easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

pinangs

wilmaw

annarbor

dysidrosis

talosians

kruegeri

unmercifully

montpelier

urlar

satinlike

telphers

loveaholic

sarko

willowed

copter

jschneid

tylar

mullaly


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: freefd
cipher variations:
gsffge htgghf iuhhig jviijh kwjjki
lxkklj myllmk nzmmnl oannom pboopn
qcppqo rdqqrp serrsq tfsstr ugttus
vhuuvt wivvwu xjwwxv ykxxyw zlyyzx
amzzay bnaabz cobbca dpccdb eqddec

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: freefd
Cipher: uivvuw

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: freefd
Cipher: AABAB BAAAA AABAA AABAA AABAB AAABB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: freefd
cipher variations:
gsffgeqannqkaivvaqkqddkwuyllucegtteiywjjyuierria
smzzsgcuhhcmmcppmswkxxwyhtgghfrboorlbjwwbrlreelx
vzmmvdfhuufjzxkkzvjfssjbtnaathdviidnndqqntxlyyxz
iuhhigscppsmckxxcsmsffmywannwegivvgkayllawkgttkc
uobbuiewjjeooerrouymzzyajviijhtdqqtndlyydtntggnz
xbooxfhjwwhlbzmmbxlhuuldvpccvjfxkkfppfsspvznaazb
kwjjkiuerruoemzzeuouhhoaycppygikxximcanncymivvme
wqddwkgyllgqqgttqwaobbaclxkkljvfssvpfnaafvpviipb
zdqqzhjlyyjndboodznjwwnfxreexlhzmmhrrhuurxbpccbd
myllmkwgttwqgobbgwqwjjqcaerraikmzzkoecppeaokxxog
ysffymiannissivvsycqddcenzmmnlxhuuxrhpcchxrxkkrd
bfssbjlnaalpfdqqfbplyyphztggznjboojttjwwtzdreedf
oannomyivvysiqddiysyllsecgttckmobbmqgerrgcqmzzqi
auhhaokcppkuukxxuaesffegpboopnzjwwztjreejztzmmtf
dhuudlnpccnrhfsshdrnaarjbviibpldqqlvvlyyvbftggfh
qcppqoakxxauksffkauannugeivvemoqddosigttiesobbsk
cwjjcqmerrmwwmzzwcguhhgirdqqrpblyybvltgglbvboovh
fjwwfnpreeptjhuujftpcctldxkkdrnfssnxxnaaxdhviihj
serrsqcmzzcwmuhhmcwcppwigkxxgoqsffqukivvkguqddum
eyllesogttoyyobbyeiwjjiktfsstrdnaadxnviindxdqqxj
hlyyhprtggrvljwwlhvreevnfzmmftphuupzzpcczfjxkkjl
ugttuseobbeyowjjoeyerrykimzziqsuhhswmkxxmiwsffwo
gannguqivvqaaqddagkyllkmvhuuvtfpccfzpxkkpfzfsszl
jnaajrtviitxnlyynjxtggxphboohvrjwwrbbreebhlzmmln
wivvwugqddgaqyllqgagttamkobbksuwjjuyomzzokyuhhyq
icppiwskxxsccsffcimannmoxjwwxvhreehbrzmmrhbhuubn
lpccltvxkkvzpnaaplzviizrjdqqjxtlyytddtggdjnboonp
ykxxywisfficsannsicivvcomqddmuwyllwaqobbqmawjjas
kerrkyumzzueeuhhekocppoqzlyyzxjtggjdtbootjdjwwdp
nreenvxzmmxbrpccrnbxkkbtlfsslzvnaavffviiflpdqqpr
amzzaykuhhkeucppukekxxeqosffowyannycsqddsocyllcu
mgttmawobbwggwjjgmqerrqsbnaabzlviilfvdqqvlflyyfr
ptggpxzboozdtreetpdzmmdvnhuunbxpccxhhxkkhnrfssrt
cobbcamwjjmgwerrwmgmzzgsquhhqyacppaeusffuqeannew
oivvocyqddyiiylliosgttsudpccdbnxkknhxfssxnhnaaht
rviirzbdqqbfvtggvrfboofxpjwwpdzreezjjzmmjpthuutv
eqddecoylloiygttyoiobbiuswjjsacerrcgwuhhwsgcppgy
qkxxqeasffakkannkquivvuwfreefdpzmmpjzhuuzpjpccjv
txkktbdfssdhxviixthdqqhzrlyyrfbtggbllboolrvjwwvx

