easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

respirational

rizzo

alcoholometry

nacket

impregnates

metaphloem

selland

hungaricus

syncarida

depicts

libere

hermaphroditical

katzur

stogdill

tangetisque

indeformable

greenmountainfalls

easthanover


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: fraudeque
cipher variations:
gsbvefrvf htcwfgswg iudxghtxh jveyhiuyi kwfzijvzj
lxgajkwak myhbklxbl nziclmycm oajdmnzdn pbkenoaeo
qclfopbfp rdmgpqcgq senhqrdhr tfoirseis ugpjstfjt
vhqktugku wirluvhlv xjsmvwimw yktnwxjnx zluoxykoy
amvpyzlpz bnwqzamqa coxrabnrb dpysbcosc eqztcdptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: fraudeque
Cipher: uizfwvjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: fraudeque
Cipher: AABAB BAAAA AAAAA BAABB AAABB AABAA ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: fraudeque
cipher variations:
gsbvefrvfqabjknxjnaibxqvdxvkqblwdjlduybzclpzlegbnitvntywbpujhpjiebdarndr
smbrgztrzcubfmhzfhmcbtspftpwkbhyxlhxhtcwfgswgrbckloykobjcyrweywlrcmxekme
vzcadmqamfhcojuwouzxcqvkiqkjfcebsoestncshausadvcgniagindcutqguqxlcizymiy
iudxghtxhscdlmpzlpckdzsxfzxmsdnyflnfwadbenrbngidpkvxpvaydrwljrlkgdfctpft
uodtibvtbewdhojbhjoedvurhvrymdjaznjzjveyhiuyitdemnqamqdleatygaynteozgmog
xbecfoscohjeqlwyqwbzesxmksmlhegduqguvpeujcwucfxeipkcikpfewvsiwsznekbaoka
kwfzijvzjuefnorbnremfbuzhbzoufpahnphycfdgptdpikfrmxzrxcaftynltnmifhevrhv
wqfvkdxvdgyfjqldjlqgfxwtjxtaoflcbplblxgajkwakvfgopscosfngcvaicapvgqbioqi
zdgehqueqjlgsnyasydbguzomuonjgifwsiwxrgwleywehzgkrmekmrhgyxukyubpgmdcqmc
myhbklxblwghpqtdptgohdwbjdbqwhrcjprjaehfirvfrkmhtozbtzechvapnvpokhjgxtjx
yshxmfzxfiahlsnflnsihzyvlzvcqhnedrndnziclmycmxhiqruequhpiexckecrxisdkqsk
bfigjswgslniupacuafdiwbqowqplikhyukyztiyngaygjbimtogmotjiazwmawdriofesoe
oajdmnzdnyijrsvfrviqjfydlfdsyjtelrtlcgjhktxhtmojvqbdvbgejxcrpxrqmjlizvlz
aujzohbzhkcjnuphnpukjbaxnbxesjpgftpfpbkenoaeozjkstwgswjrkgzemgetzkufmsum
dhkiluyiunpkwrcewchfkydsqysrnkmjawmabvkapicaildkovqioqvlkcbyocyftkqhguqg
qclfopbfpakltuxhtxkslhafnhfualvgntvneiljmvzjvoqlxsdfxdiglzetrztsolnkbxnb
cwlbqjdbjmelpwrjprwmldczpdzgulrihvrhrdmgpqcgqblmuvyiuyltmibgoigvbmwhouwo
fjmknwakwprmytegyejhmafusautpmolcyocdxmcrkecknfmqxskqsxnmedaqeahvmsjiwsi
senhqrdhrcmnvwzjvzmunjchpjhwcnxipvxpgknloxblxqsnzufhzfkinbgvtbvuqnpmdzpd
eyndslfdlognrytlrtyonfebrfbiwntkjxtjtfoirseisdnowxakwanvokdiqkixdoyjqwyq
hlompycmyrtoavgiagljochwucwvroqneaqefzoetmgemphoszumsuzpogfcsgcjxoulkyuk
ugpjstfjteopxyblxbowplejrljyepzkrxzrimpnqzdnzsupbwhjbhmkpdixvdxwsprofbrf
gapfunhfnqiptavntvaqphgdthdkypvmlzvlvhqktugkufpqyzcmycpxqmfksmkzfqalsyas
jnqoraeoatvqcxikcinlqejyweyxtqspgcsghbqgvoigorjqubwouwbrqiheuielzqwnmawm
wirluvhlvgqrzadnzdqyrngltnlagrbmtzbtkorpsbfpbuwrdyjldjomrfkzxfzyurtqhdth
icrhwpjhpskrvcxpvxcsrjifvjfmarxonbxnxjsmvwimwhrsabeoaerzsohmuombhscnuacu
lpsqtcgqcvxsezkmekpnsglaygazvsurieuijdsixqkiqtlswdyqwydtskjgwkgnbsypocyo
yktnwxjnxistbcfpbfsatpinvpncitdovbdvmqtrudhrdwytfalnflqothmbzhbawtvsjfvj
ketjyrljrumtxezrxzeutlkhxlhoctzqpdzpzluoxykoyjtucdgqcgtbuqjowqodjuepwcew
nrusveisexzugbmogmrpuincaicbxuwtkgwklfukzsmksvnuyfasyafvumliymipduarqeaq
amvpyzlpzkuvdehrdhucvrkpxrpekvfqxdfxosvtwfjtfyavhcnphnsqvjodbjdcyvxulhxl
mgvlatnltwovzgbtzbgwvnmjznjqevbsrfbrbnwqzamqalvwefiseivdwslqysqflwgryegy
ptwuxgkugzbwidoqiotrwkpeckedzwyvmiymnhwmbuomuxpwahcuachxwonkaokrfwctsgcs
coxrabnrbmwxfgjtfjwextmrztrgmxhszfhzquxvyhlvhacxjeprjpusxlqfdlfeaxzwnjzn
oixncvpnvyqxbidvbdiyxpolbplsgxduthdtdpysbcoscnxyghkugkxfyunsaushnyitagia
rvywzimwibdykfqskqvtymrgemgfbyaxokaopjyodwqowzrycjewcejzyqpmcqmthyevuieu
eqztcdptdoyzhilvhlygzvotbvtiozjubhjbswzxajnxjcezlgrtlrwuznshfnhgczbyplbp
qkzpexrpxaszdkfxdfkazrqndrnuizfwvjfvfraudequepzaijmwimzhawpucwujpakvcikc
txaybkoykdfamhsumsxvaotigoihdaczqmcqrlaqfysqybtaelgyeglbasroesovjagxwkgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: fraudeque
Cipher: senhqrdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: fraudeque
Cipher: 122411544151145451

Extended Methods:
Method #1

Plaintext: fraudeque
method variations:
lwfzikvzkqbleopaepvgqktufkuamvpyzlpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
f r a u d e q u e 
1 2 1 5 4 5 1 5 5 
2 4 1 4 1 1 4 4 1 
They are then read out in rows:
121545155241411441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: fraudeque
Cipher: fvyvkddqd

Read more ...
Method #3

Plaintext: fraudeque
method variations:
gdvtvayya dvtvayyag vtvayyagd
tvayyagdv vayyagdvt ayyagdvtv
yyagdvtva yagdvtvay agdvtvayy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: fraudeque

