easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

bhungini

infeftment

missum

linguality

dubuisson

reinstator

rkubala

psyosonik

decarnated

discept

esperanto

cardinalate

sagittamque

steeply

extractorship

quiebam

auscultascope

discing


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: forabamque
cipher variations:
gpsbcbnrvf hqtcdcoswg irudedptxh jsvefequyi ktwfgfrvzj
luxghgswak mvyhihtxbl nwzijiuycm oxajkjvzdn pybklkwaeo
qzclmlxbfp radmnmycgq sbenonzdhr tcfopoaeis udgpqpbfjt
vehqrqcgku wfirsrdhlv xgjstseimw yhktutfjnx ziluvugkoy
ajmvwvhlpz bknwxwimqa cloxyxjnrb dmpyzykosc enqzazlptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: forabamque
Cipher: ulizyznjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: forabamque
Cipher: AABAB ABBAB BAAAA AAAAA AAAAB AAAAA ABABB ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: forabamque
cipher variations:
gpsbcbnrvfqrabeblxjnatibgbjdxvkvqbibhjlduxybkbfpzlezgbmbdvntydwbqbzhpjifebsbxndr
shmbubvtrzcjubwbtzfhmlcbybrftpwnkbabplhxhqtcdcoswgrsbcfcmykobujchckeywlwrcjcikme
vyzclcgqamfahcncewouzexcrcaiqkjgfctcyoestincvcwusadkvcxcuaginmdczcsguqxolcbcqmiy
irudedptxhstcdgdnzlpcvkdidlfzxmxsdkdjlnfwzadmdhrbngbidodfxpvafydsdbjrlkhgdudzpft
ujodwdxvtbelwdydvbhjonedadthvrypmdcdrnjzjsvefequyitudeheoamqdwlejemgaynytelekmog
xabeneiscohcjepegyqwbgzetecksmliheveaqguvkpexeywucfmxezewcikpofebeuiwszqnedesoka
ktwfgfrvzjuvefifpbnrexmfkfnhbzozufmflnphybcfofjtdpidkfqfhzrxchafufdltnmjifwfbrhv
wlqfyfzxvdgnyfafxdjlqpgfcfvjxtarofeftplbluxghgswakvwfgjgqcosfynglgoicapavgngmoqi
zcdgpgkueqjelgrgiasydibgvgemuonkjgxgcsiwxmrgzgaywehozgbgyekmrqhgdgwkyubspgfguqmc
mvyhihtxblwxghkhrdptgzohmhpjdbqbwhohnprjadehqhlvfrkfmhshjbtzejchwhfnvpolkhyhdtjx
ynshahbzxfipahchzflnsrihehxlzvctqhghvrndnwzijiuycmxyhilisequhapiniqkecrcxipioqsk
befirimwgslgnitikcuafkdixigowqpmlizieukyzotibicaygjqbidiagmotsjifiymawdurihiwsoe
oxajkjvzdnyzijmjtfrvibqjojrlfdsdyjqjprtlcfgjsjnxhtmhojujldvbglejyjhpxrqnmjajfvlz
apujcjdbzhkrcjejbhnputkjgjznbxevsjijxtpfpybklkwaeozajknkugswjcrkpksmgetezkrkqsum
dghktkoyiunipkvkmewchmfkzkiqysronkbkgwmabqvkdkecailsdkfkcioqvulkhkaocyfwtkjkyuqg
qzclmlxbfpabklolvhtxkdslqltnhfufalslrtvnehilulpzjvojqlwlnfxdinglaljrztspolclhxnb
crwlelfdbjmtelgldjprwvmlilbpdzgxulklzvrhradmnmycgqbclmpmwiuyletmrmuoigvgbmtmsuwo
fijmvmqakwpkrmxmogyejohmbmksautqpmdmiyocdsxmfmgecknufmhmekqsxwnmjmcqeahyvmlmawsi
sbenonzdhrcdmnqnxjvzmfunsnvpjhwhcnuntvxpgjknwnrblxqlsnynphzfkpincnltbvurqnenjzpd
etyngnhfdlovgninflrtyxonkndrfbizwnmnbxtjtcfopoaeisdenoroykwangvotowqkixidovouwyq
hkloxoscmyrmtozoqiaglqjodomucwvsrofokaqefuzohoigempwhojogmsuzypoloesgcjaxonocyuk
udgpqpbfjtefopspzlxbohwpupxrljyjepwpvxzrilmpyptdnzsnupaprjbhmrkpepnvdxwtspgplbrf
gvapipjhfnqxipkphntvazqpmpfthdkbypopdzvlvehqrqcgkufgpqtqamycpixqvqysmkzkfqxqwyas
jmnqzqueoatovqbqskcinslqfqoweyxutqhqmcsghwbqjqkigoryjqlqiouwbarqnqguielczqpqeawm
wfirsrdhlvghqrurbnzdqjyrwrztnlalgryrxzbtknorarvfpbupwrcrtldjotmrgrpxfzyvurirndth
ixcrkrljhpszkrmrjpvxcbsrorhvjfmdarqrfbxnxgjstseimwhirsvscoaerkzsxsauombmhszsyacu
lopsbswgqcvqxsdsumekpunshsqygazwvsjsoeuijydslsmkiqtalsnskqwydctspsiwkgnebsrsgcyo
yhktutfjnxijstwtdpbfslatytbvpncnitatzbdvmpqtctxhrdwrytetvnflqvotitrzhbaxwtktpfvj
kzetmtnljrubmtotlrxzedutqtjxlhofctsthdzpziluvugkoyjktuxueqcgtmbuzucwqodojubuacew
nqruduyisexszufuwogmrwpujusaicbyxuluqgwklafunuomksvcnupumsyafevurukymipgdutuieaq
ajmvwvhlpzkluvyvfrdhuncvavdxrpepkvcvbdfxorsvevzjtfytavgvxphnsxqvkvtbjdczyvmvrhxl
mbgvovpnltwdovqvntzbgfwvsvlznjqhevuvjfbrbknwxwimqalmvwzwgseivodwbweysqfqlwdwcegy
pstwfwakugzubwhwyqiotyrwlwuckedazwnwsiymnchwpwqomuxepwrwouachgxwtwmaokrifwvwkgcs
cloxyxjnrbmnwxaxhtfjwpexcxfztrgrmxexdfhzqtuxgxblvhavcxixzrjpuzsxmxvdlfebaxoxtjzn
odixqxrpnvyfqxsxpvbdihyxuxnbplsjgxwxlhdtdmpyzykoscnoxybyiugkxqfydygaushsnyfyegia
ruvyhycmwibwdyjyaskqvatynywemgfcbypyukaopejyrysqowzgrytyqwcejizyvyocqmtkhyxymieu
enqzazlptdopyzczjvhlyrgzezhbvtitozgzfhjbsvwzizdnxjcxezkzbtlrwbuzozxfnhgdczqzvlbp
qfkzsztrpxahszuzrxdfkjazwzpdrnulizyznjfvforabamquepqzadakwimzshafaicwujupahagikc
twxajaeoykdyfalacumsxcvapaygoihedarawmcqrglatausqybitavasyeglkbaxaqesovmjazaokgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: forabamque
Cipher: sbenonzdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: forabamque
Cipher: 12432411211123145451

Extended Methods:
Method #1

Plaintext: forabamque
method variations:
ltwfgfrvzkqyblmlwaepvdgqrqbfkuaimvwvglpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
f o r a b a m q u e 
1 4 2 1 2 1 2 1 5 5 
2 3 4 1 1 1 3 4 4 1 
They are then read out in rows:
14212121552341113441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: forabamque
Cipher: qbbbzmdasd

Read more ...
Method #3

Plaintext: forabamque
method variations:
rhdfafcyya hdfafcyyar dfafcyyarh
fafcyyarhd afcyyarhdf fcyyarhdfa
cyyarhdfaf yyarhdfafc yarhdfafcy
arhdfafcyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: forabamque

