easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

engrasp

lastinger

adsiduusque

clugston

foedabamus

rogal

shoestring

quantivalence

succenturiation

deontology

exogyra

divulse

smear

quietnesses

nuntiaremusque

pflieger

pantaletted

jacqueline


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: flannels
cipher variations:
gmboofmt hncppgnu iodqqhov jperripw kqfssjqx
lrgttkry mshuulsz ntivvmta oujwwnub pvkxxovc
qwlyypwd rxmzzqxe synaaryf tzobbszg uapcctah
vbqddubi wcreevcj xdsffwdk yetggxel zfuhhyfm
agviizgn bhwjjaho cixkkbip djyllcjq ekzmmdkr

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: flannels
Cipher: uozmmvoh

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: flannels
Cipher: AABAB ABABA AAAAA ABBAA ABBAA AABAA ABABA BAAAB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: flannels
cipher variations:
gmboofmtqiboonidaeboovenkaboodaxuwboolwhesbootsrykboojkligboorgv
scboozcfcyboohypmuboopuzwqbooxqjhncppgnurjcppojebfcppwfolbcppeby
vxcppmxiftcpputszlcppklmjhcppshwtdcppadgdzcppizqnvcppqvaxrcppyrk
iodqqhovskdqqpkfcgdqqxgpmcdqqfczwydqqnyjgudqqvutamdqqlmnkidqqtix
uedqqbeheadqqjarowdqqrwbysdqqzsljperripwtlerrqlgdherryhqnderrgda
xzerrozkhverrwvubnerrmnoljerrujyvferrcfifberrkbspxerrsxczterratm
kqfssjqxumfssrmheifssziroefsshebyafsspaliwfssxwvcofssnopmkfssvkz
wgfssdgjgcfsslctqyfsstydaufssbunlrgttkryvngttsnifjgttajspfgttifc
zbgttqbmjxgttyxwdpgttopqnlgttwlaxhgttehkhdgttmdurzgttuzebvgttcvo
mshuulszwohuutojgkhuubktqghuujgdachuurcnkyhuuzyxeqhuupqromhuuxmb
yihuufiliehuunevsahuuvafcwhuudwpntivvmtaxpivvupkhlivvclurhivvkhe
bdivvsdolzivvazyfrivvqrspnivvynczjivvgjmjfivvofwtbivvwbgdxivvexq
oujwwnubyqjwwvqlimjwwdmvsijwwlifcejwwtepmajwwbazgsjwwrstqojwwzod
akjwwhknkgjwwpgxucjwwxcheyjwwfyrpvkxxovczrkxxwrmjnkxxenwtjkxxmjg
dfkxxufqnbkxxcbahtkxxsturpkxxapeblkxxilolhkxxqhyvdkxxydifzkxxgzs
qwlyypwdaslyyxsnkolyyfoxuklyynkheglyyvgroclyydcbiulyytuvsqlyybqf
cmlyyjmpmilyyrizwelyyzejgalyyhatrxmzzqxebtmzzytolpmzzgpyvlmzzoli
fhmzzwhspdmzzedcjvmzzuvwtrmzzcrgdnmzzknqnjmzzsjaxfmzzafkhbmzzibu
synaaryfcunaazupmqnaahqzwmnaapmjginaaxitqenaafedkwnaavwxusnaadsh
eonaaloroknaatkbygnaabglicnaajcvtzobbszgdvobbavqnrobbiraxnobbqnk
hjobbyjurfobbgfelxobbwxyvtobbetifpobbmpsplobbulczhobbchmjdobbkdw
uapcctahewpccbwrospccjsbyopccrolikpcczkvsgpcchgfmypccxyzwupccfuj
gqpccnqtqmpccvmdaipccdinkepcclexvbqddubifxqddcxsptqddktczpqddspm
jlqddalwthqddihgnzqddyzaxvqddgvkhrqddorurnqddwnebjqddejolfqddmfy
wcreevcjgyreedytqureeludaqreetqnkmreebmxuireejihoareezabywreehwl
isreepsvsoreexofckreefkpmgreengzxdsffwdkhzsffezurvsffmvebrsffuro
lnsffcnyvjsffkjipbsffabczxsffixmjtsffqtwtpsffypgdlsffglqnhsffoha
yetggxeliatggfavswtggnwfcstggvspmotggdozwktgglkjqctggbcdaytggjyn
kutggruxuqtggzqhemtgghmroitggpibzfuhhyfmjbuhhgbwtxuhhoxgdtuhhwtq
npuhhepaxluhhmlkrduhhcdebzuhhkzolvuhhsvyvruhharifnuhhinspjuhhqjc
agviizgnkcviihcxuyviipyheuviixuroqviifqbymviinmlseviidefcaviilap
mwviitwzwsviibsjgoviijotqkviirkdbhwjjaholdwjjidyvzwjjqzifvwjjyvs
prwjjgrcznwjjonmtfwjjefgdbwjjmbqnxwjjuxaxtwjjctkhpwjjkpurlwjjsle
cixkkbipmexkkjezwaxkkrajgwxkkzwtqsxkkhsdaoxkkponugxkkfghecxkkncr
oyxkkvybyuxkkduliqxkklqvsmxkktmfdjyllcjqnfyllkfaxbyllsbkhxyllaxu
rtyllitebpyllqpovhyllghifdyllodspzyllwzczvyllevmjryllmrwtnyllung
ekzmmdkrogzmmlgbyczmmtcliyzmmbyvsuzmmjufcqzmmrqpwizmmhijgezmmpet
qazmmxadawzmmfwnkszmmnsxuozmmvohflannelsphannmhczdannudmjzannczw
tvannkvgdrannsrqxjannijkhfannqfurbannybebxanngxoltannotyvpannwpi