first 5040 cipher variations(362880 total)
fraudeque fraudeqeu fraudeuqe fraudeueq fraudeeuq fraudeequ fraudqeue fraudqeeu fraudquee fraudquee fraudqeue
fraudqeeu frauduqee frauduqee fraudueqe fraudueeq fraudueeq fraudueqe fraudeque fraudeqeu fraudeuqe fraudeueq
fraudeeuq fraudeequ frauedque frauedqeu fraueduqe frauedueq frauedeuq frauedequ fraueqdue fraueqdeu frauequde
frauequed fraueqeud fraueqedu fraueuqde fraueuqed fraueudqe fraueudeq fraueuedq fraueueqd fraueequd fraueeqdu
fraueeuqd fraueeudq fraueeduq fraueedqu frauqedue frauqedeu frauqeude frauqeued frauqeeud frauqeedu frauqdeue
frauqdeeu frauqduee frauqduee frauqdeue frauqdeeu frauqudee frauqudee frauquede frauqueed frauqueed frauquede
frauqedue frauqedeu frauqeude frauqeued frauqeeud frauqeedu frauueqde frauueqed frauuedqe frauuedeq frauueedq
frauueeqd frauuqede frauuqeed frauuqdee frauuqdee frauuqede frauuqeed frauudqee frauudqee frauudeqe frauudeeq
frauudeeq frauudeqe frauueqde frauueqed frauuedqe frauuedeq frauueedq frauueeqd fraueequd fraueeqdu fraueeuqd
fraueeudq fraueeduq fraueedqu fraueqeud fraueqedu frauequed frauequde fraueqdue fraueqdeu fraueuqed fraueuqde
fraueueqd fraueuedq fraueudeq fraueudqe frauedque frauedqeu fraueduqe frauedueq frauedeuq frauedequ fradueque
fradueqeu fradueuqe fradueueq fradueeuq fradueequ fraduqeue fraduqeeu fraduquee fraduquee fraduqeue fraduqeeu
fraduuqee fraduuqee fraduueqe fraduueeq fraduueeq fraduueqe fradueque fradueqeu fradueuqe fradueueq fradueeuq
fradueequ fradeuque fradeuqeu fradeuuqe fradeuueq fradeueuq fradeuequ fradequue fradequeu fradequue fradequeu
fradeqeuu fradeqeuu fradeuque fradeuqeu fradeuuqe fradeuueq fradeueuq fradeuequ fradeequu fradeequu fradeeuqu
fradeeuuq fradeeuuq fradeeuqu fradqeuue fradqeueu fradqeuue fradqeueu fradqeeuu fradqeeuu fradqueue fradqueeu
fradquuee fradquuee fradqueue fradqueeu fradquuee fradquuee fradqueue fradqueeu fradqueeu fradqueue fradqeuue
fradqeueu fradqeuue fradqeueu fradqeeuu fradqeeuu fradueque fradueqeu fradueuqe fradueueq fradueeuq fradueequ
fraduqeue fraduqeeu fraduquee fraduquee fraduqeue fraduqeeu fraduuqee fraduuqee fraduueqe fraduueeq fraduueeq
fraduueqe fradueque fradueqeu fradueuqe fradueueq fradueeuq fradueequ fradeequu fradeequu fradeeuqu fradeeuuq
fradeeuuq fradeeuqu fradeqeuu fradeqeuu fradequeu fradequue fradequue fradequeu fradeuqeu fradeuque fradeuequ
fradeueuq fradeuueq fradeuuqe fradeuque fradeuqeu fradeuuqe fradeuueq fradeueuq fradeuequ fraeduque fraeduqeu
fraeduuqe fraeduueq fraedueuq fraeduequ fraedquue fraedqueu fraedquue fraedqueu fraedqeuu fraedqeuu fraeduque
fraeduqeu fraeduuqe fraeduueq fraedueuq fraeduequ fraedequu fraedequu fraedeuqu fraedeuuq fraedeuuq fraedeuqu
fraeudque fraeudqeu fraeuduqe fraeudueq fraeudeuq fraeudequ fraeuqdue fraeuqdeu fraeuqude fraeuqued fraeuqeud
fraeuqedu fraeuuqde fraeuuqed fraeuudqe fraeuudeq fraeuuedq fraeuueqd fraeuequd fraeueqdu fraeueuqd fraeueudq
fraeueduq fraeuedqu fraequdue fraequdeu fraequude fraequued fraequeud fraequedu fraeqduue fraeqdueu fraeqduue
fraeqdueu fraeqdeuu fraeqdeuu fraequdue fraequdeu fraequude fraequued fraequeud fraequedu fraeqeduu fraeqeduu
fraeqeudu fraeqeuud fraeqeuud fraeqeudu fraeuuqde fraeuuqed fraeuudqe fraeuudeq fraeuuedq fraeuueqd fraeuqude
fraeuqued fraeuqdue fraeuqdeu fraeuqedu fraeuqeud fraeudque fraeudqeu fraeuduqe fraeudueq fraeudeuq fraeudequ
fraeueqdu fraeuequd fraeuedqu fraeueduq fraeueudq fraeueuqd fraeeuqud fraeeuqdu fraeeuuqd fraeeuudq fraeeuduq
fraeeudqu fraeequud fraeequdu fraeequud fraeequdu fraeeqduu fraeeqduu fraeeuqud fraeeuqdu fraeeuuqd fraeeuudq
fraeeuduq fraeeudqu fraeedquu fraeedquu fraeeduqu fraeeduuq fraeeduuq fraeeduqu fraqdeuue fraqdeueu fraqdeuue
fraqdeueu fraqdeeuu fraqdeeuu fraqdueue fraqdueeu fraqduuee fraqduuee fraqdueue fraqdueeu fraqduuee fraqduuee
fraqdueue fraqdueeu fraqdueeu fraqdueue fraqdeuue fraqdeueu fraqdeuue fraqdeueu fraqdeeuu fraqdeeuu fraqeduue
fraqedueu fraqeduue fraqedueu fraqedeuu fraqedeuu fraqeudue fraqeudeu fraqeuude fraqeuued fraqeueud fraqeuedu
fraqeuude fraqeuued fraqeudue fraqeudeu fraqeuedu fraqeueud fraqeeuud fraqeeudu fraqeeuud fraqeeudu fraqeeduu
fraqeeduu fraquedue fraquedeu fraqueude fraqueued fraqueeud fraqueedu fraqudeue fraqudeeu fraquduee fraquduee
fraqudeue fraqudeeu fraquudee fraquudee fraquuede fraquueed fraquueed fraquuede fraquedue fraquedeu fraqueude
fraqueued fraqueeud fraqueedu fraqueude fraqueued fraquedue fraquedeu fraqueedu fraqueeud fraquuede fraquueed
fraquudee fraquudee fraquuede fraquueed fraquduee fraquduee fraqudeue fraqudeeu fraqudeeu fraqudeue fraqueude
fraqueued fraquedue fraquedeu fraqueedu fraqueeud fraqeeuud fraqeeudu fraqeeuud fraqeeudu fraqeeduu fraqeeduu
fraqeueud fraqeuedu fraqeuued fraqeuude fraqeudue fraqeudeu fraqeuued fraqeuude fraqeueud fraqeuedu fraqeudeu
fraqeudue fraqeduue fraqedueu fraqeduue fraqedueu fraqedeuu fraqedeuu fraudeque fraudeqeu fraudeuqe fraudeueq
fraudeeuq fraudeequ fraudqeue fraudqeeu fraudquee fraudquee fraudqeue fraudqeeu frauduqee frauduqee fraudueqe
fraudueeq fraudueeq fraudueqe fraudeque fraudeqeu fraudeuqe fraudeueq fraudeeuq fraudeequ frauedque frauedqeu
fraueduqe frauedueq frauedeuq frauedequ fraueqdue fraueqdeu frauequde frauequed fraueqeud fraueqedu fraueuqde
fraueuqed fraueudqe fraueudeq fraueuedq fraueueqd fraueequd fraueeqdu fraueeuqd fraueeudq fraueeduq fraueedqu
frauqedue frauqedeu frauqeude frauqeued frauqeeud frauqeedu frauqdeue frauqdeeu frauqduee frauqduee frauqdeue
frauqdeeu frauqudee frauqudee frauquede frauqueed frauqueed frauquede frauqedue frauqedeu frauqeude frauqeued
frauqeeud frauqeedu frauueqde frauueqed frauuedqe frauuedeq frauueedq frauueeqd frauuqede frauuqeed frauuqdee
frauuqdee frauuqede frauuqeed frauudqee frauudqee frauudeqe frauudeeq frauudeeq frauudeqe frauueqde frauueqed
frauuedqe frauuedeq frauueedq frauueeqd fraueequd fraueeqdu fraueeuqd fraueeudq fraueeduq fraueedqu fraueqeud
fraueqedu frauequed frauequde fraueqdue fraueqdeu fraueuqed fraueuqde fraueueqd fraueuedq fraueudeq fraueudqe
frauedque frauedqeu fraueduqe frauedueq frauedeuq frauedequ fraedequu fraedequu fraedeuqu fraedeuuq fraedeuuq
fraedeuqu fraedqeuu fraedqeuu fraedqueu fraedquue fraedquue fraedqueu fraeduqeu fraeduque fraeduequ fraedueuq
fraeduueq fraeduuqe fraeduque fraeduqeu fraeduuqe fraeduueq fraedueuq fraeduequ fraeedquu fraeedquu fraeeduqu
fraeeduuq fraeeduuq fraeeduqu fraeeqduu fraeeqduu fraeequdu fraeequud fraeequud fraeequdu fraeeuqdu fraeeuqud
fraeeudqu fraeeuduq fraeeuudq fraeeuuqd fraeeuqud fraeeuqdu fraeeuuqd fraeeuudq fraeeuduq fraeeudqu fraeqeduu
fraeqeduu fraeqeudu fraeqeuud fraeqeuud fraeqeudu fraeqdeuu fraeqdeuu fraeqdueu fraeqduue fraeqduue fraeqdueu
fraequdeu fraequdue fraequedu fraequeud fraequued fraequude fraequdue fraequdeu fraequude fraequued fraequeud
fraequedu fraeueqdu fraeuequd fraeuedqu fraeueduq fraeueudq fraeueuqd fraeuqedu fraeuqeud fraeuqdeu fraeuqdue
fraeuqude fraeuqued fraeudqeu fraeudque fraeudequ fraeudeuq fraeudueq fraeuduqe fraeuuqde fraeuuqed fraeuudqe
fraeuudeq fraeuuedq fraeuueqd fraeuequd fraeueqdu fraeueuqd fraeueudq fraeueduq fraeuedqu fraeuqeud fraeuqedu
fraeuqued fraeuqude fraeuqdue fraeuqdeu fraeuuqed fraeuuqde fraeuueqd fraeuuedq fraeuudeq fraeuudqe fraeudque