first 5040 cipher variations(3628800 total)
forabamque forabamqeu forabamuqe forabamueq forabameuq forabamequ forabaqmue forabaqmeu forabaqume forabaquem forabaqeum
forabaqemu forabauqme forabauqem forabaumqe forabaumeq forabauemq forabaueqm forabaequm forabaeqmu forabaeuqm forabaeumq
forabaemuq forabaemqu forabmaque forabmaqeu forabmauqe forabmaueq forabmaeuq forabmaequ forabmqaue forabmqaeu forabmquae
forabmquea forabmqeua forabmqeau forabmuqae forabmuqea forabmuaqe forabmuaeq forabmueaq forabmueqa forabmequa forabmeqau
forabmeuqa forabmeuaq forabmeauq forabmeaqu forabqmaue forabqmaeu forabqmuae forabqmuea forabqmeua forabqmeau forabqamue
forabqameu forabqaume forabqauem forabqaeum forabqaemu forabquame forabquaem forabqumae forabqumea forabquema forabqueam
forabqeaum forabqeamu forabqeuam forabqeuma forabqemua forabqemau forabumqae forabumqea forabumaqe forabumaeq forabumeaq
forabumeqa forabuqmae forabuqmea forabuqame forabuqaem forabuqeam forabuqema forabuaqme forabuaqem forabuamqe forabuameq
forabuaemq forabuaeqm forabueqam forabueqma forabueaqm forabueamq forabuemaq forabuemqa forabemqua forabemqau forabemuqa
forabemuaq forabemauq forabemaqu forabeqmua forabeqmau forabequma forabequam forabeqaum forabeqamu forabeuqma forabeuqam
forabeumqa forabeumaq forabeuamq forabeuaqm forabeaqum forabeaqmu forabeauqm forabeaumq forabeamuq forabeamqu foraabmque
foraabmqeu foraabmuqe foraabmueq foraabmeuq foraabmequ foraabqmue foraabqmeu foraabqume foraabquem foraabqeum foraabqemu
foraabuqme foraabuqem foraabumqe foraabumeq foraabuemq foraabueqm foraabequm foraabeqmu foraabeuqm foraabeumq foraabemuq
foraabemqu foraambque foraambqeu foraambuqe foraambueq foraambeuq foraambequ foraamqbue foraamqbeu foraamqube foraamqueb
foraamqeub foraamqebu foraamuqbe foraamuqeb foraamubqe foraamubeq foraamuebq foraamueqb foraamequb foraameqbu foraameuqb
foraameubq foraamebuq foraamebqu foraaqmbue foraaqmbeu foraaqmube foraaqmueb foraaqmeub foraaqmebu foraaqbmue foraaqbmeu
foraaqbume foraaqbuem foraaqbeum foraaqbemu foraaqubme foraaqubem foraaqumbe foraaqumeb foraaquemb foraaquebm foraaqebum
foraaqebmu foraaqeubm foraaqeumb foraaqemub foraaqembu foraaumqbe foraaumqeb foraaumbqe foraaumbeq foraaumebq foraaumeqb
foraauqmbe foraauqmeb foraauqbme foraauqbem foraauqebm foraauqemb foraaubqme foraaubqem foraaubmqe foraaubmeq foraaubemq
foraaubeqm foraaueqbm foraaueqmb foraauebqm foraauebmq foraauembq foraauemqb foraaemqub foraaemqbu foraaemuqb foraaemubq
foraaembuq foraaembqu foraaeqmub foraaeqmbu foraaequmb foraaequbm foraaeqbum foraaeqbmu foraaeuqmb foraaeuqbm foraaeumqb
foraaeumbq foraaeubmq foraaeubqm foraaebqum foraaebqmu foraaebuqm foraaebumq foraaebmuq foraaebmqu foramabque foramabqeu
foramabuqe foramabueq foramabeuq foramabequ foramaqbue foramaqbeu foramaqube foramaqueb foramaqeub foramaqebu foramauqbe
foramauqeb foramaubqe foramaubeq foramauebq foramaueqb foramaequb foramaeqbu foramaeuqb foramaeubq foramaebuq foramaebqu
forambaque forambaqeu forambauqe forambaueq forambaeuq forambaequ forambqaue forambqaeu forambquae forambquea forambqeua
forambqeau forambuqae forambuqea forambuaqe forambuaeq forambueaq forambueqa forambequa forambeqau forambeuqa forambeuaq
forambeauq forambeaqu foramqbaue foramqbaeu foramqbuae foramqbuea foramqbeua foramqbeau foramqabue foramqabeu foramqaube
foramqaueb foramqaeub foramqaebu foramquabe foramquaeb foramqubae foramqubea foramqueba foramqueab foramqeaub foramqeabu
foramqeuab foramqeuba foramqebua foramqebau foramubqae foramubqea foramubaqe foramubaeq foramubeaq foramubeqa foramuqbae
foramuqbea foramuqabe foramuqaeb foramuqeab foramuqeba foramuaqbe foramuaqeb foramuabqe foramuabeq foramuaebq foramuaeqb
foramueqab foramueqba foramueaqb foramueabq foramuebaq foramuebqa foramebqua foramebqau foramebuqa foramebuaq foramebauq
foramebaqu forameqbua forameqbau foramequba foramequab forameqaub forameqabu forameuqba forameuqab forameubqa forameubaq
forameuabq forameuaqb forameaqub forameaqbu forameauqb forameaubq forameabuq forameabqu foraqambue foraqambeu foraqamube
foraqamueb foraqameub foraqamebu foraqabmue foraqabmeu foraqabume foraqabuem foraqabeum foraqabemu foraqaubme foraqaubem
foraqaumbe foraqaumeb foraqauemb foraqauebm foraqaebum foraqaebmu foraqaeubm foraqaeumb foraqaemub foraqaembu foraqmabue
foraqmabeu foraqmaube foraqmaueb foraqmaeub foraqmaebu foraqmbaue foraqmbaeu foraqmbuae foraqmbuea foraqmbeua foraqmbeau
foraqmubae foraqmubea foraqmuabe foraqmuaeb foraqmueab foraqmueba foraqmebua foraqmebau foraqmeuba foraqmeuab foraqmeaub
foraqmeabu foraqbmaue foraqbmaeu foraqbmuae foraqbmuea foraqbmeua foraqbmeau foraqbamue foraqbameu foraqbaume foraqbauem
foraqbaeum foraqbaemu foraqbuame foraqbuaem foraqbumae foraqbumea foraqbuema foraqbueam foraqbeaum foraqbeamu foraqbeuam
foraqbeuma foraqbemua foraqbemau foraqumbae foraqumbea foraqumabe foraqumaeb foraqumeab foraqumeba foraqubmae foraqubmea
foraqubame foraqubaem foraqubeam foraqubema foraquabme foraquabem foraquambe foraquameb foraquaemb foraquaebm foraquebam
foraquebma foraqueabm foraqueamb foraquemab foraquemba foraqembua foraqembau foraqemuba foraqemuab foraqemaub foraqemabu
foraqebmua foraqebmau foraqebuma foraqebuam foraqebaum foraqebamu foraqeubma foraqeubam foraqeumba foraqeumab foraqeuamb
foraqeuabm foraqeabum foraqeabmu foraqeaubm foraqeaumb foraqeamub foraqeambu forauamqbe forauamqeb forauambqe forauambeq
forauamebq forauameqb forauaqmbe forauaqmeb forauaqbme forauaqbem forauaqebm forauaqemb forauabqme forauabqem forauabmqe
forauabmeq forauabemq forauabeqm forauaeqbm forauaeqmb forauaebqm forauaebmq forauaembq forauaemqb foraumaqbe foraumaqeb
foraumabqe foraumabeq foraumaebq foraumaeqb foraumqabe foraumqaeb foraumqbae foraumqbea foraumqeba foraumqeab foraumbqae
foraumbqea foraumbaqe foraumbaeq foraumbeaq foraumbeqa foraumeqba foraumeqab foraumebqa foraumebaq foraumeabq foraumeaqb
forauqmabe forauqmaeb forauqmbae forauqmbea forauqmeba forauqmeab forauqambe forauqameb forauqabme forauqabem forauqaebm
forauqaemb forauqbame forauqbaem forauqbmae forauqbmea forauqbema forauqbeam forauqeabm forauqeamb forauqebam forauqebma
forauqemba forauqemab foraubmqae foraubmqea foraubmaqe foraubmaeq foraubmeaq foraubmeqa foraubqmae foraubqmea foraubqame
foraubqaem foraubqeam foraubqema foraubaqme foraubaqem foraubamqe foraubameq foraubaemq foraubaeqm foraubeqam foraubeqma
foraubeaqm foraubeamq foraubemaq foraubemqa forauemqba forauemqab forauembqa forauembaq forauemabq forauemaqb foraueqmba
foraueqmab foraueqbma foraueqbam foraueqabm foraueqamb forauebqma forauebqam forauebmqa forauebmaq forauebamq forauebaqm
foraueaqbm foraueaqmb foraueabqm foraueabmq foraueambq foraueamqb foraeamqub foraeamqbu foraeamuqb foraeamubq foraeambuq
foraeambqu foraeaqmub foraeaqmbu foraeaqumb foraeaqubm foraeaqbum foraeaqbmu foraeauqmb foraeauqbm foraeaumqb foraeaumbq
foraeaubmq foraeaubqm foraeabqum foraeabqmu foraeabuqm foraeabumq foraeabmuq foraeabmqu foraemaqub foraemaqbu foraemauqb
foraemaubq foraemabuq foraemabqu foraemqaub foraemqabu foraemquab foraemquba foraemqbua foraemqbau foraemuqab foraemuqba
foraemuaqb foraemuabq foraemubaq foraemubqa foraembqua foraembqau foraembuqa foraembuaq foraembauq foraembaqu foraeqmaub
foraeqmabu foraeqmuab foraeqmuba foraeqmbua foraeqmbau foraeqamub foraeqambu foraeqaumb foraeqaubm foraeqabum foraeqabmu
foraequamb foraequabm foraequmab foraequmba foraequbma foraequbam foraeqbaum foraeqbamu foraeqbuam foraeqbuma foraeqbmua
foraeqbmau foraeumqab foraeumqba foraeumaqb foraeumabq foraeumbaq foraeumbqa foraeuqmab foraeuqmba foraeuqamb foraeuqabm
foraeuqbam foraeuqbma foraeuaqmb foraeuaqbm foraeuamqb foraeuambq foraeuabmq foraeuabqm foraeubqam foraeubqma foraeubaqm
foraeubamq foraeubmaq foraeubmqa foraebmqua foraebmqau foraebmuqa foraebmuaq foraebmauq foraebmaqu foraebqmua foraebqmau
foraebquma foraebquam foraebqaum foraebqamu foraebuqma foraebuqam foraebumqa foraebumaq foraebuamq foraebuaqm foraebaqum