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: freefd
Cipher: serrsq

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: freefd
Cipher: 122451511241

Extended Methods:
Method #1

Plaintext: freefd
method variations:
lwkkliqbppqovguuvtamzzay

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
f r e e f d 
1 2 5 5 1 4 
2 4 1 1 2 1 
They are then read out in rows:
125514241121
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: freefd
Cipher: fzqrab

Read more ...
Method #3

Plaintext: freefd
method variations:
gyvara yvarag varagy
aragyv ragyva agyvar

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: freefd

all 720 cipher variations:
freefd freedf frefed frefde fredfe fredef freefd freedf frefed frefde fredfe
fredef frfeed frfede frfeed frfede frfdee frfdee frdefe frdeef frdfee frdfee
frdefe frdeef ferefd feredf ferfed ferfde ferdfe ferdef feerfd feerdf feefrd
feefdr feedfr feedrf feferd fefedr fefred fefrde fefdre fefder fedefr federf
fedfer fedfre fedrfe fedref feerfd feerdf feefrd feefdr feedfr feedrf ferefd
feredf ferfed ferfde ferdfe ferdef fefred fefrde feferd fefedr fefder fefdre
fedrfe fedref fedfre fedfer fedefr federf ffeerd ffeedr ffered fferde ffedre
ffeder ffeerd ffeedr ffered fferde ffedre ffeder ffreed ffrede ffreed ffrede
ffrdee ffrdee ffdere ffdeer ffdree ffdree ffdere ffdeer fdeefr fdeerf fdefer
fdefre fderfe fderef fdeefr fdeerf fdefer fdefre fderfe fderef fdfeer fdfere
fdfeer fdfere fdfree fdfree fdrefe fdreef fdrfee fdrfee fdrefe fdreef rfeefd
rfeedf rfefed rfefde rfedfe rfedef rfeefd rfeedf rfefed rfefde rfedfe rfedef
rffeed rffede rffeed rffede rffdee rffdee rfdefe rfdeef rfdfee rfdfee rfdefe
rfdeef refefd refedf reffed reffde refdfe refdef reeffd reefdf reeffd reefdf
reedff reedff refefd refedf reffed reffde refdfe refdef redeff redeff redfef
redffe redffe redfef reeffd reefdf reeffd reefdf reedff reedff refefd refedf
reffed reffde refdfe refdef reffed reffde refefd refedf refdef refdfe redffe
redfef redffe redfef redeff redeff rfeefd rfeedf rfefed rfefde rfedfe rfedef
rfeefd rfeedf rfefed rfefde rfedfe rfedef rffeed rffede rffeed rffede rffdee
rffdee rfdefe rfdeef rfdfee rfdfee rfdefe rfdeef rdeeff rdeeff rdefef rdeffe
rdeffe rdefef rdeeff rdeeff rdefef rdeffe rdeffe rdefef rdfeef rdfefe rdfeef
rdfefe rdffee rdffee rdfefe rdfeef rdffee rdffee rdfefe rdfeef erfefd erfedf
erffed erffde erfdfe erfdef ereffd erefdf ereffd erefdf eredff eredff erfefd
erfedf erffed erffde erfdfe erfdef erdeff erdeff erdfef erdffe erdffe erdfef
efrefd efredf efrfed efrfde efrdfe efrdef eferfd eferdf efefrd efefdr efedfr
efedrf efferd effedr effred effrde effdre effder efdefr efderf efdfer efdfre
efdrfe efdref eefrfd eefrdf eeffrd eeffdr eefdfr eefdrf eerffd eerfdf eerffd
eerfdf eerdff eerdff eefrfd eefrdf eeffrd eeffdr eefdfr eefdrf eedrff eedrff
eedfrf eedffr eedffr eedfrf efferd effedr effred effrde effdre effder efefrd