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: flannels
Cipher: synaaryf

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: flannels
Cipher: 1213113333511334

Extended Methods:
Method #1

Plaintext: flannels
method variations:
lqfsskqxqvlxxpvcvaqccuahafvhhzfn

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
f l a n n e l s 
1 1 1 3 3 5 1 3 
2 3 1 3 3 1 3 4 
They are then read out in rows:
1113351323133134
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: flannels
Cipher: alxlmlcs

Read more ...
Method #3

Plaintext: flannels
method variations:
bclnxand clnxandb lnxandbc
nxandbcl xandbcln andbclnx
ndbclnxa dbclnxan

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: flannels

first 5040 cipher variations(40320 total)
flannels flannesl flannles flannlse flannsle flannsel flanenls flanensl flanelns flanelsn flanesln
flanesnl flanlens flanlesn flanlnes flanlnse flanlsne flanlsen flanseln flansenl flanslen flanslne
flansnle flansnel flannels flannesl flannles flannlse flannsle flannsel flanenls flanensl flanelns
flanelsn flanesln flanesnl flanlens flanlesn flanlnes flanlnse flanlsne flanlsen flanseln flansenl
flanslen flanslne flansnle flansnel flaennls flaennsl flaenlns flaenlsn flaensln flaensnl flaennls
flaennsl flaenlns flaenlsn flaensln flaensnl flaelnns flaelnsn flaelnns flaelnsn flaelsnn flaelsnn
flaesnln flaesnnl flaeslnn flaeslnn flaesnln flaesnnl flalnens flalnesn flalnnes flalnnse flalnsne
flalnsen flalenns flalensn flalenns flalensn flalesnn flalesnn flalnens flalnesn flalnnes flalnnse
flalnsne flalnsen flalsenn flalsenn flalsnen flalsnne flalsnne flalsnen flasneln flasnenl flasnlen
flasnlne flasnnle flasnnel flasenln flasennl flaselnn flaselnn flasenln flasennl flaslenn flaslenn
flaslnen flaslnne flaslnne flaslnen flasneln flasnenl flasnlen flasnlne flasnnle flasnnel flnanels
flnanesl flnanles flnanlse flnansle flnansel flnaenls flnaensl flnaelns flnaelsn flnaesln flnaesnl
flnalens flnalesn flnalnes flnalnse flnalsne flnalsen flnaseln flnasenl flnaslen flnaslne flnasnle
flnasnel flnnaels flnnaesl flnnales flnnalse flnnasle flnnasel flnneals flnneasl flnnelas flnnelsa
flnnesla flnnesal flnnleas flnnlesa flnnlaes flnnlase flnnlsae flnnlsea flnnsela flnnseal flnnslea
flnnslae flnnsale flnnsael flnenals flnenasl flnenlas flnenlsa flnensla flnensal flneanls flneansl
flnealns flnealsn flneasln flneasnl flnelans flnelasn flnelnas flnelnsa flnelsna flnelsan flnesaln
flnesanl flneslan flneslna flnesnla flnesnal flnlneas flnlnesa flnlnaes flnlnase flnlnsae flnlnsea
flnlenas flnlensa flnleans flnleasn flnlesan flnlesna flnlaens flnlaesn flnlanes flnlanse flnlasne
flnlasen flnlsean flnlsena flnlsaen flnlsane flnlsnae flnlsnea flnsnela flnsneal flnsnlea flnsnlae
flnsnale flnsnael flnsenla flnsenal flnselna flnselan flnsealn flnseanl flnslena flnslean flnslnea
flnslnae flnslane flnslaen flnsaeln flnsaenl flnsalen flnsalne flnsanle flnsanel flnnaels flnnaesl
flnnales flnnalse flnnasle flnnasel flnneals flnneasl flnnelas flnnelsa flnnesla flnnesal flnnleas
flnnlesa flnnlaes flnnlase flnnlsae flnnlsea flnnsela flnnseal flnnslea flnnslae flnnsale flnnsael
flnanels flnanesl flnanles flnanlse flnansle flnansel flnaenls flnaensl flnaelns flnaelsn flnaesln
flnaesnl flnalens flnalesn flnalnes flnalnse flnalsne flnalsen flnaseln flnasenl flnaslen flnaslne
flnasnle flnasnel flneanls flneansl flnealns flnealsn flneasln flneasnl flnenals flnenasl flnenlas
flnenlsa flnensla flnensal flnelnas flnelnsa flnelans flnelasn flnelsan flnelsna flnesnla flnesnal
flneslna flneslan flnesaln flnesanl flnlaens flnlaesn flnlanes flnlanse flnlasne flnlasen flnleans
flnleasn flnlenas flnlensa flnlesna flnlesan flnlneas flnlnesa flnlnaes flnlnase flnlnsae flnlnsea
flnlsena flnlsean flnlsnea flnlsnae flnlsane flnlsaen flnsaeln flnsaenl flnsalen flnsalne flnsanle
flnsanel flnsealn flnseanl flnselan flnselna flnsenla flnsenal flnslean flnslena flnslaen flnslane