foraebaqmu foraebauqm foraebaumq foraebamuq foraebamqu forbaamque forbaamqeu forbaamuqe forbaamueq forbaameuq forbaamequ
forbaaqmue forbaaqmeu forbaaqume forbaaquem forbaaqeum forbaaqemu forbaauqme forbaauqem forbaaumqe forbaaumeq forbaauemq
forbaaueqm forbaaequm forbaaeqmu forbaaeuqm forbaaeumq forbaaemuq forbaaemqu forbamaque forbamaqeu forbamauqe forbamaueq
forbamaeuq forbamaequ forbamqaue forbamqaeu forbamquae forbamquea forbamqeua forbamqeau forbamuqae forbamuqea forbamuaqe
forbamuaeq forbamueaq forbamueqa forbamequa forbameqau forbameuqa forbameuaq forbameauq forbameaqu forbaqmaue forbaqmaeu
forbaqmuae forbaqmuea forbaqmeua forbaqmeau forbaqamue forbaqameu forbaqaume forbaqauem forbaqaeum forbaqaemu forbaquame
forbaquaem forbaqumae forbaqumea forbaquema forbaqueam forbaqeaum forbaqeamu forbaqeuam forbaqeuma forbaqemua forbaqemau
forbaumqae forbaumqea forbaumaqe forbaumaeq forbaumeaq forbaumeqa forbauqmae forbauqmea forbauqame forbauqaem forbauqeam
forbauqema forbauaqme forbauaqem forbauamqe forbauameq forbauaemq forbauaeqm forbaueqam forbaueqma forbaueaqm forbaueamq
forbauemaq forbauemqa forbaemqua forbaemqau forbaemuqa forbaemuaq forbaemauq forbaemaqu forbaeqmua forbaeqmau forbaequma
forbaequam forbaeqaum forbaeqamu forbaeuqma forbaeuqam forbaeumqa forbaeumaq forbaeuamq forbaeuaqm forbaeaqum forbaeaqmu
forbaeauqm forbaeaumq forbaeamuq forbaeamqu forbaamque forbaamqeu forbaamuqe forbaamueq forbaameuq forbaamequ forbaaqmue
forbaaqmeu forbaaqume forbaaquem forbaaqeum forbaaqemu forbaauqme forbaauqem forbaaumqe forbaaumeq forbaauemq forbaaueqm
forbaaequm forbaaeqmu forbaaeuqm forbaaeumq forbaaemuq forbaaemqu forbamaque forbamaqeu forbamauqe forbamaueq forbamaeuq
forbamaequ forbamqaue forbamqaeu forbamquae forbamquea forbamqeua forbamqeau forbamuqae forbamuqea forbamuaqe forbamuaeq
forbamueaq forbamueqa forbamequa forbameqau forbameuqa forbameuaq forbameauq forbameaqu forbaqmaue forbaqmaeu forbaqmuae
forbaqmuea forbaqmeua forbaqmeau forbaqamue forbaqameu forbaqaume forbaqauem forbaqaeum forbaqaemu forbaquame forbaquaem
forbaqumae forbaqumea forbaquema forbaqueam forbaqeaum forbaqeamu forbaqeuam forbaqeuma forbaqemua forbaqemau forbaumqae
forbaumqea forbaumaqe forbaumaeq forbaumeaq forbaumeqa forbauqmae forbauqmea forbauqame forbauqaem forbauqeam forbauqema
forbauaqme forbauaqem forbauamqe forbauameq forbauaemq forbauaeqm forbaueqam forbaueqma forbaueaqm forbaueamq forbauemaq
forbauemqa forbaemqua forbaemqau forbaemuqa forbaemuaq forbaemauq forbaemaqu forbaeqmua forbaeqmau forbaequma forbaequam
forbaeqaum forbaeqamu forbaeuqma forbaeuqam forbaeumqa forbaeumaq forbaeuamq forbaeuaqm forbaeaqum forbaeaqmu forbaeauqm
forbaeaumq forbaeamuq forbaeamqu forbmaaque forbmaaqeu forbmaauqe forbmaaueq forbmaaeuq forbmaaequ forbmaqaue forbmaqaeu
forbmaquae forbmaquea forbmaqeua forbmaqeau forbmauqae forbmauqea forbmauaqe forbmauaeq forbmaueaq forbmaueqa forbmaequa
forbmaeqau forbmaeuqa forbmaeuaq forbmaeauq forbmaeaqu forbmaaque forbmaaqeu forbmaauqe forbmaaueq forbmaaeuq forbmaaequ
forbmaqaue forbmaqaeu forbmaquae forbmaquea forbmaqeua forbmaqeau forbmauqae forbmauqea forbmauaqe forbmauaeq forbmaueaq
forbmaueqa forbmaequa forbmaeqau forbmaeuqa forbmaeuaq forbmaeauq forbmaeaqu forbmqaaue forbmqaaeu forbmqauae forbmqauea
forbmqaeua forbmqaeau forbmqaaue forbmqaaeu forbmqauae forbmqauea forbmqaeua forbmqaeau forbmquaae forbmquaea forbmquaae
forbmquaea forbmqueaa forbmqueaa forbmqeaua forbmqeaau forbmqeuaa forbmqeuaa forbmqeaua forbmqeaau forbmuaqae forbmuaqea
forbmuaaqe forbmuaaeq forbmuaeaq forbmuaeqa forbmuqaae forbmuqaea forbmuqaae forbmuqaea forbmuqeaa forbmuqeaa forbmuaqae
forbmuaqea forbmuaaqe forbmuaaeq forbmuaeaq forbmuaeqa forbmueqaa forbmueqaa forbmueaqa forbmueaaq forbmueaaq forbmueaqa
forbmeaqua forbmeaqau forbmeauqa forbmeauaq forbmeaauq forbmeaaqu forbmeqaua forbmeqaau forbmequaa forbmequaa forbmeqaua
forbmeqaau forbmeuqaa forbmeuqaa forbmeuaqa forbmeuaaq forbmeuaaq forbmeuaqa forbmeaqua forbmeaqau forbmeauqa forbmeauaq
forbmeaauq forbmeaaqu forbqamaue forbqamaeu forbqamuae forbqamuea forbqameua forbqameau forbqaamue forbqaameu forbqaaume
forbqaauem forbqaaeum forbqaaemu forbqauame forbqauaem forbqaumae forbqaumea forbqauema forbqaueam forbqaeaum forbqaeamu
forbqaeuam forbqaeuma forbqaemua forbqaemau forbqmaaue forbqmaaeu forbqmauae forbqmauea forbqmaeua forbqmaeau forbqmaaue
forbqmaaeu forbqmauae forbqmauea forbqmaeua forbqmaeau forbqmuaae forbqmuaea forbqmuaae forbqmuaea forbqmueaa forbqmueaa
forbqmeaua forbqmeaau forbqmeuaa forbqmeuaa forbqmeaua forbqmeaau forbqamaue forbqamaeu forbqamuae forbqamuea forbqameua
forbqameau forbqaamue forbqaameu forbqaaume forbqaauem forbqaaeum forbqaaemu forbqauame forbqauaem forbqaumae forbqaumea
forbqauema forbqaueam forbqaeaum forbqaeamu forbqaeuam forbqaeuma forbqaemua forbqaemau forbqumaae forbqumaea forbqumaae
forbqumaea forbqumeaa forbqumeaa forbquamae forbquamea forbquaame forbquaaem forbquaeam forbquaema forbquaame forbquaaem
forbquamae forbquamea forbquaema forbquaeam forbqueaam forbqueama forbqueaam forbqueama forbquemaa forbquemaa forbqemaua
forbqemaau forbqemuaa forbqemuaa forbqemaua forbqemaau forbqeamua forbqeamau forbqeauma forbqeauam forbqeaaum forbqeaamu
forbqeuama forbqeuaam forbqeumaa forbqeumaa forbqeuama forbqeuaam forbqeaaum forbqeaamu forbqeauam forbqeauma forbqeamua
forbqeamau forbuamqae forbuamqea forbuamaqe forbuamaeq forbuameaq forbuameqa forbuaqmae forbuaqmea forbuaqame forbuaqaem
forbuaqeam forbuaqema forbuaaqme forbuaaqem forbuaamqe forbuaameq forbuaaemq forbuaaeqm forbuaeqam forbuaeqma forbuaeaqm
forbuaeamq forbuaemaq forbuaemqa forbumaqae forbumaqea forbumaaqe forbumaaeq forbumaeaq forbumaeqa forbumqaae forbumqaea
forbumqaae forbumqaea forbumqeaa forbumqeaa forbumaqae forbumaqea forbumaaqe forbumaaeq forbumaeaq forbumaeqa forbumeqaa
forbumeqaa forbumeaqa forbumeaaq forbumeaaq forbumeaqa forbuqmaae forbuqmaea forbuqmaae forbuqmaea forbuqmeaa forbuqmeaa
forbuqamae forbuqamea forbuqaame forbuqaaem forbuqaeam forbuqaema forbuqaame forbuqaaem forbuqamae forbuqamea forbuqaema
forbuqaeam forbuqeaam forbuqeama forbuqeaam forbuqeama forbuqemaa forbuqemaa forbuamqae forbuamqea forbuamaqe forbuamaeq
forbuameaq forbuameqa forbuaqmae forbuaqmea forbuaqame forbuaqaem forbuaqeam forbuaqema forbuaaqme forbuaaqem forbuaamqe
forbuaameq forbuaaemq forbuaaeqm forbuaeqam forbuaeqma forbuaeaqm forbuaeamq forbuaemaq forbuaemqa forbuemqaa forbuemqaa
forbuemaqa forbuemaaq forbuemaaq forbuemaqa forbueqmaa forbueqmaa forbueqama forbueqaam forbueqaam forbueqama forbueaqma
forbueaqam forbueamqa forbueamaq forbueaamq forbueaaqm forbueaqam forbueaqma forbueaaqm forbueaamq forbueamaq forbueamqa
forbeamqua forbeamqau forbeamuqa forbeamuaq forbeamauq forbeamaqu forbeaqmua forbeaqmau forbeaquma forbeaquam forbeaqaum
forbeaqamu forbeauqma forbeauqam forbeaumqa forbeaumaq forbeauamq forbeauaqm forbeaaqum forbeaaqmu forbeaauqm forbeaaumq
forbeaamuq forbeaamqu forbemaqua forbemaqau forbemauqa forbemauaq forbemaauq forbemaaqu forbemqaua forbemqaau forbemquaa
forbemquaa forbemqaua forbemqaau forbemuqaa forbemuqaa forbemuaqa forbemuaaq forbemuaaq forbemuaqa forbemaqua forbemaqau
forbemauqa forbemauaq forbemaauq forbemaaqu forbeqmaua forbeqmaau forbeqmuaa forbeqmuaa forbeqmaua forbeqmaau forbeqamua
forbeqamau forbeqauma forbeqauam forbeqaaum forbeqaamu forbequama forbequaam forbequmaa forbequmaa forbequama forbequaam
forbeqaaum forbeqaamu forbeqauam forbeqauma forbeqamua forbeqamau forbeumqaa forbeumqaa forbeumaqa forbeumaaq forbeumaaq
forbeumaqa forbeuqmaa forbeuqmaa forbeuqama forbeuqaam forbeuqaam forbeuqama forbeuaqma forbeuaqam forbeuamqa forbeuamaq
forbeuaamq forbeuaaqm forbeuaqam forbeuaqma forbeuaaqm forbeuaamq forbeuamaq forbeuamqa forbeamqua forbeamqau forbeamuqa
forbeamuaq forbeamauq forbeamaqu forbeaqmua forbeaqmau forbeaquma forbeaquam forbeaqaum forbeaqamu forbeauqma forbeauqam
forbeaumqa forbeaumaq forbeauamq forbeauaqm forbeaaqum forbeaaqmu forbeaauqm forbeaaumq forbeaamuq forbeaamqu forabamque