fraeudqeu fraeuduqe fraeudueq fraeudeuq fraeudequ fruadeque fruadeqeu fruadeuqe fruadeueq fruadeeuq fruadeequ
fruadqeue fruadqeeu fruadquee fruadquee fruadqeue fruadqeeu fruaduqee fruaduqee fruadueqe fruadueeq fruadueeq
fruadueqe fruadeque fruadeqeu fruadeuqe fruadeueq fruadeeuq fruadeequ fruaedque fruaedqeu fruaeduqe fruaedueq
fruaedeuq fruaedequ fruaeqdue fruaeqdeu fruaequde fruaequed fruaeqeud fruaeqedu fruaeuqde fruaeuqed fruaeudqe
fruaeudeq fruaeuedq fruaeueqd fruaeequd fruaeeqdu fruaeeuqd fruaeeudq fruaeeduq fruaeedqu fruaqedue fruaqedeu
fruaqeude fruaqeued fruaqeeud fruaqeedu fruaqdeue fruaqdeeu fruaqduee fruaqduee fruaqdeue fruaqdeeu fruaqudee
fruaqudee fruaquede fruaqueed fruaqueed fruaquede fruaqedue fruaqedeu fruaqeude fruaqeued fruaqeeud fruaqeedu
fruaueqde fruaueqed fruauedqe fruauedeq fruaueedq fruaueeqd fruauqede fruauqeed fruauqdee fruauqdee fruauqede
fruauqeed fruaudqee fruaudqee fruaudeqe fruaudeeq fruaudeeq fruaudeqe fruaueqde fruaueqed fruauedqe fruauedeq
fruaueedq fruaueeqd fruaeequd fruaeeqdu fruaeeuqd fruaeeudq fruaeeduq fruaeedqu fruaeqeud fruaeqedu fruaequed
fruaequde fruaeqdue fruaeqdeu fruaeuqed fruaeuqde fruaeueqd fruaeuedq fruaeudeq fruaeudqe fruaedque fruaedqeu
fruaeduqe fruaedueq fruaedeuq fruaedequ frudaeque frudaeqeu frudaeuqe frudaeueq frudaeeuq frudaeequ frudaqeue
frudaqeeu frudaquee frudaquee frudaqeue frudaqeeu frudauqee frudauqee frudaueqe frudaueeq frudaueeq frudaueqe
frudaeque frudaeqeu frudaeuqe frudaeueq frudaeeuq frudaeequ frudeaque frudeaqeu frudeauqe frudeaueq frudeaeuq
frudeaequ frudeqaue frudeqaeu frudequae frudequea frudeqeua frudeqeau frudeuqae frudeuqea frudeuaqe frudeuaeq
frudeueaq frudeueqa frudeequa frudeeqau frudeeuqa frudeeuaq frudeeauq frudeeaqu frudqeaue frudqeaeu frudqeuae
frudqeuea frudqeeua frudqeeau frudqaeue frudqaeeu frudqauee frudqauee frudqaeue frudqaeeu frudquaee frudquaee
frudqueae frudqueea frudqueea frudqueae frudqeaue frudqeaeu frudqeuae frudqeuea frudqeeua frudqeeau frudueqae
frudueqea frudueaqe frudueaeq frudueeaq frudueeqa fruduqeae fruduqeea fruduqaee fruduqaee fruduqeae fruduqeea
fruduaqee fruduaqee fruduaeqe fruduaeeq fruduaeeq fruduaeqe frudueqae frudueqea frudueaqe frudueaeq frudueeaq
frudueeqa frudeequa frudeeqau frudeeuqa frudeeuaq frudeeauq frudeeaqu frudeqeua frudeqeau frudequea frudequae
frudeqaue frudeqaeu frudeuqea frudeuqae frudeueqa frudeueaq frudeuaeq frudeuaqe frudeaque frudeaqeu frudeauqe
frudeaueq frudeaeuq frudeaequ fruedaque fruedaqeu fruedauqe fruedaueq fruedaeuq fruedaequ fruedqaue fruedqaeu
fruedquae fruedquea fruedqeua fruedqeau frueduqae frueduqea frueduaqe frueduaeq fruedueaq fruedueqa fruedequa
fruedeqau fruedeuqa fruedeuaq fruedeauq fruedeaqu frueadque frueadqeu frueaduqe frueadueq frueadeuq frueadequ
frueaqdue frueaqdeu frueaqude frueaqued frueaqeud frueaqedu frueauqde frueauqed frueaudqe frueaudeq frueauedq
frueaueqd frueaequd frueaeqdu frueaeuqd frueaeudq frueaeduq frueaedqu frueqadue frueqadeu frueqaude frueqaued
frueqaeud frueqaedu frueqdaue frueqdaeu frueqduae frueqduea frueqdeua frueqdeau fruequdae fruequdea fruequade
fruequaed fruequead fruequeda frueqedua frueqedau frueqeuda frueqeuad frueqeaud frueqeadu frueuaqde frueuaqed
frueuadqe frueuadeq frueuaedq frueuaeqd frueuqade frueuqaed frueuqdae frueuqdea frueuqeda frueuqead frueudqae
frueudqea frueudaqe frueudaeq frueudeaq frueudeqa frueueqda frueueqad frueuedqa frueuedaq frueueadq frueueaqd
frueeaqud frueeaqdu frueeauqd frueeaudq frueeaduq frueeadqu frueeqaud frueeqadu frueequad frueequda frueeqdua
frueeqdau frueeuqad frueeuqda frueeuaqd frueeuadq frueeudaq frueeudqa frueedqua frueedqau frueeduqa frueeduaq
frueedauq frueedaqu fruqdeaue fruqdeaeu fruqdeuae fruqdeuea fruqdeeua fruqdeeau fruqdaeue fruqdaeeu fruqdauee
fruqdauee fruqdaeue fruqdaeeu fruqduaee fruqduaee fruqdueae fruqdueea fruqdueea fruqdueae fruqdeaue fruqdeaeu
fruqdeuae fruqdeuea fruqdeeua fruqdeeau fruqedaue fruqedaeu fruqeduae fruqeduea fruqedeua fruqedeau fruqeadue
fruqeadeu fruqeaude fruqeaued fruqeaeud fruqeaedu fruqeuade fruqeuaed fruqeudae fruqeudea fruqeueda fruqeuead
fruqeeaud fruqeeadu fruqeeuad fruqeeuda fruqeedua fruqeedau fruqaedue fruqaedeu fruqaeude fruqaeued fruqaeeud
fruqaeedu fruqadeue fruqadeeu fruqaduee fruqaduee fruqadeue fruqadeeu fruqaudee fruqaudee fruqauede fruqaueed
fruqaueed fruqauede fruqaedue fruqaedeu fruqaeude fruqaeued fruqaeeud fruqaeedu fruqueade fruqueaed fruquedae
fruquedea fruqueeda fruqueead fruquaede fruquaeed fruquadee fruquadee fruquaede fruquaeed fruqudaee fruqudaee
fruqudeae fruqudeea fruqudeea fruqudeae fruqueade fruqueaed fruquedae fruquedea fruqueeda fruqueead fruqeeaud
fruqeeadu fruqeeuad fruqeeuda fruqeedua fruqeedau fruqeaeud fruqeaedu fruqeaued fruqeaude fruqeadue fruqeadeu
fruqeuaed fruqeuade fruqeuead fruqeueda fruqeudea fruqeudae fruqedaue fruqedaeu fruqeduae fruqeduea fruqedeua
fruqedeau fruudeqae fruudeqea fruudeaqe fruudeaeq fruudeeaq fruudeeqa fruudqeae fruudqeea fruudqaee fruudqaee
fruudqeae fruudqeea fruudaqee fruudaqee fruudaeqe fruudaeeq fruudaeeq fruudaeqe fruudeqae fruudeqea fruudeaqe
fruudeaeq fruudeeaq fruudeeqa fruuedqae fruuedqea fruuedaqe fruuedaeq fruuedeaq fruuedeqa fruueqdae fruueqdea
fruueqade fruueqaed fruueqead fruueqeda fruueaqde fruueaqed fruueadqe fruueadeq fruueaedq fruueaeqd fruueeqad
fruueeqda fruueeaqd fruueeadq fruueedaq fruueedqa fruuqedae fruuqedea fruuqeade fruuqeaed fruuqeead fruuqeeda
fruuqdeae fruuqdeea fruuqdaee fruuqdaee fruuqdeae fruuqdeea fruuqadee fruuqadee fruuqaede fruuqaeed fruuqaeed
fruuqaede fruuqedae fruuqedea fruuqeade fruuqeaed fruuqeead fruuqeeda fruuaeqde fruuaeqed fruuaedqe fruuaedeq
fruuaeedq fruuaeeqd fruuaqede fruuaqeed fruuaqdee fruuaqdee fruuaqede fruuaqeed fruuadqee fruuadqee fruuadeqe
fruuadeeq fruuadeeq fruuadeqe fruuaeqde fruuaeqed fruuaedqe fruuaedeq fruuaeedq fruuaeeqd fruueeqad fruueeqda
fruueeaqd fruueeadq fruueedaq fruueedqa fruueqead fruueqeda fruueqaed fruueqade fruueqdae fruueqdea fruueaqed
fruueaqde fruueaeqd fruueaedq fruueadeq fruueadqe fruuedqae fruuedqea fruuedaqe fruuedaeq fruuedeaq fruuedeqa
fruedequa fruedeqau fruedeuqa fruedeuaq fruedeauq fruedeaqu fruedqeua fruedqeau fruedquea fruedquae fruedqaue
fruedqaeu frueduqea frueduqae fruedueqa fruedueaq frueduaeq frueduaqe fruedaque fruedaqeu fruedauqe fruedaueq
fruedaeuq fruedaequ frueedqua frueedqau frueeduqa frueeduaq frueedauq frueedaqu frueeqdua frueeqdau frueequda
frueequad frueeqaud frueeqadu frueeuqda frueeuqad frueeudqa frueeudaq frueeuadq frueeuaqd frueeaqud frueeaqdu
frueeauqd frueeaudq frueeaduq frueeadqu frueqedua frueqedau frueqeuda frueqeuad frueqeaud frueqeadu frueqdeua
frueqdeau frueqduea frueqduae frueqdaue frueqdaeu fruequdea fruequdae fruequeda fruequead fruequaed fruequade
frueqadue frueqadeu frueqaude frueqaued frueqaeud frueqaedu frueueqda frueueqad frueuedqa frueuedaq frueueadq
frueueaqd frueuqeda frueuqead frueuqdea frueuqdae frueuqade frueuqaed frueudqea frueudqae frueudeqa frueudeaq
frueudaeq frueudaqe frueuaqde frueuaqed frueuadqe frueuadeq frueuaedq frueuaeqd frueaequd frueaeqdu frueaeuqd
frueaeudq frueaeduq frueaedqu frueaqeud frueaqedu frueaqued frueaqude frueaqdue frueaqdeu frueauqed frueauqde
frueaueqd frueauedq frueaudeq frueaudqe frueadque frueadqeu frueaduqe frueadueq frueadeuq frueadequ frduaeque