flnslnae flnslnea flnsnela flnsneal flnsnlea flnsnlae flnsnale flnsnael flennals flennasl flennlas
flennlsa flennsla flennsal flenanls flenansl flenalns flenalsn flenasln flenasnl flenlans flenlasn
flenlnas flenlnsa flenlsna flenlsan flensaln flensanl flenslan flenslna flensnla flensnal flennals
flennasl flennlas flennlsa flennsla flennsal flenanls flenansl flenalns flenalsn flenasln flenasnl
flenlans flenlasn flenlnas flenlnsa flenlsna flenlsan flensaln flensanl flenslan flenslna flensnla
flensnal fleannls fleannsl fleanlns fleanlsn fleansln fleansnl fleannls fleannsl fleanlns fleanlsn
fleansln fleansnl flealnns flealnsn flealnns flealnsn flealsnn flealsnn fleasnln fleasnnl fleaslnn
fleaslnn fleasnln fleasnnl flelnans flelnasn flelnnas flelnnsa flelnsna flelnsan flelanns flelansn
flelanns flelansn flelasnn flelasnn flelnans flelnasn flelnnas flelnnsa flelnsna flelnsan flelsann
flelsann flelsnan flelsnna flelsnna flelsnan flesnaln flesnanl flesnlan flesnlna flesnnla flesnnal
flesanln flesannl flesalnn flesalnn flesanln flesannl fleslann fleslann fleslnan fleslnna fleslnna
fleslnan flesnaln flesnanl flesnlan flesnlna flesnnla flesnnal fllnneas fllnnesa fllnnaes fllnnase
fllnnsae fllnnsea fllnenas fllnensa fllneans fllneasn fllnesan fllnesna fllnaens fllnaesn fllnanes
fllnanse fllnasne fllnasen fllnsean fllnsena fllnsaen fllnsane fllnsnae fllnsnea fllnneas fllnnesa
fllnnaes fllnnase fllnnsae fllnnsea fllnenas fllnensa fllneans fllneasn fllnesan fllnesna fllnaens
fllnaesn fllnanes fllnanse fllnasne fllnasen fllnsean fllnsena fllnsaen fllnsane fllnsnae fllnsnea
fllennas fllennsa fllenans fllenasn fllensan fllensna fllennas fllennsa fllenans fllenasn fllensan
fllensna flleanns flleansn flleanns flleansn flleasnn flleasnn fllesnan fllesnna fllesann fllesann
fllesnan fllesnna fllanens fllanesn fllannes fllannse fllansne fllansen fllaenns fllaensn fllaenns
fllaensn fllaesnn fllaesnn fllanens fllanesn fllannes fllannse fllansne fllansen fllasenn fllasenn
fllasnen fllasnne fllasnne fllasnen fllsnean fllsnena fllsnaen fllsnane fllsnnae fllsnnea fllsenan
fllsenna fllseann fllseann fllsenan fllsenna fllsaenn fllsaenn fllsanen fllsanne fllsanne fllsanen
fllsnean fllsnena fllsnaen fllsnane fllsnnae fllsnnea flsnnela flsnneal flsnnlea flsnnlae flsnnale
flsnnael flsnenla flsnenal flsnelna flsnelan flsnealn flsneanl flsnlena flsnlean flsnlnea flsnlnae
flsnlane flsnlaen flsnaeln flsnaenl flsnalen flsnalne flsnanle flsnanel flsnnela flsnneal flsnnlea
flsnnlae flsnnale flsnnael flsnenla flsnenal flsnelna flsnelan flsnealn flsneanl flsnlena flsnlean
flsnlnea flsnlnae flsnlane flsnlaen flsnaeln flsnaenl flsnalen flsnalne flsnanle flsnanel flsennla
flsennal flsenlna flsenlan flsenaln flsenanl flsennla flsennal flsenlna flsenlan flsenaln flsenanl
flselnna flselnan flselnna flselnan flselann flselann flseanln flseannl flsealnn flsealnn flseanln
flseannl flslnena flslnean flslnnea flslnnae flslnane flslnaen flslenna flslenan flslenna flslenan
flsleann flsleann flslnena flslnean flslnnea flslnnae flslnane flslnaen flslaenn flslaenn flslanen
flslanne flslanne flslanen flsaneln flsanenl flsanlen flsanlne flsannle flsannel flsaenln flsaennl
flsaelnn flsaelnn flsaenln flsaennl flsalenn flsalenn flsalnen flsalnne flsalnne flsalnen flsaneln
flsanenl flsanlen flsanlne flsannle flsannel falnnels falnnesl falnnles falnnlse falnnsle falnnsel
falnenls falnensl falnelns falnelsn falnesln falnesnl falnlens falnlesn falnlnes falnlnse falnlsne
falnlsen falnseln falnsenl falnslen falnslne falnsnle falnsnel falnnels falnnesl falnnles falnnlse
falnnsle falnnsel falnenls falnensl falnelns falnelsn falnesln falnesnl falnlens falnlesn falnlnes
falnlnse falnlsne falnlsen falnseln falnsenl falnslen falnslne falnsnle falnsnel falennls falennsl
falenlns falenlsn falensln falensnl falennls falennsl falenlns falenlsn falensln falensnl falelnns
falelnsn falelnns falelnsn falelsnn falelsnn falesnln falesnnl faleslnn faleslnn falesnln falesnnl