forabamqeu forabamuqe forabamueq forabameuq forabamequ forabaqmue forabaqmeu forabaqume forabaquem forabaqeum forabaqemu
forabauqme forabauqem forabaumqe forabaumeq forabauemq forabaueqm forabaequm forabaeqmu forabaeuqm forabaeumq forabaemuq
forabaemqu forabmaque forabmaqeu forabmauqe forabmaueq forabmaeuq forabmaequ forabmqaue forabmqaeu forabmquae forabmquea
forabmqeua forabmqeau forabmuqae forabmuqea forabmuaqe forabmuaeq forabmueaq forabmueqa forabmequa forabmeqau forabmeuqa
forabmeuaq forabmeauq forabmeaqu forabqmaue forabqmaeu forabqmuae forabqmuea forabqmeua forabqmeau forabqamue forabqameu
forabqaume forabqauem forabqaeum forabqaemu forabquame forabquaem forabqumae forabqumea forabquema forabqueam forabqeaum
forabqeamu forabqeuam forabqeuma forabqemua forabqemau forabumqae forabumqea forabumaqe forabumaeq forabumeaq forabumeqa
forabuqmae forabuqmea forabuqame forabuqaem forabuqeam forabuqema forabuaqme forabuaqem forabuamqe forabuameq forabuaemq
forabuaeqm forabueqam forabueqma forabueaqm forabueamq forabuemaq forabuemqa forabemqua forabemqau forabemuqa forabemuaq
forabemauq forabemaqu forabeqmua forabeqmau forabequma forabequam forabeqaum forabeqamu forabeuqma forabeuqam forabeumqa
forabeumaq forabeuamq forabeuaqm forabeaqum forabeaqmu forabeauqm forabeaumq forabeamuq forabeamqu foraabmque foraabmqeu
foraabmuqe foraabmueq foraabmeuq foraabmequ foraabqmue foraabqmeu foraabqume foraabquem foraabqeum foraabqemu foraabuqme
foraabuqem foraabumqe foraabumeq foraabuemq foraabueqm foraabequm foraabeqmu foraabeuqm foraabeumq foraabemuq foraabemqu
foraambque foraambqeu foraambuqe foraambueq foraambeuq foraambequ foraamqbue foraamqbeu foraamqube foraamqueb foraamqeub
foraamqebu foraamuqbe foraamuqeb foraamubqe foraamubeq foraamuebq foraamueqb foraamequb foraameqbu foraameuqb foraameubq
foraamebuq foraamebqu foraaqmbue foraaqmbeu foraaqmube foraaqmueb foraaqmeub foraaqmebu foraaqbmue foraaqbmeu foraaqbume
foraaqbuem foraaqbeum foraaqbemu foraaqubme foraaqubem foraaqumbe foraaqumeb foraaquemb foraaquebm foraaqebum foraaqebmu
foraaqeubm foraaqeumb foraaqemub foraaqembu foraaumqbe foraaumqeb foraaumbqe foraaumbeq foraaumebq foraaumeqb foraauqmbe
foraauqmeb foraauqbme foraauqbem foraauqebm foraauqemb foraaubqme foraaubqem foraaubmqe foraaubmeq foraaubemq foraaubeqm
foraaueqbm foraaueqmb foraauebqm foraauebmq foraauembq foraauemqb foraaemqub foraaemqbu foraaemuqb foraaemubq foraaembuq
foraaembqu foraaeqmub foraaeqmbu foraaequmb foraaequbm foraaeqbum foraaeqbmu foraaeuqmb foraaeuqbm foraaeumqb foraaeumbq
foraaeubmq foraaeubqm foraaebqum foraaebqmu foraaebuqm foraaebumq foraaebmuq foraaebmqu foramabque foramabqeu foramabuqe
foramabueq foramabeuq foramabequ foramaqbue foramaqbeu foramaqube foramaqueb foramaqeub foramaqebu foramauqbe foramauqeb
foramaubqe foramaubeq foramauebq foramaueqb foramaequb foramaeqbu foramaeuqb foramaeubq foramaebuq foramaebqu forambaque
forambaqeu forambauqe forambaueq forambaeuq forambaequ forambqaue forambqaeu forambquae forambquea forambqeua forambqeau
forambuqae forambuqea forambuaqe forambuaeq forambueaq forambueqa forambequa forambeqau forambeuqa forambeuaq forambeauq
forambeaqu foramqbaue foramqbaeu foramqbuae foramqbuea foramqbeua foramqbeau foramqabue foramqabeu foramqaube foramqaueb
foramqaeub foramqaebu foramquabe foramquaeb foramqubae foramqubea foramqueba foramqueab foramqeaub foramqeabu foramqeuab
foramqeuba foramqebua foramqebau foramubqae foramubqea foramubaqe foramubaeq foramubeaq foramubeqa foramuqbae foramuqbea
foramuqabe foramuqaeb foramuqeab foramuqeba foramuaqbe foramuaqeb foramuabqe foramuabeq foramuaebq foramuaeqb foramueqab
foramueqba foramueaqb foramueabq foramuebaq foramuebqa foramebqua foramebqau foramebuqa foramebuaq foramebauq foramebaqu
forameqbua forameqbau foramequba foramequab forameqaub forameqabu forameuqba forameuqab forameubqa forameubaq forameuabq
forameuaqb forameaqub forameaqbu forameauqb forameaubq forameabuq forameabqu foraqambue foraqambeu foraqamube foraqamueb
foraqameub foraqamebu foraqabmue foraqabmeu foraqabume foraqabuem foraqabeum foraqabemu foraqaubme foraqaubem foraqaumbe
foraqaumeb foraqauemb foraqauebm foraqaebum foraqaebmu foraqaeubm foraqaeumb foraqaemub foraqaembu foraqmabue foraqmabeu
foraqmaube foraqmaueb foraqmaeub foraqmaebu foraqmbaue foraqmbaeu foraqmbuae foraqmbuea foraqmbeua foraqmbeau foraqmubae
foraqmubea foraqmuabe foraqmuaeb foraqmueab foraqmueba foraqmebua foraqmebau foraqmeuba foraqmeuab foraqmeaub foraqmeabu
foraqbmaue foraqbmaeu foraqbmuae foraqbmuea foraqbmeua foraqbmeau foraqbamue foraqbameu foraqbaume foraqbauem foraqbaeum
foraqbaemu foraqbuame foraqbuaem foraqbumae foraqbumea foraqbuema foraqbueam foraqbeaum foraqbeamu foraqbeuam foraqbeuma
foraqbemua foraqbemau foraqumbae foraqumbea foraqumabe foraqumaeb foraqumeab foraqumeba foraqubmae foraqubmea foraqubame
foraqubaem foraqubeam foraqubema foraquabme foraquabem foraquambe foraquameb foraquaemb foraquaebm foraquebam foraquebma
foraqueabm foraqueamb foraquemab foraquemba foraqembua foraqembau foraqemuba foraqemuab foraqemaub foraqemabu foraqebmua
foraqebmau foraqebuma foraqebuam foraqebaum foraqebamu foraqeubma foraqeubam foraqeumba foraqeumab foraqeuamb foraqeuabm
foraqeabum foraqeabmu foraqeaubm foraqeaumb foraqeamub foraqeambu forauamqbe forauamqeb forauambqe forauambeq forauamebq
forauameqb forauaqmbe forauaqmeb forauaqbme forauaqbem forauaqebm forauaqemb forauabqme forauabqem forauabmqe forauabmeq
forauabemq forauabeqm forauaeqbm forauaeqmb forauaebqm forauaebmq forauaembq forauaemqb foraumaqbe foraumaqeb foraumabqe
foraumabeq foraumaebq foraumaeqb foraumqabe foraumqaeb foraumqbae foraumqbea foraumqeba foraumqeab foraumbqae foraumbqea
foraumbaqe foraumbaeq foraumbeaq foraumbeqa foraumeqba foraumeqab foraumebqa foraumebaq foraumeabq foraumeaqb forauqmabe
forauqmaeb forauqmbae forauqmbea forauqmeba forauqmeab forauqambe forauqameb forauqabme forauqabem forauqaebm forauqaemb
forauqbame forauqbaem forauqbmae forauqbmea forauqbema forauqbeam forauqeabm forauqeamb forauqebam forauqebma forauqemba
forauqemab foraubmqae foraubmqea foraubmaqe foraubmaeq foraubmeaq foraubmeqa foraubqmae foraubqmea foraubqame foraubqaem
foraubqeam foraubqema foraubaqme foraubaqem foraubamqe foraubameq foraubaemq foraubaeqm foraubeqam foraubeqma foraubeaqm
foraubeamq foraubemaq foraubemqa forauemqba forauemqab forauembqa forauembaq forauemabq forauemaqb foraueqmba foraueqmab
foraueqbma foraueqbam foraueqabm foraueqamb forauebqma forauebqam forauebmqa forauebmaq forauebamq forauebaqm foraueaqbm
foraueaqmb foraueabqm foraueabmq foraueambq foraueamqb foraeamqub foraeamqbu foraeamuqb foraeamubq foraeambuq foraeambqu
foraeaqmub foraeaqmbu foraeaqumb foraeaqubm foraeaqbum foraeaqbmu foraeauqmb foraeauqbm foraeaumqb foraeaumbq foraeaubmq
foraeaubqm foraeabqum foraeabqmu foraeabuqm foraeabumq foraeabmuq foraeabmqu foraemaqub foraemaqbu foraemauqb foraemaubq
foraemabuq foraemabqu foraemqaub foraemqabu foraemquab foraemquba foraemqbua foraemqbau foraemuqab foraemuqba foraemuaqb
foraemuabq foraemubaq foraemubqa foraembqua foraembqau foraembuqa foraembuaq foraembauq foraembaqu foraeqmaub foraeqmabu
foraeqmuab foraeqmuba foraeqmbua foraeqmbau foraeqamub foraeqambu foraeqaumb foraeqaubm foraeqabum foraeqabmu foraequamb
foraequabm foraequmab foraequmba foraequbma foraequbam foraeqbaum foraeqbamu foraeqbuam foraeqbuma foraeqbmua foraeqbmau
foraeumqab foraeumqba foraeumaqb foraeumabq foraeumbaq foraeumbqa foraeuqmab foraeuqmba foraeuqamb foraeuqabm foraeuqbam
foraeuqbma foraeuaqmb foraeuaqbm foraeuamqb foraeuambq foraeuabmq foraeuabqm foraeubqam foraeubqma foraeubaqm foraeubamq
foraeubmaq foraeubmqa foraebmqua foraebmqau foraebmuqa foraebmuaq foraebmauq foraebmaqu foraebqmua foraebqmau foraebquma
foraebquam foraebqaum foraebqamu foraebuqma foraebuqam foraebumqa foraebumaq foraebuamq foraebuaqm foraebaqum foraebaqmu