efefdr eferfd eferdf efedrf efedfr efrefd efredf efrfed efrfde efrdfe efrdef
efderf efdefr efdref efdrfe efdfre efdfer edfefr edferf edffer edffre edfrfe
edfref edeffr edefrf edeffr edefrf ederff ederff edfefr edferf edffer edffre
edfrfe edfref edreff edreff edrfef edrffe edrffe edrfef ereffd erefdf ereffd
erefdf eredff eredff erfefd erfedf erffed erffde erfdfe erfdef erffed erffde
erfefd erfedf erfdef erfdfe erdffe erdfef erdffe erdfef erdeff erdeff eerffd
eerfdf eerffd eerfdf eerdff eerdff eefrfd eefrdf eeffrd eeffdr eefdfr eefdrf
eeffrd eeffdr eefrfd eefrdf eefdrf eefdfr eedffr eedfrf eedffr eedfrf eedrff
eedrff eferfd eferdf efefrd efefdr efedfr efedrf efrefd efredf efrfed efrfde
efrdfe efrdef effred effrde efferd effedr effder effdre efdrfe efdref efdfre
efdfer efdefr efderf efefrd efefdr eferfd eferdf efedrf efedfr efferd effedr
effred effrde effdre effder efrfed efrfde efrefd efredf efrdef efrdfe efdfre
efdfer efdrfe efdref efderf efdefr edeffr edefrf edeffr edefrf ederff ederff
edfefr edferf edffer edffre edfrfe edfref edffer edffre edfefr edferf edfref
edfrfe edrffe edrfef edrffe edrfef edreff edreff freefd freedf frefed frefde
fredfe fredef freefd freedf frefed frefde fredfe fredef frfeed frfede frfeed
frfede frfdee frfdee frdefe frdeef frdfee frdfee frdefe frdeef ferefd feredf
ferfed ferfde ferdfe ferdef feerfd feerdf feefrd feefdr feedfr feedrf feferd
fefedr fefred fefrde fefdre fefder fedefr federf fedfer fedfre fedrfe fedref
feerfd feerdf feefrd feefdr feedfr feedrf ferefd feredf ferfed ferfde ferdfe
ferdef fefred fefrde feferd fefedr fefder fefdre fedrfe fedref fedfre fedfer
fedefr federf ffeerd ffeedr ffered fferde ffedre ffeder ffeerd ffeedr ffered
fferde ffedre ffeder ffreed ffrede ffreed ffrede ffrdee ffrdee ffdere ffdeer
ffdree ffdree ffdere ffdeer fdeefr fdeerf fdefer fdefre fderfe fderef fdeefr
fdeerf fdefer fdefre fderfe fderef fdfeer fdfere fdfeer fdfere fdfree fdfree
fdrefe fdreef fdrfee fdrfee fdrefe fdreef dreeff dreeff drefef dreffe dreffe
drefef dreeff dreeff drefef dreffe dreffe drefef drfeef drfefe drfeef drfefe
drffee drffee drfefe drfeef drffee drffee drfefe drfeef dereff dereff derfef
derffe derffe derfef deerff deerff deefrf deeffr deeffr deefrf deferf defefr
defref defrfe deffre deffer defefr deferf deffer deffre defrfe defref deerff
deerff deefrf deeffr deeffr deefrf dereff dereff derfef derffe derffe derfef
defref defrfe deferf defefr deffer deffre defrfe defref deffre deffer defefr
deferf dfeerf dfeefr dferef dferfe dfefre dfefer dfeerf dfeefr dferef dferfe
dfefre dfefer dfreef dfrefe dfreef dfrefe dfrfee dfrfee dffere dffeer dffree
dffree dffere dffeer dfeefr dfeerf dfefer dfefre dferfe dferef dfeefr dfeerf
dfefer dfefre dferfe dferef dffeer dffere dffeer dffere dffree dffree dfrefe
dfreef dfrfee dfrfee dfrefe dfreef

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us