fallnens fallnesn fallnnes fallnnse fallnsne fallnsen fallenns fallensn fallenns fallensn fallesnn
fallesnn fallnens fallnesn fallnnes fallnnse fallnsne fallnsen fallsenn fallsenn fallsnen fallsnne
fallsnne fallsnen falsneln falsnenl falsnlen falsnlne falsnnle falsnnel falsenln falsennl falselnn
falselnn falsenln falsennl falslenn falslenn falslnen falslnne falslnne falslnen falsneln falsnenl
falsnlen falsnlne falsnnle falsnnel fanlnels fanlnesl fanlnles fanlnlse fanlnsle fanlnsel fanlenls
fanlensl fanlelns fanlelsn fanlesln fanlesnl fanllens fanllesn fanllnes fanllnse fanllsne fanllsen
fanlseln fanlsenl fanlslen fanlslne fanlsnle fanlsnel fannlels fannlesl fannlles fannllse fannlsle
fannlsel fannells fannelsl fannells fannelsl fannesll fannesll fannlels fannlesl fannlles fannllse
fannlsle fannlsel fannsell fannsell fannslel fannslle fannslle fannslel fanenlls fanenlsl fanenlls
fanenlsl fanensll fanensll fanelnls fanelnsl fanellns fanellsn fanelsln fanelsnl fanellns fanellsn
fanelnls fanelnsl fanelsnl fanelsln faneslln faneslnl faneslln faneslnl fanesnll fanesnll fanlnels
fanlnesl fanlnles fanlnlse fanlnsle fanlnsel fanlenls fanlensl fanlelns fanlelsn fanlesln fanlesnl
fanllens fanllesn fanllnes fanllnse fanllsne fanllsen fanlseln fanlsenl fanlslen fanlslne fanlsnle
fanlsnel fansnell fansnell fansnlel fansnlle fansnlle fansnlel fansenll fansenll fanselnl fanselln
fanselln fanselnl fanslenl fansleln fanslnel fanslnle fansllne fansllen fansleln fanslenl fansllen
fansllne fanslnle fanslnel fannlels fannlesl fannlles fannllse fannlsle fannlsel fannells fannelsl
fannells fannelsl fannesll fannesll fannlels fannlesl fannlles fannllse fannlsle fannlsel fannsell
fannsell fannslel fannslle fannslle fannslel fanlnels fanlnesl fanlnles fanlnlse fanlnsle fanlnsel
fanlenls fanlensl fanlelns fanlelsn fanlesln fanlesnl fanllens fanllesn fanllnes fanllnse fanllsne
fanllsen fanlseln fanlsenl fanlslen fanlslne fanlsnle fanlsnel fanelnls fanelnsl fanellns fanellsn
fanelsln fanelsnl fanenlls fanenlsl fanenlls fanenlsl fanensll fanensll fanelnls fanelnsl fanellns
fanellsn fanelsln fanelsnl fanesnll fanesnll faneslnl faneslln faneslln faneslnl fanllens fanllesn
fanllnes fanllnse fanllsne fanllsen fanlelns fanlelsn fanlenls fanlensl fanlesnl fanlesln fanlnels
fanlnesl fanlnles fanlnlse fanlnsle fanlnsel fanlsenl fanlseln fanlsnel fanlsnle fanlslne fanlslen
fansleln fanslenl fansllen fansllne fanslnle fanslnel fanselln fanselnl fanselln fanselnl fansenll
fansenll fansleln fanslenl fansllen fansllne fanslnle fanslnel fansnell fansnell fansnlel fansnlle
fansnlle fansnlel faennlls faennlsl faennlls faennlsl faennsll faennsll faenlnls faenlnsl faenllns
faenllsn faenlsln faenlsnl faenllns faenllsn faenlnls faenlnsl faenlsnl faenlsln faenslln faenslnl
faenslln faenslnl faensnll faensnll faennlls faennlsl faennlls faennlsl faennsll faennsll faenlnls
faenlnsl faenllns faenllsn faenlsln faenlsnl faenllns faenllsn faenlnls faenlnsl faenlsnl faenlsln
faenslln faenslnl faenslln faenslnl faensnll faensnll faelnnls faelnnsl faelnlns faelnlsn faelnsln
faelnsnl faelnnls faelnnsl faelnlns faelnlsn faelnsln faelnsnl faellnns faellnsn faellnns faellnsn
faellsnn faellsnn faelsnln faelsnnl faelslnn faelslnn faelsnln faelsnnl faelnlns faelnlsn faelnnls
faelnnsl faelnsnl faelnsln faellnns faellnsn faellnns faellnsn faellsnn faellsnn faelnlns faelnlsn
faelnnls faelnnsl faelnsnl faelnsln faelslnn faelslnn faelsnln faelsnnl faelsnnl faelsnln faesnlln
faesnlnl faesnlln faesnlnl faesnnll faesnnll faeslnln faeslnnl faesllnn faesllnn faeslnln faeslnnl
faesllnn faesllnn faeslnln faeslnnl faeslnnl faeslnln faesnlln faesnlnl faesnlln faesnlnl faesnnll
faesnnll falnnels falnnesl falnnles falnnlse falnnsle falnnsel falnenls falnensl falnelns falnelsn
falnesln falnesnl falnlens falnlesn falnlnes falnlnse falnlsne falnlsen falnseln falnsenl falnslen