foraebauqm foraebaumq foraebamuq foraebamqu formbaaque formbaaqeu formbaauqe formbaaueq formbaaeuq formbaaequ formbaqaue
formbaqaeu formbaquae formbaquea formbaqeua formbaqeau formbauqae formbauqea formbauaqe formbauaeq formbaueaq formbaueqa
formbaequa formbaeqau formbaeuqa formbaeuaq formbaeauq formbaeaqu formbaaque formbaaqeu formbaauqe formbaaueq formbaaeuq
formbaaequ formbaqaue formbaqaeu formbaquae formbaquea formbaqeua formbaqeau formbauqae formbauqea formbauaqe formbauaeq
formbaueaq formbaueqa formbaequa formbaeqau formbaeuqa formbaeuaq formbaeauq formbaeaqu formbqaaue formbqaaeu formbqauae
formbqauea formbqaeua formbqaeau formbqaaue formbqaaeu formbqauae formbqauea formbqaeua formbqaeau formbquaae formbquaea
formbquaae formbquaea formbqueaa formbqueaa formbqeaua formbqeaau formbqeuaa formbqeuaa formbqeaua formbqeaau formbuaqae
formbuaqea formbuaaqe formbuaaeq formbuaeaq formbuaeqa formbuqaae formbuqaea formbuqaae formbuqaea formbuqeaa formbuqeaa
formbuaqae formbuaqea formbuaaqe formbuaaeq formbuaeaq formbuaeqa formbueqaa formbueqaa formbueaqa formbueaaq formbueaaq
formbueaqa formbeaqua formbeaqau formbeauqa formbeauaq formbeaauq formbeaaqu formbeqaua formbeqaau formbequaa formbequaa
formbeqaua formbeqaau formbeuqaa formbeuqaa formbeuaqa formbeuaaq formbeuaaq formbeuaqa formbeaqua formbeaqau formbeauqa
formbeauaq formbeaauq formbeaaqu formabaque formabaqeu formabauqe formabaueq formabaeuq formabaequ formabqaue formabqaeu
formabquae formabquea formabqeua formabqeau formabuqae formabuqea formabuaqe formabuaeq formabueaq formabueqa formabequa
formabeqau formabeuqa formabeuaq formabeauq formabeaqu formaabque formaabqeu formaabuqe formaabueq formaabeuq formaabequ
formaaqbue formaaqbeu formaaqube formaaqueb formaaqeub formaaqebu formaauqbe formaauqeb formaaubqe formaaubeq formaauebq
formaaueqb formaaequb formaaeqbu formaaeuqb formaaeubq formaaebuq formaaebqu formaqabue formaqabeu formaqaube formaqaueb
formaqaeub formaqaebu formaqbaue formaqbaeu formaqbuae formaqbuea formaqbeua formaqbeau formaqubae formaqubea formaquabe
formaquaeb formaqueab formaqueba formaqebua formaqebau formaqeuba formaqeuab formaqeaub formaqeabu formauaqbe formauaqeb
formauabqe formauabeq formauaebq formauaeqb formauqabe formauqaeb formauqbae formauqbea formauqeba formauqeab formaubqae
formaubqea formaubaqe formaubaeq formaubeaq formaubeqa formaueqba formaueqab formauebqa formauebaq formaueabq formaueaqb
formaeaqub formaeaqbu formaeauqb formaeaubq formaeabuq formaeabqu formaeqaub formaeqabu formaequab formaequba formaeqbua
formaeqbau formaeuqab formaeuqba formaeuaqb formaeuabq formaeubaq formaeubqa formaebqua formaebqau formaebuqa formaebuaq
formaebauq formaebaqu formaabque formaabqeu formaabuqe formaabueq formaabeuq formaabequ formaaqbue formaaqbeu formaaqube
formaaqueb formaaqeub formaaqebu formaauqbe formaauqeb formaaubqe formaaubeq formaauebq formaaueqb formaaequb formaaeqbu
formaaeuqb formaaeubq formaaebuq formaaebqu formabaque formabaqeu formabauqe formabaueq formabaeuq formabaequ formabqaue
formabqaeu formabquae formabquea formabqeua formabqeau formabuqae formabuqea formabuaqe formabuaeq formabueaq formabueqa
formabequa formabeqau formabeuqa formabeuaq formabeauq formabeaqu formaqbaue formaqbaeu formaqbuae formaqbuea formaqbeua
formaqbeau formaqabue formaqabeu formaqaube formaqaueb formaqaeub formaqaebu formaquabe formaquaeb formaqubae formaqubea
formaqueba formaqueab formaqeaub formaqeabu formaqeuab formaqeuba formaqebua formaqebau formaubqae formaubqea formaubaqe
formaubaeq formaubeaq formaubeqa formauqbae formauqbea formauqabe formauqaeb formauqeab formauqeba formauaqbe formauaqeb
formauabqe formauabeq formauaebq formauaeqb formaueqab formaueqba formaueaqb formaueabq formauebaq formauebqa formaebqua
formaebqau formaebuqa formaebuaq formaebauq formaebaqu formaeqbua formaeqbau formaequba formaequab formaeqaub formaeqabu
formaeuqba formaeuqab formaeubqa formaeubaq formaeuabq formaeuaqb formaeaqub formaeaqbu formaeauqb formaeaubq formaeabuq
formaeabqu formqaabue formqaabeu formqaaube formqaaueb formqaaeub formqaaebu formqabaue formqabaeu formqabuae formqabuea
formqabeua formqabeau formqaubae formqaubea formqauabe formqauaeb formqaueab formqaueba formqaebua formqaebau formqaeuba
formqaeuab formqaeaub formqaeabu formqaabue formqaabeu formqaaube formqaaueb formqaaeub formqaaebu formqabaue formqabaeu
formqabuae formqabuea formqabeua formqabeau formqaubae formqaubea formqauabe formqauaeb formqaueab formqaueba formqaebua
formqaebau formqaeuba formqaeuab formqaeaub formqaeabu formqbaaue formqbaaeu formqbauae formqbauea formqbaeua formqbaeau
formqbaaue formqbaaeu formqbauae formqbauea formqbaeua formqbaeau formqbuaae formqbuaea formqbuaae formqbuaea formqbueaa
formqbueaa formqbeaua formqbeaau formqbeuaa formqbeuaa formqbeaua formqbeaau formquabae formquabea formquaabe formquaaeb
formquaeab formquaeba formqubaae formqubaea formqubaae formqubaea formqubeaa formqubeaa formquabae formquabea formquaabe
formquaaeb formquaeab formquaeba formquebaa formquebaa formqueaba formqueaab formqueaab formqueaba formqeabua formqeabau
formqeauba formqeauab formqeaaub formqeaabu formqebaua formqebaau formqebuaa formqebuaa formqebaua formqebaau formqeubaa
formqeubaa formqeuaba formqeuaab formqeuaab formqeuaba formqeabua formqeabau formqeauba formqeauab formqeaaub formqeaabu
formuaaqbe formuaaqeb formuaabqe formuaabeq formuaaebq formuaaeqb formuaqabe formuaqaeb formuaqbae formuaqbea formuaqeba
formuaqeab formuabqae formuabqea formuabaqe formuabaeq formuabeaq formuabeqa formuaeqba formuaeqab formuaebqa formuaebaq
formuaeabq formuaeaqb formuaaqbe formuaaqeb formuaabqe formuaabeq formuaaebq formuaaeqb formuaqabe formuaqaeb formuaqbae
formuaqbea formuaqeba formuaqeab formuabqae formuabqea formuabaqe formuabaeq formuabeaq formuabeqa formuaeqba formuaeqab
formuaebqa formuaebaq formuaeabq formuaeaqb formuqaabe formuqaaeb formuqabae formuqabea formuqaeba formuqaeab formuqaabe
formuqaaeb formuqabae formuqabea formuqaeba formuqaeab formuqbaae formuqbaea formuqbaae formuqbaea formuqbeaa formuqbeaa
formuqeaba formuqeaab formuqebaa formuqebaa formuqeaba formuqeaab formubaqae formubaqea formubaaqe formubaaeq formubaeaq
formubaeqa formubqaae formubqaea formubqaae formubqaea formubqeaa formubqeaa formubaqae formubaqea formubaaqe formubaaeq
formubaeaq formubaeqa formubeqaa formubeqaa formubeaqa formubeaaq formubeaaq formubeaqa formueaqba formueaqab formueabqa
formueabaq formueaabq formueaaqb formueqaba formueqaab formueqbaa formueqbaa formueqaba formueqaab formuebqaa formuebqaa
formuebaqa formuebaaq formuebaaq formuebaqa formueaqba formueaqab formueabqa formueabaq formueaabq formueaaqb formeaaqub
formeaaqbu formeaauqb formeaaubq formeaabuq formeaabqu formeaqaub formeaqabu formeaquab formeaquba formeaqbua formeaqbau
formeauqab formeauqba formeauaqb formeauabq formeaubaq formeaubqa formeabqua formeabqau formeabuqa formeabuaq formeabauq
formeabaqu formeaaqub formeaaqbu formeaauqb formeaaubq formeaabuq formeaabqu formeaqaub formeaqabu formeaquab formeaquba
formeaqbua formeaqbau formeauqab formeauqba formeauaqb formeauabq formeaubaq formeaubqa formeabqua formeabqau formeabuqa
formeabuaq formeabauq formeabaqu formeqaaub formeqaabu formeqauab formeqauba formeqabua formeqabau formeqaaub formeqaabu
formeqauab formeqauba formeqabua formeqabau formequaab formequaba formequaab formequaba formequbaa formequbaa formeqbaua
formeqbaau formeqbuaa formeqbuaa formeqbaua formeqbaau formeuaqab formeuaqba formeuaaqb formeuaabq formeuabaq formeuabqa
formeuqaab formeuqaba formeuqaab formeuqaba formeuqbaa formeuqbaa formeuaqab formeuaqba formeuaaqb formeuaabq formeuabaq
formeuabqa formeubqaa formeubqaa formeubaqa formeubaaq formeubaaq formeubaqa formebaqua formebaqau formebauqa formebauaq
formebaauq formebaaqu formebqaua formebqaau formebquaa formebquaa formebqaua formebqaau formebuqaa formebuqaa formebuaqa
formebuaaq formebuaaq formebuaqa formebaqua formebaqau formebauqa formebauaq formebaauq formebaaqu forqbamaue forqbamaeu