frduaeqeu frduaeuqe frduaeueq frduaeeuq frduaeequ frduaqeue frduaqeeu frduaquee frduaquee frduaqeue frduaqeeu
frduauqee frduauqee frduaueqe frduaueeq frduaueeq frduaueqe frduaeque frduaeqeu frduaeuqe frduaeueq frduaeeuq
frduaeequ frdueaque frdueaqeu frdueauqe frdueaueq frdueaeuq frdueaequ frdueqaue frdueqaeu frduequae frduequea
frdueqeua frdueqeau frdueuqae frdueuqea frdueuaqe frdueuaeq frdueueaq frdueueqa frdueequa frdueeqau frdueeuqa
frdueeuaq frdueeauq frdueeaqu frduqeaue frduqeaeu frduqeuae frduqeuea frduqeeua frduqeeau frduqaeue frduqaeeu
frduqauee frduqauee frduqaeue frduqaeeu frduquaee frduquaee frduqueae frduqueea frduqueea frduqueae frduqeaue
frduqeaeu frduqeuae frduqeuea frduqeeua frduqeeau frduueqae frduueqea frduueaqe frduueaeq frduueeaq frduueeqa
frduuqeae frduuqeea frduuqaee frduuqaee frduuqeae frduuqeea frduuaqee frduuaqee frduuaeqe frduuaeeq frduuaeeq
frduuaeqe frduueqae frduueqea frduueaqe frduueaeq frduueeaq frduueeqa frdueequa frdueeqau frdueeuqa frdueeuaq
frdueeauq frdueeaqu frdueqeua frdueqeau frduequea frduequae frdueqaue frdueqaeu frdueuqea frdueuqae frdueueqa
frdueueaq frdueuaeq frdueuaqe frdueaque frdueaqeu frdueauqe frdueaueq frdueaeuq frdueaequ frdaueque frdaueqeu
frdaueuqe frdaueueq frdaueeuq frdaueequ frdauqeue frdauqeeu frdauquee frdauquee frdauqeue frdauqeeu frdauuqee
frdauuqee frdauueqe frdauueeq frdauueeq frdauueqe frdaueque frdaueqeu frdaueuqe frdaueueq frdaueeuq frdaueequ
frdaeuque frdaeuqeu frdaeuuqe frdaeuueq frdaeueuq frdaeuequ frdaequue frdaequeu frdaequue frdaequeu frdaeqeuu
frdaeqeuu frdaeuque frdaeuqeu frdaeuuqe frdaeuueq frdaeueuq frdaeuequ frdaeequu frdaeequu frdaeeuqu frdaeeuuq
frdaeeuuq frdaeeuqu frdaqeuue frdaqeueu frdaqeuue frdaqeueu frdaqeeuu frdaqeeuu frdaqueue frdaqueeu frdaquuee
frdaquuee frdaqueue frdaqueeu frdaquuee frdaquuee frdaqueue frdaqueeu frdaqueeu frdaqueue frdaqeuue frdaqeueu
frdaqeuue frdaqeueu frdaqeeuu frdaqeeuu frdaueque frdaueqeu frdaueuqe frdaueueq frdaueeuq frdaueequ frdauqeue
frdauqeeu frdauquee frdauquee frdauqeue frdauqeeu frdauuqee frdauuqee frdauueqe frdauueeq frdauueeq frdauueqe
frdaueque frdaueqeu frdaueuqe frdaueueq frdaueeuq frdaueequ frdaeequu frdaeequu frdaeeuqu frdaeeuuq frdaeeuuq
frdaeeuqu frdaeqeuu frdaeqeuu frdaequeu frdaequue frdaequue frdaequeu frdaeuqeu frdaeuque frdaeuequ frdaeueuq
frdaeuueq frdaeuuqe frdaeuque frdaeuqeu frdaeuuqe frdaeuueq frdaeueuq frdaeuequ frdeauque frdeauqeu frdeauuqe
frdeauueq frdeaueuq frdeauequ frdeaquue frdeaqueu frdeaquue frdeaqueu frdeaqeuu frdeaqeuu frdeauque frdeauqeu
frdeauuqe frdeauueq frdeaueuq frdeauequ frdeaequu frdeaequu frdeaeuqu frdeaeuuq frdeaeuuq frdeaeuqu frdeuaque
frdeuaqeu frdeuauqe frdeuaueq frdeuaeuq frdeuaequ frdeuqaue frdeuqaeu frdeuquae frdeuquea frdeuqeua frdeuqeau
frdeuuqae frdeuuqea frdeuuaqe frdeuuaeq frdeuueaq frdeuueqa frdeuequa frdeueqau frdeueuqa frdeueuaq frdeueauq
frdeueaqu frdequaue frdequaeu frdequuae frdequuea frdequeua frdequeau frdeqauue frdeqaueu frdeqauue frdeqaueu
frdeqaeuu frdeqaeuu frdequaue frdequaeu frdequuae frdequuea frdequeua frdequeau frdeqeauu frdeqeauu frdeqeuau
frdeqeuua frdeqeuua frdeqeuau frdeuuqae frdeuuqea frdeuuaqe frdeuuaeq frdeuueaq frdeuueqa frdeuquae frdeuquea
frdeuqaue frdeuqaeu frdeuqeau frdeuqeua frdeuaque frdeuaqeu frdeuauqe frdeuaueq frdeuaeuq frdeuaequ frdeueqau
frdeuequa frdeueaqu frdeueauq frdeueuaq frdeueuqa frdeeuqua frdeeuqau frdeeuuqa frdeeuuaq frdeeuauq frdeeuaqu
frdeequua frdeequau frdeequua frdeequau frdeeqauu frdeeqauu frdeeuqua frdeeuqau frdeeuuqa frdeeuuaq frdeeuauq
frdeeuaqu frdeeaquu frdeeaquu frdeeauqu frdeeauuq frdeeauuq frdeeauqu frdqaeuue frdqaeueu frdqaeuue frdqaeueu
frdqaeeuu frdqaeeuu frdqaueue frdqaueeu frdqauuee frdqauuee frdqaueue frdqaueeu frdqauuee frdqauuee frdqaueue
frdqaueeu frdqaueeu frdqaueue frdqaeuue frdqaeueu frdqaeuue frdqaeueu frdqaeeuu frdqaeeuu frdqeauue frdqeaueu
frdqeauue frdqeaueu frdqeaeuu frdqeaeuu frdqeuaue frdqeuaeu frdqeuuae frdqeuuea frdqeueua frdqeueau frdqeuuae
frdqeuuea frdqeuaue frdqeuaeu frdqeueau frdqeueua frdqeeuua frdqeeuau frdqeeuua frdqeeuau frdqeeauu frdqeeauu
frdqueaue frdqueaeu frdqueuae frdqueuea frdqueeua frdqueeau frdquaeue frdquaeeu frdquauee frdquauee frdquaeue
frdquaeeu frdquuaee frdquuaee frdquueae frdquueea frdquueea frdquueae frdqueaue frdqueaeu frdqueuae frdqueuea
frdqueeua frdqueeau frdqueuae frdqueuea frdqueaue frdqueaeu frdqueeau frdqueeua frdquueae frdquueea frdquuaee
frdquuaee frdquueae frdquueea frdquauee frdquauee frdquaeue frdquaeeu frdquaeeu frdquaeue frdqueuae frdqueuea
frdqueaue frdqueaeu frdqueeau frdqueeua frdqeeuua frdqeeuau frdqeeuua frdqeeuau frdqeeauu frdqeeauu frdqeueua
frdqeueau frdqeuuea frdqeuuae frdqeuaue frdqeuaeu frdqeuuea frdqeuuae frdqeueua frdqeueau frdqeuaeu frdqeuaue
frdqeauue frdqeaueu frdqeauue frdqeaueu frdqeaeuu frdqeaeuu frduaeque frduaeqeu frduaeuqe frduaeueq frduaeeuq
frduaeequ frduaqeue frduaqeeu frduaquee frduaquee frduaqeue frduaqeeu frduauqee frduauqee frduaueqe frduaueeq
frduaueeq frduaueqe frduaeque frduaeqeu frduaeuqe frduaeueq frduaeeuq frduaeequ frdueaque frdueaqeu frdueauqe
frdueaueq frdueaeuq frdueaequ frdueqaue frdueqaeu frduequae frduequea frdueqeua frdueqeau frdueuqae frdueuqea
frdueuaqe frdueuaeq frdueueaq frdueueqa frdueequa frdueeqau frdueeuqa frdueeuaq frdueeauq frdueeaqu frduqeaue
frduqeaeu frduqeuae frduqeuea frduqeeua frduqeeau frduqaeue frduqaeeu frduqauee frduqauee frduqaeue frduqaeeu
frduquaee frduquaee frduqueae frduqueea frduqueea frduqueae frduqeaue frduqeaeu frduqeuae frduqeuea frduqeeua
frduqeeau frduueqae frduueqea frduueaqe frduueaeq frduueeaq frduueeqa frduuqeae frduuqeea frduuqaee frduuqaee
frduuqeae frduuqeea frduuaqee frduuaqee frduuaeqe frduuaeeq frduuaeeq frduuaeqe frduueqae frduueqea frduueaqe
frduueaeq frduueeaq frduueeqa frdueequa frdueeqau frdueeuqa frdueeuaq frdueeauq frdueeaqu frdueqeua frdueqeau
frduequea frduequae frdueqaue frdueqaeu frdueuqea frdueuqae frdueueqa frdueueaq frdueuaeq frdueuaqe frdueaque
frdueaqeu frdueauqe frdueaueq frdueaeuq frdueaequ frdeaequu frdeaequu frdeaeuqu frdeaeuuq frdeaeuuq frdeaeuqu
frdeaqeuu frdeaqeuu frdeaqueu frdeaquue frdeaquue frdeaqueu frdeauqeu frdeauque frdeauequ frdeaueuq frdeauueq
frdeauuqe frdeauque frdeauqeu frdeauuqe frdeauueq frdeaueuq frdeauequ frdeeaquu frdeeaquu frdeeauqu frdeeauuq
frdeeauuq frdeeauqu frdeeqauu frdeeqauu frdeequau frdeequua frdeequua frdeequau frdeeuqau frdeeuqua frdeeuaqu
frdeeuauq frdeeuuaq frdeeuuqa frdeeuqua frdeeuqau frdeeuuqa frdeeuuaq frdeeuauq frdeeuaqu frdeqeauu frdeqeauu
frdeqeuau frdeqeuua frdeqeuua frdeqeuau frdeqaeuu frdeqaeuu frdeqaueu frdeqauue frdeqauue frdeqaueu frdequaeu
frdequaue frdequeau frdequeua frdequuea frdequuae frdequaue frdequaeu frdequuae frdequuea frdequeua frdequeau
frdeueqau frdeuequa frdeueaqu frdeueauq frdeueuaq frdeueuqa frdeuqeau frdeuqeua frdeuqaeu frdeuqaue frdeuquae
frdeuquea frdeuaqeu frdeuaque frdeuaequ frdeuaeuq frdeuaueq frdeuauqe frdeuuqae frdeuuqea frdeuuaqe frdeuuaeq
frdeuueaq frdeuueqa frdeuequa frdeueqau frdeueuqa frdeueuaq frdeueauq frdeueaqu frdeuqeua frdeuqeau frdeuquea
frdeuquae frdeuqaue frdeuqaeu frdeuuqea frdeuuqae frdeuueqa frdeuueaq frdeuuaeq frdeuuaqe frdeuaque frdeuaqeu