falnslne falnsnle falnsnel falnnels falnnesl falnnles falnnlse falnnsle falnnsel falnenls falnensl
falnelns falnelsn falnesln falnesnl falnlens falnlesn falnlnes falnlnse falnlsne falnlsen falnseln
falnsenl falnslen falnslne falnsnle falnsnel falennls falennsl falenlns falenlsn falensln falensnl
falennls falennsl falenlns falenlsn falensln falensnl falelnns falelnsn falelnns falelnsn falelsnn
falelsnn falesnln falesnnl faleslnn faleslnn falesnln falesnnl fallnens fallnesn fallnnes fallnnse
fallnsne fallnsen fallenns fallensn fallenns fallensn fallesnn fallesnn fallnens fallnesn fallnnes
fallnnse fallnsne fallnsen fallsenn fallsenn fallsnen fallsnne fallsnne fallsnen falsneln falsnenl
falsnlen falsnlne falsnnle falsnnel falsenln falsennl falselnn falselnn falsenln falsennl falslenn
falslenn falslnen falslnne falslnne falslnen falsneln falsnenl falsnlen falsnlne falsnnle falsnnel
fasnnell fasnnell fasnnlel fasnnlle fasnnlle fasnnlel fasnenll fasnenll fasnelnl fasnelln fasnelln
fasnelnl fasnlenl fasnleln fasnlnel fasnlnle fasnllne fasnllen fasnleln fasnlenl fasnllen fasnllne
fasnlnle fasnlnel fasnnell fasnnell fasnnlel fasnnlle fasnnlle fasnnlel fasnenll fasnenll fasnelnl
fasnelln fasnelln fasnelnl fasnlenl fasnleln fasnlnel fasnlnle fasnllne fasnllen fasnleln fasnlenl
fasnllen fasnllne fasnlnle fasnlnel fasennll fasennll fasenlnl fasenlln fasenlln fasenlnl fasennll
fasennll fasenlnl fasenlln fasenlln fasenlnl faselnnl faselnln faselnnl faselnln fasellnn fasellnn
faselnln faselnnl fasellnn fasellnn faselnln faselnnl faslnenl faslneln faslnnel faslnnle faslnlne
faslnlen faslennl faslenln faslennl faslenln faslelnn faslelnn faslnenl faslneln faslnnel faslnnle
faslnlne faslnlen fasllenn fasllenn fasllnen fasllnne fasllnne fasllnen faslneln faslnenl faslnlen
faslnlne faslnnle faslnnel faslenln faslennl faslelnn faslelnn faslenln faslennl fasllenn fasllenn
fasllnen fasllnne fasllnne fasllnen faslneln faslnenl faslnlen faslnlne faslnnle faslnnel fnalnels
fnalnesl fnalnles fnalnlse fnalnsle fnalnsel fnalenls fnalensl fnalelns fnalelsn fnalesln fnalesnl
fnallens fnallesn fnallnes fnallnse fnallsne fnallsen fnalseln fnalsenl fnalslen fnalslne fnalsnle
fnalsnel fnanlels fnanlesl fnanlles fnanllse fnanlsle fnanlsel fnanells fnanelsl fnanells fnanelsl
fnanesll fnanesll fnanlels fnanlesl fnanlles fnanllse fnanlsle fnanlsel fnansell fnansell fnanslel
fnanslle fnanslle fnanslel fnaenlls fnaenlsl fnaenlls fnaenlsl fnaensll fnaensll fnaelnls fnaelnsl
fnaellns fnaellsn fnaelsln fnaelsnl fnaellns fnaellsn fnaelnls fnaelnsl fnaelsnl fnaelsln fnaeslln
fnaeslnl fnaeslln fnaeslnl fnaesnll fnaesnll fnalnels fnalnesl fnalnles fnalnlse fnalnsle fnalnsel
fnalenls fnalensl fnalelns fnalelsn fnalesln fnalesnl fnallens fnallesn fnallnes fnallnse fnallsne
fnallsen fnalseln fnalsenl fnalslen fnalslne fnalsnle fnalsnel fnasnell fnasnell fnasnlel fnasnlle
fnasnlle fnasnlel fnasenll fnasenll fnaselnl fnaselln fnaselln fnaselnl fnaslenl fnasleln fnaslnel
fnaslnle fnasllne fnasllen fnasleln fnaslenl fnasllen fnasllne fnaslnle fnaslnel fnlanels fnlanesl
fnlanles fnlanlse fnlansle fnlansel fnlaenls fnlaensl fnlaelns fnlaelsn fnlaesln fnlaesnl fnlalens
fnlalesn fnlalnes fnlalnse fnlalsne fnlalsen fnlaseln fnlasenl fnlaslen fnlaslne fnlasnle fnlasnel
fnlnaels fnlnaesl fnlnales fnlnalse fnlnasle fnlnasel fnlneals fnlneasl fnlnelas fnlnelsa fnlnesla
fnlnesal fnlnleas fnlnlesa fnlnlaes fnlnlase fnlnlsae fnlnlsea fnlnsela fnlnseal fnlnslea fnlnslae
fnlnsale fnlnsael fnlenals fnlenasl fnlenlas fnlenlsa fnlensla fnlensal fnleanls fnleansl fnlealns
fnlealsn fnleasln fnleasnl fnlelans fnlelasn fnlelnas fnlelnsa fnlelsna fnlelsan fnlesaln fnlesanl
fnleslan fnleslna fnlesnla fnlesnal fnllneas fnllnesa fnllnaes fnllnase fnllnsae fnllnsea fnllenas
fnllensa fnlleans fnlleasn fnllesan fnllesna fnllaens fnllaesn fnllanes fnllanse fnllasne fnllasen
fnllsean fnllsena fnllsaen fnllsane fnllsnae fnllsnea fnlsnela fnlsneal fnlsnlea fnlsnlae fnlsnale