forqbamuae forqbamuea forqbameua forqbameau forqbaamue forqbaameu forqbaaume forqbaauem forqbaaeum forqbaaemu forqbauame
forqbauaem forqbaumae forqbaumea forqbauema forqbaueam forqbaeaum forqbaeamu forqbaeuam forqbaeuma forqbaemua forqbaemau
forqbmaaue forqbmaaeu forqbmauae forqbmauea forqbmaeua forqbmaeau forqbmaaue forqbmaaeu forqbmauae forqbmauea forqbmaeua
forqbmaeau forqbmuaae forqbmuaea forqbmuaae forqbmuaea forqbmueaa forqbmueaa forqbmeaua forqbmeaau forqbmeuaa forqbmeuaa
forqbmeaua forqbmeaau forqbamaue forqbamaeu forqbamuae forqbamuea forqbameua forqbameau forqbaamue forqbaameu forqbaaume
forqbaauem forqbaaeum forqbaaemu forqbauame forqbauaem forqbaumae forqbaumea forqbauema forqbaueam forqbaeaum forqbaeamu
forqbaeuam forqbaeuma forqbaemua forqbaemau forqbumaae forqbumaea forqbumaae forqbumaea forqbumeaa forqbumeaa forqbuamae
forqbuamea forqbuaame forqbuaaem forqbuaeam forqbuaema forqbuaame forqbuaaem forqbuamae forqbuamea forqbuaema forqbuaeam
forqbueaam forqbueama forqbueaam forqbueama forqbuemaa forqbuemaa forqbemaua forqbemaau forqbemuaa forqbemuaa forqbemaua
forqbemaau forqbeamua forqbeamau forqbeauma forqbeauam forqbeaaum forqbeaamu forqbeuama forqbeuaam forqbeumaa forqbeumaa
forqbeuama forqbeuaam forqbeaaum forqbeaamu forqbeauam forqbeauma forqbeamua forqbeamau forqabmaue forqabmaeu forqabmuae
forqabmuea forqabmeua forqabmeau forqabamue forqabameu forqabaume forqabauem forqabaeum forqabaemu forqabuame forqabuaem
forqabumae forqabumea forqabuema forqabueam forqabeaum forqabeamu forqabeuam forqabeuma forqabemua forqabemau forqambaue
forqambaeu forqambuae forqambuea forqambeua forqambeau forqamabue forqamabeu forqamaube forqamaueb forqamaeub forqamaebu
forqamuabe forqamuaeb forqamubae forqamubea forqamueba forqamueab forqameaub forqameabu forqameuab forqameuba forqamebua
forqamebau forqaambue forqaambeu forqaamube forqaamueb forqaameub forqaamebu forqaabmue forqaabmeu forqaabume forqaabuem
forqaabeum forqaabemu forqaaubme forqaaubem forqaaumbe forqaaumeb forqaauemb forqaauebm forqaaebum forqaaebmu forqaaeubm
forqaaeumb forqaaemub forqaaembu forqaumabe forqaumaeb forqaumbae forqaumbea forqaumeba forqaumeab forqauambe forqauameb
forqauabme forqauabem forqauaebm forqauaemb forqaubame forqaubaem forqaubmae forqaubmea forqaubema forqaubeam forqaueabm
forqaueamb forqauebam forqauebma forqauemba forqauemab forqaemaub forqaemabu forqaemuab forqaemuba forqaembua forqaembau
forqaeamub forqaeambu forqaeaumb forqaeaubm forqaeabum forqaeabmu forqaeuamb forqaeuabm forqaeumab forqaeumba forqaeubma
forqaeubam forqaebaum forqaebamu forqaebuam forqaebuma forqaebmua forqaebmau forqmabaue forqmabaeu forqmabuae forqmabuea
forqmabeua forqmabeau forqmaabue forqmaabeu forqmaaube forqmaaueb forqmaaeub forqmaaebu forqmauabe forqmauaeb forqmaubae
forqmaubea forqmaueba forqmaueab forqmaeaub forqmaeabu forqmaeuab forqmaeuba forqmaebua forqmaebau forqmbaaue forqmbaaeu
forqmbauae forqmbauea forqmbaeua forqmbaeau forqmbaaue forqmbaaeu forqmbauae forqmbauea forqmbaeua forqmbaeau forqmbuaae
forqmbuaea forqmbuaae forqmbuaea forqmbueaa forqmbueaa forqmbeaua forqmbeaau forqmbeuaa forqmbeuaa forqmbeaua forqmbeaau
forqmabaue forqmabaeu forqmabuae forqmabuea forqmabeua forqmabeau forqmaabue forqmaabeu forqmaaube forqmaaueb forqmaaeub
forqmaaebu forqmauabe forqmauaeb forqmaubae forqmaubea forqmaueba forqmaueab forqmaeaub forqmaeabu forqmaeuab forqmaeuba
forqmaebua forqmaebau forqmubaae forqmubaea forqmubaae forqmubaea forqmubeaa forqmubeaa forqmuabae forqmuabea forqmuaabe
forqmuaaeb forqmuaeab forqmuaeba forqmuaabe forqmuaaeb forqmuabae forqmuabea forqmuaeba forqmuaeab forqmueaab forqmueaba
forqmueaab forqmueaba forqmuebaa forqmuebaa forqmebaua forqmebaau forqmebuaa forqmebuaa forqmebaua forqmebaau forqmeabua
forqmeabau forqmeauba forqmeauab forqmeaaub forqmeaabu forqmeuaba forqmeuaab forqmeubaa forqmeubaa forqmeuaba forqmeuaab
forqmeaaub forqmeaabu forqmeauab forqmeauba forqmeabua forqmeabau forqaambue forqaambeu forqaamube forqaamueb forqaameub
forqaamebu forqaabmue forqaabmeu forqaabume forqaabuem forqaabeum forqaabemu forqaaubme forqaaubem forqaaumbe forqaaumeb
forqaauemb forqaauebm forqaaebum forqaaebmu forqaaeubm forqaaeumb forqaaemub forqaaembu forqamabue forqamabeu forqamaube
forqamaueb forqamaeub forqamaebu forqambaue forqambaeu forqambuae forqambuea forqambeua forqambeau forqamubae forqamubea
forqamuabe forqamuaeb forqamueab forqamueba forqamebua forqamebau forqameuba forqameuab forqameaub forqameabu forqabmaue
forqabmaeu forqabmuae forqabmuea forqabmeua forqabmeau forqabamue forqabameu forqabaume forqabauem forqabaeum forqabaemu
forqabuame forqabuaem forqabumae forqabumea forqabuema forqabueam forqabeaum forqabeamu forqabeuam forqabeuma forqabemua
forqabemau forqaumbae forqaumbea forqaumabe forqaumaeb forqaumeab forqaumeba forqaubmae forqaubmea forqaubame forqaubaem
forqaubeam forqaubema forqauabme forqauabem forqauambe forqauameb forqauaemb forqauaebm forqauebam forqauebma forqaueabm
forqaueamb forqauemab forqauemba forqaembua forqaembau forqaemuba forqaemuab forqaemaub forqaemabu forqaebmua forqaebmau
forqaebuma forqaebuam forqaebaum forqaebamu forqaeubma forqaeubam forqaeumba forqaeumab forqaeuamb forqaeuabm forqaeabum
forqaeabmu forqaeaubm forqaeaumb forqaeamub forqaeambu forquamabe forquamaeb forquambae forquambea forquameba forquameab
forquaambe forquaameb forquaabme forquaabem forquaaebm forquaaemb forquabame forquabaem forquabmae forquabmea forquabema
forquabeam forquaeabm forquaeamb forquaebam forquaebma forquaemba forquaemab forqumaabe forqumaaeb forqumabae forqumabea
forqumaeba forqumaeab forqumaabe forqumaaeb forqumabae forqumabea forqumaeba forqumaeab forqumbaae forqumbaea forqumbaae
forqumbaea forqumbeaa forqumbeaa forqumeaba forqumeaab forqumebaa forqumebaa forqumeaba forqumeaab forquamabe forquamaeb
forquambae forquambea forquameba forquameab forquaambe forquaameb forquaabme forquaabem forquaaebm forquaaemb forquabame
forquabaem forquabmae forquabmea forquabema forquabeam forquaeabm forquaeamb forquaebam forquaebma forquaemba forquaemab
forqubmaae forqubmaea forqubmaae forqubmaea forqubmeaa forqubmeaa forqubamae forqubamea forqubaame forqubaaem forqubaeam
forqubaema forqubaame forqubaaem forqubamae forqubamea forqubaema forqubaeam forqubeaam forqubeama forqubeaam forqubeama
forqubemaa forqubemaa forquemaba forquemaab forquembaa forquembaa forquemaba forquemaab forqueamba forqueamab forqueabma
forqueabam forqueaabm forqueaamb forquebama forquebaam forquebmaa forquebmaa forquebama forquebaam forqueaabm forqueaamb
forqueabam forqueabma forqueamba forqueamab forqeamaub forqeamabu forqeamuab forqeamuba forqeambua forqeambau forqeaamub
forqeaambu forqeaaumb forqeaaubm forqeaabum forqeaabmu forqeauamb forqeauabm forqeaumab forqeaumba forqeaubma forqeaubam
forqeabaum forqeabamu forqeabuam forqeabuma forqeabmua forqeabmau forqemaaub forqemaabu forqemauab forqemauba forqemabua
forqemabau forqemaaub forqemaabu forqemauab forqemauba forqemabua forqemabau forqemuaab forqemuaba forqemuaab forqemuaba
forqemubaa forqemubaa forqembaua forqembaau forqembuaa forqembuaa forqembaua forqembaau forqeamaub forqeamabu forqeamuab
forqeamuba forqeambua forqeambau forqeaamub forqeaambu forqeaaumb forqeaaubm forqeaabum forqeaabmu forqeauamb forqeauabm
forqeaumab forqeaumba forqeaubma forqeaubam forqeabaum forqeabamu forqeabuam forqeabuma forqeabmua forqeabmau forqeumaab
forqeumaba forqeumaab forqeumaba forqeumbaa forqeumbaa forqeuamab forqeuamba forqeuaamb forqeuaabm forqeuabam forqeuabma
forqeuaamb forqeuaabm forqeuamab forqeuamba forqeuabma forqeuabam forqeubaam forqeubama forqeubaam forqeubama forqeubmaa
forqeubmaa forqebmaua forqebmaau forqebmuaa forqebmuaa forqebmaua forqebmaau forqebamua forqebamau forqebauma forqebauam
forqebaaum forqebaamu forqebuama forqebuaam forqebumaa forqebumaa forqebuama forqebuaam forqebaaum forqebaamu forqebauam
