnnge arneng arnegn
arngen arngne arnneg arnnge arneng arnegn arngen arngne arenng arengn arenng
arengn aregnn aregnn argnen argnne argenn argenn argnen argnne nagner nagnre
nagenr nagern nagren nagrne nanger nangre nanegr nanerg nanreg nanrge naengr
naenrg naegnr naegrn naergn naerng narneg narnge nareng naregn nargen nargne
nganer nganre ngaenr ngaern ngaren ngarne ngnaer ngnare ngnear ngnera ngnrea
ngnrae ngenar ngenra ngeanr ngearn ngeran ngerna ngrnea ngrnae ngrena ngrean
ngraen ngrane nngaer nngare nngear nngera nngrea nngrae nnager nnagre nnaegr
nnaerg nnareg nnarge nneagr nnearg nnegar nnegra nnerga nnerag nnraeg nnrage
nnreag nnrega nnrgea nnrgae negnar negnra neganr negarn negran negrna nengar
nengra nenagr nenarg nenrag nenrga neangr neanrg neagnr neagrn neargn nearng
nernag nernga nerang neragn nergan nergna nrgnea nrgnae nrgena nrgean nrgaen
nrgane nrngea nrngae nrnega nrneag nrnaeg nrnage nrenga nrenag nregna nregan
nreagn nreang nraneg nrange nraeng nraegn nragen nragne nanger nangre nanegr
nanerg nanreg nanrge nagner nagnre nagenr nagern nagren nagrne naegnr naegrn
naengr naenrg naerng naergn nargen nargne naregn nareng narneg narnge nnager
nnagre nnaegr nnaerg nnareg nnarge nngaer nngare nngear nngera nngrea nngrae
nnegar nnegra nneagr nnearg nnerag nnerga nnrgea nnrgae nnrega nnreag nnraeg
nnrage ngnaer ngnare ngnear ngnera ngnrea ngnrae nganer nganre ngaenr ngaern
ngaren ngarne ngeanr ngearn ngenar ngenra ngerna ngeran ngraen ngrane ngrean
ngrena ngrnea ngrnae nengar nengra nenagr nenarg nenrag nenrga negnar negnra
neganr negarn negran negrna neagnr neagrn neangr neanrg nearng neargn nergan
nergna neragn nerang nernag nernga nrngea nrngae nrnega nrneag nrnaeg nrnage
nrgnea nrgnae nrgena nrgean nrgaen nrgane nregna nregan nrenga nrenag nreang
nreagn nragen nragne nraegn nraeng nraneg nrange eanngr eannrg eangnr eangrn
eanrgn eanrng eanngr eannrg eangnr eangrn eanrgn eanrng eagnnr eagnrn eagnnr
eagnrn eagrnn eagrnn earngn earnng eargnn eargnn earngn earnng enangr enanrg
enagnr enagrn enargn enarng ennagr ennarg enngar enngra ennrga ennrag engnar
engnra enganr engarn engran engrna enrnga enrnag enrgna enrgan enragn enrang
ennagr ennarg enngar enngra ennrga ennrag enangr enanrg enagnr enagrn enargn
enarng enganr engarn engnar engnra engrna engran enragn enrang enrgan enrgna
enrnga enrnag egnnar egnnra egnanr egnarn egnran egnrna egnnar egnnra egnanr
egnarn egnran egnrna egannr eganrn egannr eganrn egarnn egarnn egrnan egrnna
egrann egrann egrnan egrnna ernnga ernnag erngna erngan ernagn ernang ernnga
ernnag erngna erngan ernagn ernang ergnna ergnan ergnna ergnan ergann ergann
erangn eranng eragnn eragnn erangn eranng ranneg rannge raneng ranegn rangen
rangne ranneg rannge raneng ranegn rangen rangne raenng raengn raenng raengn
raegnn raegnn ragnen ragnne ragenn ragenn ragnen ragnne rnaneg rnange rnaeng
rnaegn rnagen rnagne rnnaeg rnnage rnneag rnnega rnngea rnngae rnenag rnenga
rneang rneagn rnegan rnegna rngnea rngnae rngena rngean rngaen rngane rnnaeg
rnnage rnneag rnnega rnngea rnngae rnaneg rnange rnaeng rnaegn rnagen rnagne
rneang rneagn rnenag rnenga rnegna rnegan rngaen rngane rngean rngena rngnea
rngnae rennag rennga renang renagn rengan rengna rennag rennga renang renagn
rengan rengna reanng reangn reanng reangn reagnn reagnn regnan regnna regann
regann regnan regnna rgnnea rgnnae rgnena rgnean rgnaen rgnane rgnnea rgnnae
rgnena rgnean rgnaen rgnane rgenna rgenan rgenna rgenan rgeann rgeann rganen
rganne rgaenn rgaenn rganen rganne

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us