fnlsnael fnlsenla fnlsenal fnlselna fnlselan fnlsealn fnlseanl fnlslena fnlslean fnlslnea fnlslnae
fnlslane fnlslaen fnlsaeln fnlsaenl fnlsalen fnlsalne fnlsanle fnlsanel fnnlaels fnnlaesl fnnlales
fnnlalse fnnlasle fnnlasel fnnleals fnnleasl fnnlelas fnnlelsa fnnlesla fnnlesal fnnlleas fnnllesa
fnnllaes fnnllase fnnllsae fnnllsea fnnlsela fnnlseal fnnlslea fnnlslae fnnlsale fnnlsael fnnalels
fnnalesl fnnalles fnnallse fnnalsle fnnalsel fnnaells fnnaelsl fnnaells fnnaelsl fnnaesll fnnaesll
fnnalels fnnalesl fnnalles fnnallse fnnalsle fnnalsel fnnasell fnnasell fnnaslel fnnaslle fnnaslle
fnnaslel fnnealls fnnealsl fnnealls fnnealsl fnneasll fnneasll fnnelals fnnelasl fnnellas fnnellsa
fnnelsla fnnelsal fnnellas fnnellsa fnnelals fnnelasl fnnelsal fnnelsla fnneslla fnneslal fnneslla
fnneslal fnnesall fnnesall fnnlaels fnnlaesl fnnlales fnnlalse fnnlasle fnnlasel fnnleals fnnleasl
fnnlelas fnnlelsa fnnlesla fnnlesal fnnlleas fnnllesa fnnllaes fnnllase fnnllsae fnnllsea fnnlsela
fnnlseal fnnlslea fnnlslae fnnlsale fnnlsael fnnsaell fnnsaell fnnsalel fnnsalle fnnsalle fnnsalel
fnnseall fnnseall fnnselal fnnsella fnnsella fnnselal fnnsleal fnnslela fnnslael fnnslale fnnsllae
fnnsllea fnnslela fnnsleal fnnsllea fnnsllae fnnslale fnnslael fnelnals fnelnasl fnelnlas fnelnlsa
fnelnsla fnelnsal fnelanls fnelansl fnelalns fnelalsn fnelasln fnelasnl fnellans fnellasn fnellnas
fnellnsa fnellsna fnellsan fnelsaln fnelsanl fnelslan fnelslna fnelsnla fnelsnal fnenlals fnenlasl
fnenllas fnenllsa fnenlsla fnenlsal fnenalls fnenalsl fnenalls fnenalsl fnenasll fnenasll fnenlals
fnenlasl fnenllas fnenllsa fnenlsla fnenlsal fnensall fnensall fnenslal fnenslla fnenslla fnenslal
fneanlls fneanlsl fneanlls fneanlsl fneansll fneansll fnealnls fnealnsl fneallns fneallsn fnealsln
fnealsnl fneallns fneallsn fnealnls fnealnsl fnealsnl fnealsln fneaslln fneaslnl fneaslln fneaslnl
fneasnll fneasnll fnelnals fnelnasl fnelnlas fnelnlsa fnelnsla fnelnsal fnelanls fnelansl fnelalns
fnelalsn fnelasln fnelasnl fnellans fnellasn fnellnas fnellnsa fnellsna fnellsan fnelsaln fnelsanl
fnelslan fnelslna fnelsnla fnelsnal fnesnall fnesnall fnesnlal fnesnlla fnesnlla fnesnlal fnesanll
fnesanll fnesalnl fnesalln fnesalln fnesalnl fneslanl fneslaln fneslnal fneslnla fnesllna fnesllan
fneslaln fneslanl fnesllan fnesllna fneslnla fneslnal fnllneas fnllnesa fnllnaes fnllnase fnllnsae
fnllnsea fnllenas fnllensa fnlleans fnlleasn fnllesan fnllesna fnllaens fnllaesn fnllanes fnllanse
fnllasne fnllasen fnllsean fnllsena fnllsaen fnllsane fnllsnae fnllsnea fnlnleas fnlnlesa fnlnlaes
fnlnlase fnlnlsae fnlnlsea fnlnelas fnlnelsa fnlneals fnlneasl fnlnesal fnlnesla fnlnaels fnlnaesl
fnlnales fnlnalse fnlnasle fnlnasel fnlnseal fnlnsela fnlnsael fnlnsale fnlnslae fnlnslea fnlenlas
fnlenlsa fnlenals fnlenasl fnlensal fnlensla fnlelnas fnlelnsa fnlelans fnlelasn fnlelsan fnlelsna
fnlealns fnlealsn fnleanls fnleansl fnleasnl fnleasln fnleslan fnleslna fnlesaln fnlesanl fnlesnal
fnlesnla fnlanels fnlanesl fnlanles fnlanlse fnlansle fnlansel fnlaenls fnlaensl fnlaelns fnlaelsn
fnlaesln fnlaesnl fnlalens fnlalesn fnlalnes fnlalnse fnlalsne fnlalsen fnlaseln fnlasenl fnlaslen
fnlaslne fnlasnle fnlasnel fnlsneal fnlsnela fnlsnael fnlsnale fnlsnlae fnlsnlea fnlsenal fnlsenla
fnlseanl fnlsealn fnlselan fnlselna fnlsaenl fnlsaeln fnlsanel fnlsanle fnlsalne fnlsalen fnlslean
fnlslena fnlslaen fnlslane fnlslnae fnlslnea fnslnela fnslneal fnslnlea fnslnlae fnslnale fnslnael
fnslenla fnslenal fnslelna fnslelan fnslealn fnsleanl fnsllena fnsllean fnsllnea fnsllnae fnsllane
fnsllaen fnslaeln fnslaenl fnslalen fnslalne fnslanle fnslanel fnsnlela fnsnleal fnsnllea fnsnllae
fnsnlale fnsnlael fnsnella fnsnelal fnsnella fnsnelal fnsneall fnsneall fnsnlela fnsnleal fnsnllea
fnsnllae fnsnlale fnsnlael fnsnaell fnsnaell fnsnalel fnsnalle fnsnalle fnsnalel fnsenlla fnsenlal