forqebauma forqebamua forqebamau forubamqae forubamqea forubamaqe forubamaeq forubameaq forubameqa forubaqmae forubaqmea
forubaqame forubaqaem forubaqeam forubaqema forubaaqme forubaaqem forubaamqe forubaameq forubaaemq forubaaeqm forubaeqam
forubaeqma forubaeaqm forubaeamq forubaemaq forubaemqa forubmaqae forubmaqea forubmaaqe forubmaaeq forubmaeaq forubmaeqa
forubmqaae forubmqaea forubmqaae forubmqaea forubmqeaa forubmqeaa forubmaqae forubmaqea forubmaaqe forubmaaeq forubmaeaq
forubmaeqa forubmeqaa forubmeqaa forubmeaqa forubmeaaq forubmeaaq forubmeaqa forubqmaae forubqmaea forubqmaae forubqmaea
forubqmeaa forubqmeaa forubqamae forubqamea forubqaame forubqaaem forubqaeam forubqaema forubqaame forubqaaem forubqamae
forubqamea forubqaema forubqaeam forubqeaam forubqeama forubqeaam forubqeama forubqemaa forubqemaa forubamqae forubamqea
forubamaqe forubamaeq forubameaq forubameqa forubaqmae forubaqmea forubaqame forubaqaem forubaqeam forubaqema forubaaqme
forubaaqem forubaamqe forubaameq forubaaemq forubaaeqm forubaeqam forubaeqma forubaeaqm forubaeamq forubaemaq forubaemqa
forubemqaa forubemqaa forubemaqa forubemaaq forubemaaq forubemaqa forubeqmaa forubeqmaa forubeqama forubeqaam forubeqaam
forubeqama forubeaqma forubeaqam forubeamqa forubeamaq forubeaamq forubeaaqm forubeaqam forubeaqma forubeaaqm forubeaamq
forubeamaq forubeamqa foruabmqae foruabmqea foruabmaqe foruabmaeq foruabmeaq foruabmeqa foruabqmae foruabqmea foruabqame
foruabqaem foruabqeam foruabqema foruabaqme foruabaqem foruabamqe foruabameq foruabaemq foruabaeqm foruabeqam foruabeqma
foruabeaqm foruabeamq foruabemaq foruabemqa foruambqae foruambqea foruambaqe foruambaeq foruambeaq foruambeqa foruamqbae
foruamqbea foruamqabe foruamqaeb foruamqeab foruamqeba foruamaqbe foruamaqeb foruamabqe foruamabeq foruamaebq foruamaeqb
foruameqab foruameqba foruameaqb foruameabq foruamebaq foruamebqa foruaqmbae foruaqmbea foruaqmabe foruaqmaeb foruaqmeab
foruaqmeba foruaqbmae foruaqbmea foruaqbame foruaqbaem foruaqbeam foruaqbema foruaqabme foruaqabem foruaqambe foruaqameb
foruaqaemb foruaqaebm foruaqebam foruaqebma foruaqeabm foruaqeamb foruaqemab foruaqemba foruaamqbe foruaamqeb foruaambqe
foruaambeq foruaamebq foruaameqb foruaaqmbe foruaaqmeb foruaaqbme foruaaqbem foruaaqebm foruaaqemb foruaabqme foruaabqem
foruaabmqe foruaabmeq foruaabemq foruaabeqm foruaaeqbm foruaaeqmb foruaaebqm foruaaebmq foruaaembq foruaaemqb foruaemqab
foruaemqba foruaemaqb foruaemabq foruaembaq foruaembqa foruaeqmab foruaeqmba foruaeqamb foruaeqabm foruaeqbam foruaeqbma
foruaeaqmb foruaeaqbm foruaeamqb foruaeambq foruaeabmq foruaeabqm foruaebqam foruaebqma foruaebaqm foruaebamq foruaebmaq
foruaebmqa forumabqae forumabqea forumabaqe forumabaeq forumabeaq forumabeqa forumaqbae forumaqbea forumaqabe forumaqaeb
forumaqeab forumaqeba forumaaqbe forumaaqeb forumaabqe forumaabeq forumaaebq forumaaeqb forumaeqab forumaeqba forumaeaqb
forumaeabq forumaebaq forumaebqa forumbaqae forumbaqea forumbaaqe forumbaaeq forumbaeaq forumbaeqa forumbqaae forumbqaea
forumbqaae forumbqaea forumbqeaa forumbqeaa forumbaqae forumbaqea forumbaaqe forumbaaeq forumbaeaq forumbaeqa forumbeqaa
forumbeqaa forumbeaqa forumbeaaq forumbeaaq forumbeaqa forumqbaae forumqbaea forumqbaae forumqbaea forumqbeaa forumqbeaa
forumqabae forumqabea forumqaabe forumqaaeb forumqaeab forumqaeba forumqaabe forumqaaeb forumqabae forumqabea forumqaeba
forumqaeab forumqeaab forumqeaba forumqeaab forumqeaba forumqebaa forumqebaa forumabqae forumabqea forumabaqe forumabaeq
forumabeaq forumabeqa forumaqbae forumaqbea forumaqabe forumaqaeb forumaqeab forumaqeba forumaaqbe forumaaqeb forumaabqe
forumaabeq forumaaebq forumaaeqb forumaeqab forumaeqba forumaeaqb forumaeabq forumaebaq forumaebqa forumebqaa forumebqaa
forumebaqa forumebaaq forumebaaq forumebaqa forumeqbaa forumeqbaa forumeqaba forumeqaab forumeqaab forumeqaba forumeaqba
forumeaqab forumeabqa forumeabaq forumeaabq forumeaaqb forumeaqab forumeaqba forumeaaqb forumeaabq forumeabaq forumeabqa
foruqambae foruqambea foruqamabe foruqamaeb foruqameab foruqameba foruqabmae foruqabmea foruqabame foruqabaem foruqabeam
foruqabema foruqaabme foruqaabem foruqaambe foruqaameb foruqaaemb foruqaaebm foruqaebam foruqaebma foruqaeabm foruqaeamb
foruqaemab foruqaemba foruqmabae foruqmabea foruqmaabe foruqmaaeb foruqmaeab foruqmaeba foruqmbaae foruqmbaea foruqmbaae
foruqmbaea foruqmbeaa foruqmbeaa foruqmabae foruqmabea foruqmaabe foruqmaaeb foruqmaeab foruqmaeba foruqmebaa foruqmebaa
foruqmeaba foruqmeaab foruqmeaab foruqmeaba foruqbmaae foruqbmaea foruqbmaae foruqbmaea foruqbmeaa foruqbmeaa foruqbamae
foruqbamea foruqbaame foruqbaaem foruqbaeam foruqbaema foruqbaame foruqbaaem foruqbamae foruqbamea foruqbaema foruqbaeam
foruqbeaam foruqbeama foruqbeaam foruqbeama foruqbemaa foruqbemaa foruqambae foruqambea foruqamabe foruqamaeb foruqameab
foruqameba foruqabmae foruqabmea foruqabame foruqabaem foruqabeam foruqabema foruqaabme foruqaabem foruqaambe foruqaameb
foruqaaemb foruqaaebm foruqaebam foruqaebma foruqaeabm foruqaeamb foruqaemab foruqaemba foruqembaa foruqembaa foruqemaba
foruqemaab foruqemaab foruqemaba foruqebmaa foruqebmaa foruqebama foruqebaam foruqebaam foruqebama foruqeabma foruqeabam
foruqeamba foruqeamab foruqeaamb foruqeaabm foruqeabam foruqeabma foruqeaabm foruqeaamb foruqeamab foruqeamba foruaamqbe
foruaamqeb foruaambqe foruaambeq foruaamebq foruaameqb foruaaqmbe foruaaqmeb foruaaqbme foruaaqbem foruaaqebm foruaaqemb
foruaabqme foruaabqem foruaabmqe foruaabmeq foruaabemq foruaabeqm foruaaeqbm foruaaeqmb foruaaebqm foruaaebmq foruaaembq
foruaaemqb foruamaqbe foruamaqeb foruamabqe foruamabeq foruamaebq foruamaeqb foruamqabe foruamqaeb foruamqbae foruamqbea
foruamqeba foruamqeab foruambqae foruambqea foruambaqe foruambaeq foruambeaq foruambeqa foruameqba foruameqab foruamebqa
foruamebaq foruameabq foruameaqb foruaqmabe foruaqmaeb foruaqmbae foruaqmbea foruaqmeba foruaqmeab foruaqambe foruaqameb
foruaqabme foruaqabem foruaqaebm foruaqaemb foruaqbame foruaqbaem foruaqbmae foruaqbmea foruaqbema foruaqbeam foruaqeabm
foruaqeamb foruaqebam foruaqebma foruaqemba foruaqemab foruabmqae foruabmqea foruabmaqe foruabmaeq foruabmeaq foruabmeqa
foruabqmae foruabqmea foruabqame foruabqaem foruabqeam foruabqema foruabaqme foruabaqem foruabamqe foruabameq foruabaemq
foruabaeqm foruabeqam foruabeqma foruabeaqm foruabeamq foruabemaq foruabemqa foruaemqba foruaemqab foruaembqa foruaembaq
foruaemabq foruaemaqb foruaeqmba foruaeqmab foruaeqbma foruaeqbam foruaeqabm foruaeqamb foruaebqma foruaebqam foruaebmqa
foruaebmaq foruaebamq foruaebaqm foruaeaqbm foruaeaqmb foruaeabqm foruaeabmq foruaeambq foruaeamqb forueamqab forueamqba
forueamaqb forueamabq forueambaq forueambqa forueaqmab forueaqmba forueaqamb forueaqabm forueaqbam forueaqbma forueaaqmb
forueaaqbm forueaamqb forueaambq forueaabmq forueaabqm forueabqam forueabqma forueabaqm forueabamq forueabmaq forueabmqa
foruemaqab foruemaqba foruemaaqb foruemaabq foruemabaq foruemabqa foruemqaab foruemqaba foruemqaab foruemqaba foruemqbaa
foruemqbaa foruemaqab foruemaqba foruemaaqb foruemaabq foruemabaq foruemabqa foruembqaa foruembqaa foruembaqa foruembaaq
foruembaaq foruembaqa forueqmaab forueqmaba forueqmaab forueqmaba forueqmbaa forueqmbaa forueqamab forueqamba forueqaamb
forueqaabm forueqabam forueqabma forueqaamb forueqaabm forueqamab forueqamba forueqabma forueqabam forueqbaam forueqbama
forueqbaam forueqbama forueqbmaa forueqbmaa forueamqab forueamqba forueamaqb forueamabq forueambaq forueambqa forueaqmab
forueaqmba forueaqamb forueaqabm forueaqbam forueaqbma forueaaqmb forueaaqbm forueaamqb forueaambq forueaabmq forueaabqm
forueabqam forueabqma forueabaqm forueabamq forueabmaq forueabmqa foruebmqaa foruebmqaa foruebmaqa foruebmaaq foruebmaaq
foruebmaqa foruebqmaa foruebqmaa foruebqama foruebqaam foruebqaam foruebqama foruebaqma foruebaqam foruebamqa foruebamaq
foruebaamq foruebaaqm foruebaqam foruebaqma foruebaaqm foruebaamq foruebamaq foruebamqa forebamqua forebamqau forebamuqa