frdeuauqe frdeuaueq frdeuaeuq frdeuaequ freudaque freudaqeu freudauqe freudaueq freudaeuq freudaequ freudqaue
freudqaeu freudquae freudquea freudqeua freudqeau freuduqae freuduqea freuduaqe freuduaeq freudueaq freudueqa
freudequa freudeqau freudeuqa freudeuaq freudeauq freudeaqu freuadque freuadqeu freuaduqe freuadueq freuadeuq
freuadequ freuaqdue freuaqdeu freuaqude freuaqued freuaqeud freuaqedu freuauqde freuauqed freuaudqe freuaudeq
freuauedq freuaueqd freuaequd freuaeqdu freuaeuqd freuaeudq freuaeduq freuaedqu freuqadue freuqadeu freuqaude
freuqaued freuqaeud freuqaedu freuqdaue freuqdaeu freuqduae freuqduea freuqdeua freuqdeau freuqudae freuqudea
freuquade freuquaed freuquead freuqueda freuqedua freuqedau freuqeuda freuqeuad freuqeaud freuqeadu freuuaqde
freuuaqed freuuadqe freuuadeq freuuaedq freuuaeqd freuuqade freuuqaed freuuqdae freuuqdea freuuqeda freuuqead
freuudqae freuudqea freuudaqe freuudaeq freuudeaq freuudeqa freuueqda freuueqad freuuedqa freuuedaq freuueadq
freuueaqd freueaqud freueaqdu freueauqd freueaudq freueaduq freueadqu freueqaud freueqadu freuequad freuequda
freueqdua freueqdau freueuqad freueuqda freueuaqd freueuadq freueudaq freueudqa freuedqua freuedqau freueduqa
freueduaq freuedauq freuedaqu freduaque freduaqeu freduauqe freduaueq freduaeuq freduaequ freduqaue freduqaeu
freduquae freduquea freduqeua freduqeau freduuqae freduuqea freduuaqe freduuaeq freduueaq freduueqa freduequa
fredueqau fredueuqa fredueuaq fredueauq fredueaqu fredauque fredauqeu fredauuqe fredauueq fredaueuq fredauequ
fredaquue fredaqueu fredaquue fredaqueu fredaqeuu fredaqeuu fredauque fredauqeu fredauuqe fredauueq fredaueuq
fredauequ fredaequu fredaequu fredaeuqu fredaeuuq fredaeuuq fredaeuqu fredqauue fredqaueu fredqauue fredqaueu
fredqaeuu fredqaeuu fredquaue fredquaeu fredquuae fredquuea fredqueua fredqueau fredquuae fredquuea fredquaue
fredquaeu fredqueau fredqueua fredqeuua fredqeuau fredqeuua fredqeuau fredqeauu fredqeauu freduaque freduaqeu
freduauqe freduaueq freduaeuq freduaequ freduqaue freduqaeu freduquae freduquea freduqeua freduqeau freduuqae
freduuqea freduuaqe freduuaeq freduueaq freduueqa freduequa fredueqau fredueuqa fredueuaq fredueauq fredueaqu
fredeaquu fredeaquu fredeauqu fredeauuq fredeauuq fredeauqu fredeqauu fredeqauu fredequau fredequua fredequua
fredequau fredeuqau fredeuqua fredeuaqu fredeuauq fredeuuaq fredeuuqa fredeuqua fredeuqau fredeuuqa fredeuuaq
fredeuauq fredeuaqu freaduque freaduqeu freaduuqe freaduueq freadueuq freaduequ freadquue freadqueu freadquue
freadqueu freadqeuu freadqeuu freaduque freaduqeu freaduuqe freaduueq freadueuq freaduequ freadequu freadequu
freadeuqu freadeuuq freadeuuq freadeuqu freaudque freaudqeu freauduqe freaudueq freaudeuq freaudequ freauqdue
freauqdeu freauqude freauqued freauqeud freauqedu freauuqde freauuqed freauudqe freauudeq freauuedq freauueqd
freauequd freaueqdu freaueuqd freaueudq freaueduq freauedqu freaqudue freaqudeu freaquude freaquued freaqueud
freaquedu freaqduue freaqdueu freaqduue freaqdueu freaqdeuu freaqdeuu freaqudue freaqudeu freaquude freaquued
freaqueud freaquedu freaqeduu freaqeduu freaqeudu freaqeuud freaqeuud freaqeudu freauuqde freauuqed freauudqe
freauudeq freauuedq freauueqd freauqude freauqued freauqdue freauqdeu freauqedu freauqeud freaudque freaudqeu
freauduqe freaudueq freaudeuq freaudequ freaueqdu freauequd freauedqu freaueduq freaueudq freaueuqd freaeuqud
freaeuqdu freaeuuqd freaeuudq freaeuduq freaeudqu freaequud freaequdu freaequud freaequdu freaeqduu freaeqduu
freaeuqud freaeuqdu freaeuuqd freaeuudq freaeuduq freaeudqu freaedquu freaedquu freaeduqu freaeduuq freaeduuq
freaeduqu freqdauue freqdaueu freqdauue freqdaueu freqdaeuu freqdaeuu freqduaue freqduaeu freqduuae freqduuea
freqdueua freqdueau freqduuae freqduuea freqduaue freqduaeu freqdueau freqdueua freqdeuua freqdeuau freqdeuua
freqdeuau freqdeauu freqdeauu freqaduue freqadueu freqaduue freqadueu freqadeuu freqadeuu freqaudue freqaudeu
freqauude freqauued freqaueud freqauedu freqauude freqauued freqaudue freqaudeu freqauedu freqaueud freqaeuud
freqaeudu freqaeuud freqaeudu freqaeduu freqaeduu frequadue frequadeu frequaude frequaued frequaeud frequaedu
frequdaue frequdaeu frequduae frequduea frequdeua frequdeau frequudae frequudea frequuade frequuaed frequuead
frequueda frequedua frequedau frequeuda frequeuad frequeaud frequeadu frequaude frequaued frequadue frequadeu
frequaedu frequaeud frequuade frequuaed frequudae frequudea frequueda frequuead frequduae frequduea frequdaue
frequdaeu frequdeau frequdeua frequeuda frequeuad frequedua frequedau frequeadu frequeaud freqeauud freqeaudu
freqeauud freqeaudu freqeaduu freqeaduu freqeuaud freqeuadu freqeuuad freqeuuda freqeudua freqeudau freqeuuad
freqeuuda freqeuaud freqeuadu freqeudau freqeudua freqeduua freqeduau freqeduua freqeduau freqedauu freqedauu
freudaque freudaqeu freudauqe freudaueq freudaeuq freudaequ freudqaue freudqaeu freudquae freudquea freudqeua
freudqeau freuduqae freuduqea freuduaqe freuduaeq freudueaq freudueqa freudequa freudeqau freudeuqa freudeuaq
freudeauq freudeaqu freuadque freuadqeu freuaduqe freuadueq freuadeuq freuadequ freuaqdue freuaqdeu freuaqude
freuaqued freuaqeud freuaqedu freuauqde freuauqed freuaudqe freuaudeq freuauedq freuaueqd freuaequd freuaeqdu
freuaeuqd freuaeudq freuaeduq freuaedqu freuqadue freuqadeu freuqaude freuqaued freuqaeud freuqaedu freuqdaue
freuqdaeu freuqduae freuqduea freuqdeua freuqdeau freuqudae freuqudea freuquade freuquaed freuquead freuqueda
freuqedua freuqedau freuqeuda freuqeuad freuqeaud freuqeadu freuuaqde freuuaqed freuuadqe freuuadeq freuuaedq
freuuaeqd freuuqade freuuqaed freuuqdae freuuqdea freuuqeda freuuqead freuudqae freuudqea freuudaqe freuudaeq
freuudeaq freuudeqa freuueqda freuueqad freuuedqa freuuedaq freuueadq freuueaqd freueaqud freueaqdu freueauqd
freueaudq freueaduq freueadqu freueqaud freueqadu freuequad freuequda freueqdua freueqdau freueuqad freueuqda
freueuaqd freueuadq freueudaq freueudqa freuedqua freuedqau freueduqa freueduaq freuedauq freuedaqu freedaquu
freedaquu freedauqu freedauuq freedauuq freedauqu freedqauu freedqauu freedquau freedquua freedquua freedquau
freeduqau freeduqua freeduaqu freeduauq freeduuaq freeduuqa freeduqua freeduqau freeduuqa freeduuaq freeduauq
freeduaqu freeadquu freeadquu freeaduqu freeaduuq freeaduuq freeaduqu freeaqduu freeaqduu freeaqudu freeaquud
freeaquud freeaqudu freeauqdu freeauqud freeaudqu freeauduq freeauudq freeauuqd freeauqud freeauqdu freeauuqd
freeauudq freeauduq freeaudqu freeqaduu freeqaduu freeqaudu freeqauud freeqauud freeqaudu freeqdauu freeqdauu
freeqduau freeqduua freeqduua freeqduau freequdau freequdua freequadu freequaud freequuad freequuda freequdua
freequdau freequuda freequuad freequaud freequadu freeuaqdu freeuaqud freeuadqu freeuaduq freeuaudq freeuauqd
freeuqadu freeuqaud freeuqdau freeuqdua freeuquda freeuquad freeudqau freeudqua freeudaqu freeudauq freeuduaq
freeuduqa freeuuqda freeuuqad freeuudqa freeuudaq freeuuadq freeuuaqd freeuaqud freeuaqdu freeuauqd freeuaudq
freeuaduq freeuadqu freeuqaud freeuqadu freeuquad freeuquda freeuqdua freeuqdau freeuuqad freeuuqda freeuuaqd
freeuuadq freeuudaq freeuudqa freeudqua freeudqau freeuduqa freeuduaq freeudauq freeudaqu frqudeaue frqudeaeu