fnsenlla fnsenlal fnsenall fnsenall fnselnla fnselnal fnsellna fnsellan fnselaln fnselanl fnsellna
fnsellan fnselnla fnselnal fnselanl fnselaln fnsealln fnsealnl fnsealln fnsealnl fnseanll fnseanll
fnslnela fnslneal fnslnlea fnslnlae fnslnale fnslnael fnslenla fnslenal fnslelna fnslelan fnslealn
fnsleanl fnsllena fnsllean fnsllnea fnsllnae fnsllane fnsllaen fnslaeln fnslaenl fnslalen fnslalne
fnslanle fnslanel fnsanell fnsanell fnsanlel fnsanlle fnsanlle fnsanlel fnsaenll fnsaenll fnsaelnl
fnsaelln fnsaelln fnsaelnl fnsalenl fnsaleln fnsalnel fnsalnle fnsallne fnsallen fnsaleln fnsalenl
fnsallen fnsallne fnsalnle fnsalnel fnanlels fnanlesl fnanlles fnanllse fnanlsle fnanlsel fnanells
fnanelsl fnanells fnanelsl fnanesll fnanesll fnanlels fnanlesl fnanlles fnanllse fnanlsle fnanlsel
fnansell fnansell fnanslel fnanslle fnanslle fnanslel fnalnels fnalnesl fnalnles fnalnlse fnalnsle
fnalnsel fnalenls fnalensl fnalelns fnalelsn fnalesln fnalesnl fnallens fnallesn fnallnes fnallnse
fnallsne fnallsen fnalseln fnalsenl fnalslen fnalslne fnalsnle fnalsnel fnaelnls fnaelnsl fnaellns
fnaellsn fnaelsln fnaelsnl fnaenlls fnaenlsl fnaenlls fnaenlsl fnaensll fnaensll fnaelnls fnaelnsl
fnaellns fnaellsn fnaelsln fnaelsnl fnaesnll fnaesnll fnaeslnl fnaeslln fnaeslln fnaeslnl fnallens
fnallesn fnallnes fnallnse fnallsne fnallsen fnalelns fnalelsn fnalenls fnalensl fnalesnl fnalesln
fnalnels fnalnesl fnalnles fnalnlse fnalnsle fnalnsel fnalsenl fnalseln fnalsnel fnalsnle fnalslne
fnalslen fnasleln fnaslenl fnasllen fnasllne fnaslnle fnaslnel fnaselln fnaselnl fnaselln fnaselnl
fnasenll fnasenll fnasleln fnaslenl fnasllen fnasllne fnaslnle fnaslnel fnasnell fnasnell fnasnlel
fnasnlle fnasnlle fnasnlel fnnalels fnnalesl fnnalles fnnallse fnnalsle fnnalsel fnnaells fnnaelsl
fnnaells fnnaelsl fnnaesll fnnaesll fnnalels fnnalesl fnnalles fnnallse fnnalsle fnnalsel fnnasell
fnnasell fnnaslel fnnaslle fnnaslle fnnaslel fnnlaels fnnlaesl fnnlales fnnlalse fnnlasle fnnlasel
fnnleals fnnleasl fnnlelas fnnlelsa fnnlesla fnnlesal fnnlleas fnnllesa fnnllaes fnnllase fnnllsae
fnnllsea fnnlsela fnnlseal fnnlslea fnnlslae fnnlsale fnnlsael fnnelals fnnelasl fnnellas fnnellsa
fnnelsla fnnelsal fnnealls fnnealsl fnnealls fnnealsl fnneasll fnneasll fnnelals fnnelasl fnnellas
fnnellsa fnnelsla fnnelsal fnnesall fnnesall fnneslal fnneslla fnneslla fnneslal fnnlleas fnnllesa
fnnllaes fnnllase fnnllsae fnnllsea fnnlelas fnnlelsa fnnleals fnnleasl fnnlesal fnnlesla fnnlaels
fnnlaesl fnnlales fnnlalse fnnlasle fnnlasel fnnlseal fnnlsela fnnlsael fnnlsale fnnlslae fnnlslea
fnnslela fnnsleal fnnsllea fnnsllae fnnslale fnnslael fnnsella fnnselal fnnsella fnnselal fnnseall
fnnseall fnnslela fnnsleal fnnsllea fnnsllae fnnslale fnnslael fnnsaell fnnsaell fnnsalel fnnsalle
fnnsalle fnnsalel fnlnaels fnlnaesl fnlnales fnlnalse fnlnasle fnlnasel fnlneals fnlneasl fnlnelas
fnlnelsa fnlnesla fnlnesal fnlnleas fnlnlesa fnlnlaes fnlnlase fnlnlsae fnlnlsea fnlnsela fnlnseal
fnlnslea fnlnslae fnlnsale fnlnsael fnlanels fnlanesl fnlanles fnlanlse fnlansle fnlansel fnlaenls
fnlaensl fnlaelns fnlaelsn fnlaesln fnlaesnl fnlalens fnlalesn fnlalnes fnlalnse fnlalsne fnlalsen
fnlaseln fnlasenl fnlaslen fnlaslne fnlasnle fnlasnel fnleanls fnleansl fnlealns fnlealsn fnleasln
fnleasnl fnlenals fnlenasl fnlenlas fnlenlsa fnlensla fnlensal fnlelnas fnlelnsa fnlelans fnlelasn
fnlelsan fnlelsna fnlesnla fnlesnal fnleslna fnleslan fnlesaln fnlesanl fnllaens fnllaesn fnllanes
fnllanse fnllasne fnllasen fnlleans fnlleasn fnllenas fnllensa fnllesna fnllesan fnllneas fnllnesa
fnllnaes fnllnase fnllnsae fnllnsea fnllsena fnllsean fnllsnea fnllsnae fnllsane fnllsaen fnlsaeln
fnlsaenl fnlsalen fnlsalne fnlsanle fnlsanel fnlsealn fnlseanl fnlselan fnlselna fnlsenla fnlsenal
fnlslean fnlslena fnlslaen fnlslane fnlslnae fnlslnea fnlsnela fnlsneal fnlsnlea fnlsnlae fnlsnale
fnlsnael fnenlals fnenlasl fnenllas fnenllsa fnenlsla fnenlsal fnenalls fnenalsl fnenalls fnenalsl