forebamuaq forebamauq forebamaqu forebaqmua forebaqmau forebaquma forebaquam forebaqaum forebaqamu forebauqma forebauqam
forebaumqa forebaumaq forebauamq forebauaqm forebaaqum forebaaqmu forebaauqm forebaaumq forebaamuq forebaamqu forebmaqua
forebmaqau forebmauqa forebmauaq forebmaauq forebmaaqu forebmqaua forebmqaau forebmquaa forebmquaa forebmqaua forebmqaau
forebmuqaa forebmuqaa forebmuaqa forebmuaaq forebmuaaq forebmuaqa forebmaqua forebmaqau forebmauqa forebmauaq forebmaauq
forebmaaqu forebqmaua forebqmaau forebqmuaa forebqmuaa forebqmaua forebqmaau forebqamua forebqamau forebqauma forebqauam
forebqaaum forebqaamu forebquama forebquaam forebqumaa forebqumaa forebquama forebquaam forebqaaum forebqaamu forebqauam
forebqauma forebqamua forebqamau forebumqaa forebumqaa forebumaqa forebumaaq forebumaaq forebumaqa forebuqmaa forebuqmaa
forebuqama forebuqaam forebuqaam forebuqama forebuaqma forebuaqam forebuamqa forebuamaq forebuaamq forebuaaqm forebuaqam
forebuaqma forebuaaqm forebuaamq forebuamaq forebuamqa forebamqua forebamqau forebamuqa forebamuaq forebamauq forebamaqu
forebaqmua forebaqmau forebaquma forebaquam forebaqaum forebaqamu forebauqma forebauqam forebaumqa forebaumaq forebauamq
forebauaqm forebaaqum forebaaqmu forebaauqm forebaaumq forebaamuq forebaamqu foreabmqua foreabmqau foreabmuqa foreabmuaq
foreabmauq foreabmaqu foreabqmua foreabqmau foreabquma foreabquam foreabqaum foreabqamu foreabuqma foreabuqam foreabumqa
foreabumaq foreabuamq foreabuaqm foreabaqum foreabaqmu foreabauqm foreabaumq foreabamuq foreabamqu foreambqua foreambqau
foreambuqa foreambuaq foreambauq foreambaqu foreamqbua foreamqbau foreamquba foreamquab foreamqaub foreamqabu foreamuqba
foreamuqab foreamubqa foreamubaq foreamuabq foreamuaqb foreamaqub foreamaqbu foreamauqb foreamaubq foreamabuq foreamabqu
foreaqmbua foreaqmbau foreaqmuba foreaqmuab foreaqmaub foreaqmabu foreaqbmua foreaqbmau foreaqbuma foreaqbuam foreaqbaum
foreaqbamu foreaqubma foreaqubam foreaqumba foreaqumab foreaquamb foreaquabm foreaqabum foreaqabmu foreaqaubm foreaqaumb
foreaqamub foreaqambu foreaumqba foreaumqab foreaumbqa foreaumbaq foreaumabq foreaumaqb foreauqmba foreauqmab foreauqbma
foreauqbam foreauqabm foreauqamb foreaubqma foreaubqam foreaubmqa foreaubmaq foreaubamq foreaubaqm foreauaqbm foreauaqmb
foreauabqm foreauabmq foreauambq foreauamqb foreaamqub foreaamqbu foreaamuqb foreaamubq foreaambuq foreaambqu foreaaqmub
foreaaqmbu foreaaqumb foreaaqubm foreaaqbum foreaaqbmu foreaauqmb foreaauqbm foreaaumqb foreaaumbq foreaaubmq foreaaubqm
foreaabqum foreaabqmu foreaabuqm foreaabumq foreaabmuq foreaabmqu foremabqua foremabqau foremabuqa foremabuaq foremabauq
foremabaqu foremaqbua foremaqbau foremaquba foremaquab foremaqaub foremaqabu foremauqba foremauqab foremaubqa foremaubaq
foremauabq foremauaqb foremaaqub foremaaqbu foremaauqb foremaaubq foremaabuq foremaabqu forembaqua forembaqau forembauqa
forembauaq forembaauq forembaaqu forembqaua forembqaau forembquaa forembquaa forembqaua forembqaau forembuqaa forembuqaa
forembuaqa forembuaaq forembuaaq forembuaqa forembaqua forembaqau forembauqa forembauaq forembaauq forembaaqu foremqbaua
foremqbaau foremqbuaa foremqbuaa foremqbaua foremqbaau foremqabua foremqabau foremqauba foremqauab foremqaaub foremqaabu
foremquaba foremquaab foremqubaa foremqubaa foremquaba foremquaab foremqaaub foremqaabu foremqauab foremqauba foremqabua
foremqabau foremubqaa foremubqaa foremubaqa foremubaaq foremubaaq foremubaqa foremuqbaa foremuqbaa foremuqaba foremuqaab
foremuqaab foremuqaba foremuaqba foremuaqab foremuabqa foremuabaq foremuaabq foremuaaqb foremuaqab foremuaqba foremuaaqb
foremuaabq foremuabaq foremuabqa foremabqua foremabqau foremabuqa foremabuaq foremabauq foremabaqu foremaqbua foremaqbau
foremaquba foremaquab foremaqaub foremaqabu foremauqba foremauqab foremaubqa foremaubaq foremauabq foremauaqb foremaaqub
foremaaqbu foremaauqb foremaaubq foremaabuq foremaabqu foreqambua foreqambau foreqamuba foreqamuab foreqamaub foreqamabu
foreqabmua foreqabmau foreqabuma foreqabuam foreqabaum foreqabamu foreqaubma foreqaubam foreqaumba foreqaumab foreqauamb
foreqauabm foreqaabum foreqaabmu foreqaaubm foreqaaumb foreqaamub foreqaambu foreqmabua foreqmabau foreqmauba foreqmauab
foreqmaaub foreqmaabu foreqmbaua foreqmbaau foreqmbuaa foreqmbuaa foreqmbaua foreqmbaau foreqmubaa foreqmubaa foreqmuaba
foreqmuaab foreqmuaab foreqmuaba foreqmabua foreqmabau foreqmauba foreqmauab foreqmaaub foreqmaabu foreqbmaua foreqbmaau
foreqbmuaa foreqbmuaa foreqbmaua foreqbmaau foreqbamua foreqbamau foreqbauma foreqbauam foreqbaaum foreqbaamu foreqbuama
foreqbuaam foreqbumaa foreqbumaa foreqbuama foreqbuaam foreqbaaum foreqbaamu foreqbauam foreqbauma foreqbamua foreqbamau
forequmbaa forequmbaa forequmaba forequmaab forequmaab forequmaba forequbmaa forequbmaa forequbama forequbaam forequbaam
forequbama forequabma forequabam forequamba forequamab forequaamb forequaabm forequabam forequabma forequaabm forequaamb
forequamab forequamba foreqambua foreqambau foreqamuba foreqamuab foreqamaub foreqamabu foreqabmua foreqabmau foreqabuma
foreqabuam foreqabaum foreqabamu foreqaubma foreqaubam foreqaumba foreqaumab foreqauamb foreqauabm foreqaabum foreqaabmu
foreqaaubm foreqaaumb foreqaamub foreqaambu foreuamqba foreuamqab foreuambqa foreuambaq foreuamabq foreuamaqb foreuaqmba
foreuaqmab foreuaqbma foreuaqbam foreuaqabm foreuaqamb foreuabqma foreuabqam foreuabmqa foreuabmaq foreuabamq foreuabaqm
foreuaaqbm foreuaaqmb foreuaabqm foreuaabmq foreuaambq foreuaamqb foreumaqba foreumaqab foreumabqa foreumabaq foreumaabq
foreumaaqb foreumqaba foreumqaab foreumqbaa foreumqbaa foreumqaba foreumqaab foreumbqaa foreumbqaa foreumbaqa foreumbaaq
foreumbaaq foreumbaqa foreumaqba foreumaqab foreumabqa foreumabaq foreumaabq foreumaaqb foreuqmaba foreuqmaab foreuqmbaa
foreuqmbaa foreuqmaba foreuqmaab foreuqamba foreuqamab foreuqabma foreuqabam foreuqaabm foreuqaamb foreuqbama foreuqbaam
foreuqbmaa foreuqbmaa foreuqbama foreuqbaam foreuqaabm foreuqaamb foreuqabam foreuqabma foreuqamba foreuqamab foreubmqaa
foreubmqaa foreubmaqa foreubmaaq foreubmaaq foreubmaqa foreubqmaa foreubqmaa foreubqama foreubqaam foreubqaam foreubqama
foreubaqma foreubaqam foreubamqa foreubamaq foreubaamq foreubaaqm foreubaqam foreubaqma foreubaaqm foreubaamq foreubamaq
foreubamqa foreuamqba foreuamqab foreuambqa foreuambaq foreuamabq foreuamaqb foreuaqmba foreuaqmab foreuaqbma foreuaqbam
foreuaqabm foreuaqamb foreuabqma foreuabqam foreuabmqa foreuabmaq foreuabamq foreuabaqm foreuaaqbm foreuaaqmb foreuaabqm
foreuaabmq foreuaambq foreuaamqb foreaamqub foreaamqbu foreaamuqb foreaamubq foreaambuq foreaambqu foreaaqmub foreaaqmbu
foreaaqumb foreaaqubm foreaaqbum foreaaqbmu foreaauqmb foreaauqbm foreaaumqb foreaaumbq foreaaubmq foreaaubqm foreaabqum
foreaabqmu foreaabuqm foreaabumq foreaabmuq foreaabmqu foreamaqub foreamaqbu foreamauqb foreamaubq foreamabuq foreamabqu
foreamqaub foreamqabu foreamquab foreamquba foreamqbua foreamqbau foreamuqab foreamuqba foreamuaqb foreamuabq foreamubaq
foreamubqa foreambqua foreambqau foreambuqa foreambuaq foreambauq foreambaqu foreaqmaub foreaqmabu foreaqmuab foreaqmuba
foreaqmbua foreaqmbau foreaqamub foreaqambu foreaqaumb foreaqaubm foreaqabum foreaqabmu foreaquamb foreaquabm foreaqumab
foreaqumba foreaqubma foreaqubam foreaqbaum foreaqbamu foreaqbuam foreaqbuma foreaqbmua foreaqbmau foreaumqab foreaumqba
foreaumaqb foreaumabq foreaumbaq foreaumbqa foreauqmab foreauqmba foreauqamb foreauqabm foreauqbam foreauqbma foreauaqmb
foreauaqbm foreauamqb foreauambq foreauabmq foreauabqm foreaubqam foreaubqma foreaubaqm foreaubamq foreaubmaq foreaubmqa
foreabmqua foreabmqau foreabmuqa foreabmuaq foreabmauq foreabmaqu foreabqmua foreabqmau foreabquma foreabquam foreabqaum
foreabqamu foreabuqma foreabuqam foreabumqa foreabumaq foreabuamq foreabuaqm foreabaqum foreabaqmu foreabauqm foreabaumq
foreabamuq foreabamqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us