frqudeuae frqudeuea frqudeeua frqudeeau frqudaeue frqudaeeu frqudauee frqudauee frqudaeue frqudaeeu frquduaee
frquduaee frqudueae frqudueea frqudueea frqudueae frqudeaue frqudeaeu frqudeuae frqudeuea frqudeeua frqudeeau
frquedaue frquedaeu frqueduae frqueduea frquedeua frquedeau frqueadue frqueadeu frqueaude frqueaued frqueaeud
frqueaedu frqueuade frqueuaed frqueudae frqueudea frqueueda frqueuead frqueeaud frqueeadu frqueeuad frqueeuda
frqueedua frqueedau frquaedue frquaedeu frquaeude frquaeued frquaeeud frquaeedu frquadeue frquadeeu frquaduee
frquaduee frquadeue frquadeeu frquaudee frquaudee frquauede frquaueed frquaueed frquauede frquaedue frquaedeu
frquaeude frquaeued frquaeeud frquaeedu frquueade frquueaed frquuedae frquuedea frquueeda frquueead frquuaede
frquuaeed frquuadee frquuadee frquuaede frquuaeed frquudaee frquudaee frquudeae frquudeea frquudeea frquudeae
frquueade frquueaed frquuedae frquuedea frquueeda frquueead frqueeaud frqueeadu frqueeuad frqueeuda frqueedua
frqueedau frqueaeud frqueaedu frqueaued frqueaude frqueadue frqueadeu frqueuaed frqueuade frqueuead frqueueda
frqueudea frqueudae frquedaue frquedaeu frqueduae frqueduea frquedeua frquedeau frqdueaue frqdueaeu frqdueuae
frqdueuea frqdueeua frqdueeau frqduaeue frqduaeeu frqduauee frqduauee frqduaeue frqduaeeu frqduuaee frqduuaee
frqduueae frqduueea frqduueea frqduueae frqdueaue frqdueaeu frqdueuae frqdueuea frqdueeua frqdueeau frqdeuaue
frqdeuaeu frqdeuuae frqdeuuea frqdeueua frqdeueau frqdeauue frqdeaueu frqdeauue frqdeaueu frqdeaeuu frqdeaeuu
frqdeuaue frqdeuaeu frqdeuuae frqdeuuea frqdeueua frqdeueau frqdeeauu frqdeeauu frqdeeuau frqdeeuua frqdeeuua
frqdeeuau frqdaeuue frqdaeueu frqdaeuue frqdaeueu frqdaeeuu frqdaeeuu frqdaueue frqdaueeu frqdauuee frqdauuee
frqdaueue frqdaueeu frqdauuee frqdauuee frqdaueue frqdaueeu frqdaueeu frqdaueue frqdaeuue frqdaeueu frqdaeuue
frqdaeueu frqdaeeuu frqdaeeuu frqdueaue frqdueaeu frqdueuae frqdueuea frqdueeua frqdueeau frqduaeue frqduaeeu
frqduauee frqduauee frqduaeue frqduaeeu frqduuaee frqduuaee frqduueae frqduueea frqduueea frqduueae frqdueaue
frqdueaeu frqdueuae frqdueuea frqdueeua frqdueeau frqdeeauu frqdeeauu frqdeeuau frqdeeuua frqdeeuua frqdeeuau
frqdeaeuu frqdeaeuu frqdeaueu frqdeauue frqdeauue frqdeaueu frqdeuaeu frqdeuaue frqdeueau frqdeueua frqdeuuea
frqdeuuae frqdeuaue frqdeuaeu frqdeuuae frqdeuuea frqdeueua frqdeueau frqeduaue frqeduaeu frqeduuae frqeduuea
frqedueua frqedueau frqedauue frqedaueu frqedauue frqedaueu frqedaeuu frqedaeuu frqeduaue frqeduaeu frqeduuae
frqeduuea frqedueua frqedueau frqedeauu frqedeauu frqedeuau frqedeuua frqedeuua frqedeuau frqeudaue frqeudaeu
frqeuduae frqeuduea frqeudeua frqeudeau frqeuadue frqeuadeu frqeuaude frqeuaued frqeuaeud frqeuaedu frqeuuade
frqeuuaed frqeuudae frqeuudea frqeuueda frqeuuead frqeueaud frqeueadu frqeueuad frqeueuda frqeuedua frqeuedau
frqeaudue frqeaudeu frqeauude frqeauued frqeaueud frqeauedu frqeaduue frqeadueu frqeaduue frqeadueu frqeadeuu
frqeadeuu frqeaudue frqeaudeu frqeauude frqeauued frqeaueud frqeauedu frqeaeduu frqeaeduu frqeaeudu frqeaeuud
frqeaeuud frqeaeudu frqeuuade frqeuuaed frqeuudae frqeuudea frqeuueda frqeuuead frqeuaude frqeuaued frqeuadue
frqeuadeu frqeuaedu frqeuaeud frqeudaue frqeudaeu frqeuduae frqeuduea frqeudeua frqeudeau frqeueadu frqeueaud
frqeuedau frqeuedua frqeueuda frqeueuad frqeeuaud frqeeuadu frqeeuuad frqeeuuda frqeeudua frqeeudau frqeeauud
frqeeaudu frqeeauud frqeeaudu frqeeaduu frqeeaduu frqeeuaud frqeeuadu frqeeuuad frqeeuuda frqeeudua frqeeudau
frqeedauu frqeedauu frqeeduau frqeeduua frqeeduua frqeeduau frqadeuue frqadeueu frqadeuue frqadeueu frqadeeuu
frqadeeuu frqadueue frqadueeu frqaduuee frqaduuee frqadueue frqadueeu frqaduuee frqaduuee frqadueue frqadueeu
frqadueeu frqadueue frqadeuue frqadeueu frqadeuue frqadeueu frqadeeuu frqadeeuu frqaeduue frqaedueu frqaeduue
frqaedueu frqaedeuu frqaedeuu frqaeudue frqaeudeu frqaeuude frqaeuued frqaeueud frqaeuedu frqaeuude frqaeuued
frqaeudue frqaeudeu frqaeuedu frqaeueud frqaeeuud frqaeeudu frqaeeuud frqaeeudu frqaeeduu frqaeeduu frqauedue
frqauedeu frqaueude frqaueued frqaueeud frqaueedu frqaudeue frqaudeeu frqauduee frqauduee frqaudeue frqaudeeu
frqauudee frqauudee frqauuede frqauueed frqauueed frqauuede frqauedue frqauedeu frqaueude frqaueued frqaueeud
frqaueedu frqaueude frqaueued frqauedue frqauedeu frqaueedu frqaueeud frqauuede frqauueed frqauudee frqauudee
frqauuede frqauueed frqauduee frqauduee frqaudeue frqaudeeu frqaudeeu frqaudeue frqaueude frqaueued frqauedue
frqauedeu frqaueedu frqaueeud frqaeeuud frqaeeudu frqaeeuud frqaeeudu frqaeeduu frqaeeduu frqaeueud frqaeuedu
frqaeuued frqaeuude frqaeudue frqaeudeu frqaeuued frqaeuude frqaeueud frqaeuedu frqaeudeu frqaeudue frqaeduue
frqaedueu frqaeduue frqaedueu frqaedeuu frqaedeuu frqudeaue frqudeaeu frqudeuae frqudeuea frqudeeua frqudeeau
frqudaeue frqudaeeu frqudauee frqudauee frqudaeue frqudaeeu frquduaee frquduaee frqudueae frqudueea frqudueea
frqudueae frqudeaue frqudeaeu frqudeuae frqudeuea frqudeeua frqudeeau frquedaue frquedaeu frqueduae frqueduea
frquedeua frquedeau frqueadue frqueadeu frqueaude frqueaued frqueaeud frqueaedu frqueuade frqueuaed frqueudae
frqueudea frqueueda frqueuead frqueeaud frqueeadu frqueeuad frqueeuda frqueedua frqueedau frquaedue frquaedeu
frquaeude frquaeued frquaeeud frquaeedu frquadeue frquadeeu frquaduee frquaduee frquadeue frquadeeu frquaudee
frquaudee frquauede frquaueed frquaueed frquauede frquaedue frquaedeu frquaeude frquaeued frquaeeud frquaeedu
frquueade frquueaed frquuedae frquuedea frquueeda frquueead frquuaede frquuaeed frquuadee frquuadee frquuaede
frquuaeed frquudaee frquudaee frquudeae frquudeea frquudeea frquudeae frquueade frquueaed frquuedae frquuedea
frquueeda frquueead frqueeaud frqueeadu frqueeuad frqueeuda frqueedua frqueedau frqueaeud frqueaedu frqueaued
frqueaude frqueadue frqueadeu frqueuaed frqueuade frqueuead frqueueda frqueudea frqueudae frquedaue frquedaeu
frqueduae frqueduea frquedeua frquedeau frqedeauu frqedeauu frqedeuau frqedeuua frqedeuua frqedeuau frqedaeuu
frqedaeuu frqedaueu frqedauue frqedauue frqedaueu frqeduaeu frqeduaue frqedueau frqedueua frqeduuea frqeduuae
frqeduaue frqeduaeu frqeduuae frqeduuea frqedueua frqedueau frqeedauu frqeedauu frqeeduau frqeeduua frqeeduua
frqeeduau frqeeaduu frqeeaduu frqeeaudu frqeeauud frqeeauud frqeeaudu frqeeuadu frqeeuaud frqeeudau frqeeudua
frqeeuuda frqeeuuad frqeeuaud frqeeuadu frqeeuuad frqeeuuda frqeeudua frqeeudau frqeaeduu frqeaeduu frqeaeudu
frqeaeuud frqeaeuud frqeaeudu frqeadeuu frqeadeuu frqeadueu frqeaduue frqeaduue frqeadueu frqeaudeu frqeaudue
frqeauedu frqeaueud frqeauued frqeauude frqeaudue frqeaudeu frqeauude frqeauued frqeaueud frqeauedu frqeueadu
frqeueaud frqeuedau frqeuedua frqeueuda frqeueuad frqeuaedu frqeuaeud frqeuadeu frqeuadue frqeuaude frqeuaued
frqeudaeu frqeudaue frqeudeau frqeudeua frqeuduea frqeuduae frqeuuade frqeuuaed frqeuudae frqeuudea frqeuueda
frqeuuead frqeueaud frqeueadu frqeueuad frqeueuda frqeuedua frqeuedau frqeuaeud frqeuaedu frqeuaued frqeuaude
frqeuadue frqeuadeu frqeuuaed frqeuuade frqeuuead frqeuueda frqeuudea frqeuudae frqeudaue frqeudaeu frqeuduae
frqeuduea frqeudeua frqeudeau fruudeqae fruudeqea fruudeaqe fruudeaeq fruudeeaq fruudeeqa fruudqeae fruudqeea
fruudqaee fruudqaee fruudqeae fruudqeea fruudaqee fruudaqee fruudaeqe fruudaeeq fruudaeeq fruudaeqe fruudeqae
fruudeqea fruudeaqe fruudeaeq fruudeeaq fruudeeqa fruuedqae fruuedqea fruuedaqe fruuedaeq fruuedeaq fruuedeqa
fruueqdae fruueqdea fruueqade fruueqaed fruueqead fruueqeda fruueaqde fruueaqed fruueadqe fruueadeq fruueaedq
fruueaeqd fruueeqad fruueeqda fruueeaqd fruueeadq fruueedaq fruueedqa fruuqedae fruuqedea fruuqeade fruuqeaed
fruuqeead fruuqeeda fruuqdeae fruuqdeea fruuqdaee fruuqdaee fruuqdeae fruuqdeea fruuqadee fruuqadee fruuqaede
fruuqaeed fruuqaeed fruuqaede fruuqedae fruuqedea fruuqeade fruuqeaed fruuqeead fruuqeeda fruuaeqde fruuaeqed
fruuaedqe fruuaedeq fruuaeedq fruuaeeqd fruuaqede fruuaqeed fruuaqdee fruuaqdee fruuaqede fruuaqeed fruuadqee
fruuadqee fruuadeqe fruuadeeq fruuadeeq fruuadeqe fruuaeqde fruuaeqed fruuaedqe fruuaedeq fruuaeedq fruuaeeqd
fruueeqad fruueeqda fruueeaqd fruueeadq fruueedaq fruueedqa fruueqead fruueqeda fruueqaed fruueqade fruueqdae
fruueqdea fruueaqed fruueaqde fruueaeqd fruueaedq fruueadeq fruueadqe fruuedqae fruuedqea fruuedaqe fruuedaeq
fruuedeaq fruuedeqa frudueqae frudueqea frudueaqe frudueaeq frudueeaq frudueeqa fruduqeae fruduqeea fruduqaee
fruduqaee fruduqeae fruduqeea fruduaqee fruduaqee fruduaeqe fruduaeeq fruduaeeq fruduaeqe frudueqae frudueqea
frudueaqe frudueaeq frudueeaq frudueeqa frudeuqae frudeuqea frudeuaqe frudeuaeq frudeueaq frudeueqa frudequae
frudequea frudeqaue frudeqaeu frudeqeau frudeqeua frudeaque frudeaqeu frudeauqe frudeaueq frudeaeuq frudeaequ
frudeeqau frudeequa frudeeaqu frudeeauq frudeeuaq frudeeuqa frudqeuae frudqeuea frudqeaue frudqeaeu frudqeeau
frudqeeua frudqueae frudqueea frudquaee frudquaee frudqueae frudqueea frudqauee frudqauee frudqaeue frudqaeeu
frudqaeeu frudqaeue frudqeuae frudqeuea frudqeaue frudqeaeu frudqeeau frudqeeua frudaeque frudaeqeu frudaeuqe
frudaeueq frudaeeuq frudaeequ frudaqeue frudaqeeu frudaquee frudaquee frudaqeue frudaqeeu frudauqee frudauqee
frudaueqe frudaueeq frudaueeq frudaueqe frudaeque frudaeqeu frudaeuqe frudaeueq frudaeeuq frudaeequ frudeeqau
frudeequa frudeeaqu frudeeauq frudeeuaq frudeeuqa frudeqeau frudeqeua frudeqaeu frudeqaue frudequae frudequea
frudeaqeu frudeaque frudeaequ frudeaeuq frudeaueq frudeauqe frudeuqae frudeuqea frudeuaqe frudeuaeq frudeueaq
frudeueqa frueduqae frueduqea frueduaqe frueduaeq fruedueaq fruedueqa fruedquae fruedquea fruedqaue fruedqaeu
fruedqeau fruedqeua fruedaque fruedaqeu fruedauqe fruedaueq fruedaeuq fruedaequ fruedeqau fruedequa fruedeaqu
fruedeauq fruedeuaq fruedeuqa frueudqae frueudqea frueudaqe frueudaeq frueudeaq frueudeqa frueuqdae frueuqdea
frueuqade frueuqaed frueuqead frueuqeda frueuaqde frueuaqed frueuadqe frueuadeq frueuaedq frueuaeqd frueueqad
frueueqda frueueaqd frueueadq frueuedaq frueuedqa fruequdae fruequdea fruequade fruequaed fruequead fruequeda
frueqduae frueqduea frueqdaue frueqdaeu frueqdeau frueqdeua frueqadue frueqadeu frueqaude frueqaued frueqaeud
frueqaedu frueqedau frueqedua frueqeadu frueqeaud frueqeuad frueqeuda frueauqde frueauqed frueaudqe frueaudeq
frueauedq frueaueqd frueaqude frueaqued frueaqdue frueaqdeu frueaqedu frueaqeud frueadque frueadqeu frueaduqe
frueadueq frueadeuq frueadequ frueaeqdu frueaequd frueaedqu frueaeduq frueaeudq frueaeuqd frueeuqad frueeuqda
frueeuaqd frueeuadq frueeudaq frueeudqa frueequad frueequda frueeqaud frueeqadu frueeqdau frueeqdua frueeaqud
frueeaqdu frueeauqd frueeaudq frueeaduq frueeadqu frueedqau frueedqua frueedaqu frueedauq frueeduaq frueeduqa
fruqdeuae fruqdeuea fruqdeaue fruqdeaeu fruqdeeau fruqdeeua fruqdueae fruqdueea fruqduaee fruqduaee fruqdueae
fruqdueea fruqdauee fruqdauee fruqdaeue fruqdaeeu fruqdaeeu fruqdaeue fruqdeuae fruqdeuea fruqdeaue fruqdeaeu
fruqdeeau fruqdeeua fruqeduae fruqeduea fruqedaue fruqedaeu fruqedeau fruqedeua fruqeudae fruqeudea fruqeuade
fruqeuaed fruqeuead fruqeueda fruqeaude fruqeaued fruqeadue fruqeadeu fruqeaedu fruqeaeud fruqeeuad fruqeeuda
fruqeeaud fruqeeadu fruqeedau fruqeedua fruquedae fruquedea fruqueade fruqueaed fruqueead fruqueeda fruqudeae
fruqudeea fruqudaee fruqudaee fruqudeae fruqudeea fruquadee fruquadee fruquaede fruquaeed fruquaeed fruquaede
fruquedae fruquedea fruqueade fruqueaed fruqueead fruqueeda fruqaeude fruqaeued fruqaedue fruqaedeu fruqaeedu
fruqaeeud fruqauede fruqaueed fruqaudee fruqaudee fruqauede fruqaueed fruqaduee fruqaduee fruqadeue fruqadeeu
fruqadeeu fruqadeue fruqaeude fruqaeued fruqaedue fruqaedeu fruqaeedu fruqaeeud fruqeeuad fruqeeuda fruqeeaud
fruqeeadu fruqeedau fruqeedua fruqeuead fruqeueda fruqeuaed fruqeuade fruqeudae fruqeudea fruqeaued fruqeaude
fruqeaeud fruqeaedu fruqeadeu fruqeadue fruqeduae fruqeduea fruqedaue fruqedaeu fruqedeau fruqedeua fruadeque
fruadeqeu fruadeuqe fruadeueq fruadeeuq fruadeequ fruadqeue fruadqeeu fruadquee fruadquee fruadqeue fruadqeeu
fruaduqee fruaduqee fruadueqe fruadueeq fruadueeq fruadueqe fruadeque fruadeqeu fruadeuqe fruadeueq fruadeeuq
fruadeequ fruaedque fruaedqeu fruaeduqe fruaedueq fruaedeuq fruaedequ fruaeqdue fruaeqdeu fruaequde fruaequed
fruaeqeud fruaeqedu fruaeuqde fruaeuqed fruaeudqe fruaeudeq fruaeuedq fruaeueqd fruaeequd fruaeeqdu fruaeeuqd
fruaeeudq fruaeeduq fruaeedqu fruaqedue fruaqedeu fruaqeude fruaqeued fruaqeeud fruaqeedu fruaqdeue fruaqdeeu
fruaqduee fruaqduee fruaqdeue fruaqdeeu fruaqudee fruaqudee fruaquede fruaqueed fruaqueed fruaquede fruaqedue
fruaqedeu fruaqeude fruaqeued fruaqeeud fruaqeedu fruaueqde fruaueqed fruauedqe fruauedeq fruaueedq fruaueeqd
fruauqede fruauqeed fruauqdee fruauqdee fruauqede fruauqeed fruaudqee fruaudqee fruaudeqe fruaudeeq fruaudeeq
fruaudeqe fruaueqde fruaueqed fruauedqe fruauedeq fruaueedq fruaueeqd fruaeequd fruaeeqdu fruaeeuqd fruaeeudq
fruaeeduq fruaeedqu fruaeqeud fruaeqedu fruaequed fruaequde fruaeqdue fruaeqdeu fruaeuqed fruaeuqde fruaeueqd
fruaeuedq fruaeudeq fruaeudqe fruaedque fruaedqeu fruaeduqe fruaedueq fruaedeuq fruaedequ fruedeqau fruedequa
fruedeaqu fruedeauq fruedeuaq fruedeuqa fruedqeau fruedqeua fruedqaeu fruedqaue fruedquae fruedquea fruedaqeu
fruedaque fruedaequ fruedaeuq fruedaueq fruedauqe frueduqae frueduqea frueduaqe frueduaeq fruedueaq fruedueqa
frueedqau frueedqua frueedaqu frueedauq frueeduaq frueeduqa frueeqdau frueeqdua frueeqadu frueeqaud frueequad
frueequda frueeaqdu frueeaqud frueeadqu frueeaduq frueeaudq frueeauqd frueeuqad frueeuqda frueeuaqd frueeuadq
frueeudaq frueeudqa frueqedau frueqedua frueqeadu frueqeaud frueqeuad frueqeuda frueqdeau frueqdeua frueqdaeu
frueqdaue frueqduae frueqduea frueqadeu frueqadue frueqaedu frueqaeud frueqaued frueqaude fruequdae fruequdea
fruequade fruequaed fruequead fruequeda frueaeqdu frueaequd frueaedqu frueaeduq frueaeudq frueaeuqd frueaqedu
frueaqeud frueaqdeu frueaqdue frueaqude frueaqued frueadqeu frueadque frueadequ frueadeuq frueadueq frueaduqe
frueauqde frueauqed frueaudqe frueaudeq frueauedq frueaueqd frueueqad frueueqda frueueaqd frueueadq frueuedaq
frueuedqa frueuqead frueuqeda frueuqaed frueuqade frueuqdae frueuqdea frueuaqed frueuaqde frueuaeqd frueuaedq
frueuadeq frueuadqe frueudqae frueudqea frueudaqe frueudaeq frueudeaq frueudeqa freudequa freudeqau freudeuqa
freudeuaq freudeauq freudeaqu freudqeua freudqeau freudquea freudquae freudqaue freudqaeu freuduqea freuduqae
freudueqa freudueaq freuduaeq freuduaqe freudaque freudaqeu freudauqe freudaueq freudaeuq freudaequ freuedqua
freuedqau freueduqa freueduaq freuedauq freuedaqu freueqdua freueqdau freuequda freuequad freueqaud freueqadu
freueuqda freueuqad freueudqa freueudaq freueuadq freueuaqd freueaqud freueaqdu freueauqd freueaudq freueaduq
freueadqu freuqedua freuqedau freuqeuda freuqeuad freuqeaud freuqeadu freuqdeua freuqdeau freuqduea freuqduae
freuqdaue freuqdaeu freuqudea freuqudae freuqueda freuquead freuquaed freuquade freuqadue freuqadeu freuqaude
freuqaued freuqaeud freuqaedu freuueqda freuueqad freuuedqa freuuedaq freuueadq freuueaqd freuuqeda freuuqead
freuuqdea freuuqdae freuuqade freuuqaed freuudqea freuudqae freuudeqa freuudeaq freuudaeq freuudaqe freuuaqde
freuuaqed freuuadqe freuuadeq freuuaedq freuuaeqd freuaequd freuaeqdu freuaeuqd freuaeudq freuaeduq freuaedqu
freuaqeud freuaqedu freuaqued freuaqude freuaqdue freuaqdeu freuauqed freuauqde freuaueqd freuauedq freuaudeq
freuaudqe freuadque freuadqeu freuaduqe freuadueq freuadeuq freuadequ freduequa fredueqau fredueuqa fredueuaq
fredueauq fredueaqu freduqeua freduqeau freduquea freduquae freduqaue freduqaeu freduuqea freduuqae freduueqa
freduueaq freduuaeq freduuaqe freduaque freduaqeu freduauqe freduaueq freduaeuq freduaequ fredeuqua fredeuqau
fredeuuqa fredeuuaq fredeuauq fredeuaqu fredequua fredequau fredequua fredequau fredeqauu fredeqauu fredeuqua
fredeuqau fredeuuqa fredeuuaq fredeuauq fredeuaqu fredeaquu fredeaquu fredeauqu fredeauuq fredeauuq fredeauqu
fredqeuua fredqeuau fredqeuua fredqeuau fredqeauu fredqeauu fredqueua fredqueau fredquuea fredquuae fredquaue
fredquaeu fredquuea fredquuae fredqueua fredqueau fredquaeu fredquaue fredqauue fredqaueu fredqauue fredqaueu
fredqaeuu fredqaeuu freduequa fredueqau fredueuqa fredueuaq fredueauq fredueaqu freduqeua freduqeau freduquea
freduquae freduqaue freduqaeu freduuqea freduuqae freduueqa freduueaq freduuaeq freduuaqe freduaque freduaqeu
freduauqe freduaueq freduaeuq freduaequ fredaequu fredaequu fredaeuqu fredaeuuq fredaeuuq fredaeuqu fredaqeuu
fredaqeuu fredaqueu fredaquue fredaquue fredaqueu fredauqeu fredauque fredauequ fredaueuq fredauueq fredauuqe
fredauque fredauqeu fredauuqe fredauueq fredaueuq fredauequ freeduqua freeduqau freeduuqa freeduuaq freeduauq
freeduaqu freedquua freedquau freedquua freedquau freedqauu freedqauu freeduqua freeduqau freeduuqa freeduuaq
freeduauq freeduaqu freedaquu freedaquu freedauqu freedauuq freedauuq freedauqu freeudqua freeudqau freeuduqa
freeuduaq freeudauq freeudaqu freeuqdua freeuqdau freeuquda freeuquad freeuqaud freeuqadu freeuuqda freeuuqad
freeuudqa freeuudaq freeuuadq freeuuaqd freeuaqud freeuaqdu freeuauqd freeuaudq freeuaduq freeuadqu freequdua
freequdau freequuda freequuad freequaud freequadu freeqduua freeqduau freeqduua freeqduau freeqdauu freeqdauu
freequdua freequdau freequuda freequuad freequaud freequadu freeqaduu freeqaduu freeqaudu freeqauud freeqauud
freeqaudu freeuuqda freeuuqad freeuudqa freeuudaq freeuuadq freeuuaqd freeuquda freeuquad freeuqdua freeuqdau
freeuqadu freeuqaud freeudqua freeudqau freeuduqa freeuduaq freeudauq freeudaqu freeuaqdu freeuaqud freeuadqu
freeuaduq freeuaudq freeuauqd freeauqud freeauqdu freeauuqd freeauudq freeauduq freeaudqu freeaquud freeaqudu
freeaquud freeaqudu freeaqduu freeaqduu freeauqud freeauqdu freeauuqd freeauudq freeauduq freeaudqu freeadquu
freeadquu freeaduqu freeaduuq freeaduuq freeaduqu freqdeuua freqdeuau freqdeuua freqdeuau freqdeauu freqdeauu
freqdueua freqdueau freqduuea freqduuae freqduaue freqduaeu freqduuea freqduuae freqdueua freqdueau freqduaeu
freqduaue freqdauue freqdaueu freqdauue freqdaueu freqdaeuu freqdaeuu freqeduua freqeduau freqeduua freqeduau
freqedauu freqedauu freqeudua freqeudau freqeuuda freqeuuad freqeuaud freqeuadu freqeuuda freqeuuad freqeudua
freqeudau freqeuadu freqeuaud freqeauud freqeaudu freqeauud freqeaudu freqeaduu freqeaduu frequedua frequedau
frequeuda frequeuad frequeaud frequeadu frequdeua frequdeau frequduea frequduae frequdaue frequdaeu frequudea
frequudae frequueda frequuead frequuaed frequuade frequadue frequadeu frequaude frequaued frequaeud frequaedu
frequeuda frequeuad frequedua frequedau frequeadu frequeaud frequueda frequuead frequudea frequudae frequuade
frequuaed frequduea frequduae frequdeua frequdeau frequdaeu frequdaue frequaude frequaued frequadue frequadeu
frequaedu frequaeud freqaeuud freqaeudu freqaeuud freqaeudu freqaeduu freqaeduu freqaueud freqauedu freqauued
freqauude freqaudue freqaudeu freqauued freqauude freqaueud freqauedu freqaudeu freqaudue freqaduue freqadueu
freqaduue freqadueu freqadeuu freqadeuu freudequa freudeqau freudeuqa freudeuaq freudeauq freudeaqu freudqeua
freudqeau freudquea freudquae freudqaue freudqaeu freuduqea freuduqae freudueqa freudueaq freuduaeq freuduaqe
freudaque freudaqeu freudauqe freudaueq freudaeuq freudaequ freuedqua freuedqau freueduqa freueduaq freuedauq
freuedaqu freueqdua freueqdau freuequda freuequad freueqaud freueqadu freueuqda freueuqad freueudqa freueudaq
freueuadq freueuaqd freueaqud freueaqdu freueauqd freueaudq freueaduq freueadqu freuqedua freuqedau freuqeuda
freuqeuad freuqeaud freuqeadu freuqdeua freuqdeau freuqduea freuqduae freuqdaue freuqdaeu freuqudea freuqudae
freuqueda freuquead freuquaed freuquade freuqadue freuqadeu freuqaude freuqaued freuqaeud freuqaedu freuueqda
freuueqad freuuedqa freuuedaq freuueadq freuueaqd freuuqeda freuuqead freuuqdea freuuqdae freuuqade freuuqaed
freuudqea freuudqae freuudeqa freuudeaq freuudaeq freuudaqe freuuaqde freuuaqed freuuadqe freuuadeq freuuaedq
freuuaeqd freuaequd freuaeqdu freuaeuqd freuaeudq freuaeduq freuaedqu freuaqeud freuaqedu freuaqued freuaqude
freuaqdue freuaqdeu freuauqed freuauqde freuaueqd freuauedq freuaudeq freuaudqe freuadque freuadqeu freuaduqe
freuadueq freuadeuq freuadequ freadequu freadequu freadeuqu freadeuuq freadeuuq freadeuqu freadqeuu freadqeuu
freadqueu freadquue freadquue freadqueu freaduqeu freaduque freaduequ freadueuq freaduueq freaduuqe freaduque
freaduqeu freaduuqe freaduueq freadueuq freaduequ freaedquu freaedquu freaeduqu freaeduuq freaeduuq freaeduqu
freaeqduu freaeqduu freaequdu freaequud freaequud freaequdu freaeuqdu freaeuqud freaeudqu freaeuduq freaeuudq
freaeuuqd freaeuqud freaeuqdu freaeuuqd freaeuudq freaeuduq freaeudqu freaqeduu freaqeduu freaqeudu freaqeuud
freaqeuud freaqeudu freaqdeuu freaqdeuu freaqdueu freaqduue freaqduue freaqdueu freaqudeu freaqudue freaquedu
freaqueud freaquued freaquude freaqudue freaqudeu freaquude freaquued freaqueud freaquedu freaueqdu freauequd
freauedqu freaueduq freaueudq freaueuqd freauqedu freauqeud freauqdeu freauqdue freauqude freauqued freaudqeu
freaudque freaudequ freaudeuq freaudueq freauduqe freauuqde freauuqed freauudqe freauudeq freauuedq freauueqd
freauequd freaueqdu freaueuqd freaueudq freaueduq freauedqu freauqeud freauqedu freauqued freauqude freauqdue
freauqdeu freauuqed freauuqde freauueqd freauuedq freauudeq freauudqe freaudque freaudqeu freauduqe freaudueq
freaudeuq freaudequ

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us