fnenasll fnenasll fnenlals fnenlasl fnenllas fnenllsa fnenlsla fnenlsal fnensall fnensall fnenslal
fnenslla fnenslla fnenslal fnelnals fnelnasl fnelnlas fnelnlsa fnelnsla fnelnsal fnelanls fnelansl
fnelalns fnelalsn fnelasln fnelasnl fnellans fnellasn fnellnas fnellnsa fnellsna fnellsan fnelsaln
fnelsanl fnelslan fnelslna fnelsnla fnelsnal fnealnls fnealnsl fneallns fneallsn fnealsln fnealsnl
fneanlls fneanlsl fneanlls fneanlsl fneansll fneansll fnealnls fnealnsl fneallns fneallsn fnealsln
fnealsnl fneasnll fneasnll fneaslnl fneaslln fneaslln fneaslnl fnellans fnellasn fnellnas fnellnsa
fnellsna fnellsan fnelalns fnelalsn fnelanls fnelansl fnelasnl fnelasln fnelnals fnelnasl fnelnlas
fnelnlsa fnelnsla fnelnsal fnelsanl fnelsaln fnelsnal fnelsnla fnelslna fnelslan fneslaln fneslanl
fnesllan fnesllna fneslnla fneslnal fnesalln fnesalnl fnesalln fnesalnl fnesanll fnesanll fneslaln
fneslanl fnesllan fnesllna fneslnla fneslnal fnesnall fnesnall fnesnlal fnesnlla fnesnlla fnesnlal
fnlnleas fnlnlesa fnlnlaes fnlnlase fnlnlsae fnlnlsea fnlnelas fnlnelsa fnlneals fnlneasl fnlnesal
fnlnesla fnlnaels fnlnaesl fnlnales fnlnalse fnlnasle fnlnasel fnlnseal fnlnsela fnlnsael fnlnsale
fnlnslae fnlnslea fnllneas fnllnesa fnllnaes fnllnase fnllnsae fnllnsea fnllenas fnllensa fnlleans
fnlleasn fnllesan fnllesna fnllaens fnllaesn fnllanes fnllanse fnllasne fnllasen fnllsean fnllsena
fnllsaen fnllsane fnllsnae fnllsnea fnlelnas fnlelnsa fnlelans fnlelasn fnlelsan fnlelsna fnlenlas
fnlenlsa fnlenals fnlenasl fnlensal fnlensla fnleanls fnleansl fnlealns fnlealsn fnleasln fnleasnl
fnlesnal fnlesnla fnlesanl fnlesaln fnleslan fnleslna fnlalens fnlalesn fnlalnes fnlalnse fnlalsne
fnlalsen fnlaelns fnlaelsn fnlaenls fnlaensl fnlaesnl fnlaesln fnlanels fnlanesl fnlanles fnlanlse
fnlansle fnlansel fnlasenl fnlaseln fnlasnel fnlasnle fnlaslne fnlaslen fnlslean fnlslena fnlslaen
fnlslane fnlslnae fnlslnea fnlselan fnlselna fnlsealn fnlseanl fnlsenal fnlsenla fnlsaeln fnlsaenl
fnlsalen fnlsalne fnlsanle fnlsanel fnlsneal fnlsnela fnlsnael fnlsnale fnlsnlae fnlsnlea fnsnlela
fnsnleal fnsnllea fnsnllae fnsnlale fnsnlael fnsnella fnsnelal fnsnella fnsnelal fnsneall fnsneall
fnsnlela fnsnleal fnsnllea fnsnllae fnsnlale fnsnlael fnsnaell fnsnaell fnsnalel fnsnalle fnsnalle
fnsnalel fnslnela fnslneal fnslnlea fnslnlae fnslnale fnslnael fnslenla fnslenal fnslelna fnslelan
fnslealn fnsleanl fnsllena fnsllean fnsllnea fnsllnae fnsllane fnsllaen fnslaeln fnslaenl fnslalen
fnslalne fnslanle fnslanel fnselnla fnselnal fnsellna fnsellan fnselaln fnselanl fnsenlla fnsenlal
fnsenlla fnsenlal fnsenall fnsenall fnselnla fnselnal fnsellna fnsellan fnselaln fnselanl fnseanll
fnseanll fnsealnl fnsealln fnsealln fnsealnl fnsllena fnsllean fnsllnea fnsllnae fnsllane fnsllaen
fnslelna fnslelan fnslenla fnslenal fnsleanl fnslealn fnslnela fnslneal fnslnlea fnslnlae fnslnale
fnslnael fnslaenl fnslaeln fnslanel fnslanle fnslalne fnslalen fnsaleln fnsalenl fnsallen fnsallne
fnsalnle fnsalnel fnsaelln fnsaelnl fnsaelln fnsaelnl fnsaenll fnsaenll fnsaleln fnsalenl fnsallen
fnsallne fnsalnle fnsalnel fnsanell fnsanell fnsanlel fnsanlle fnsanlle fnsanlel feannlls feannlsl
feannlls feannlsl feannsll feannsll feanlnls feanlnsl feanllns feanllsn feanlsln feanlsnl feanllns
feanllsn feanlnls feanlnsl feanlsnl feanlsln feanslln feanslnl feanslln feanslnl feansnll feansnll
feannlls feannlsl feannlls feannlsl feannsll feannsll feanlnls feanlnsl feanllns feanllsn feanlsln
feanlsnl feanllns feanllsn feanlnls feanlnsl feanlsnl feanlsln feanslln feanslnl feanslln feanslnl
feansnll feansnll fealnnls fealnnsl fealnlns fealnlsn fealnsln fealnsnl fealnnls fealnnsl fealnlns
fealnlsn fealnsln fealnsnl feallnns feallnsn feallnns feallnsn feallsnn feallsnn fealsnln fealsnnl
fealslnn fealslnn fealsnln fealsnnl fealnlns fealnlsn fealnnls fealnnsl fealnsnl fealnsln feallnns
feallnsn feallnns feallnsn feallsnn feallsnn fealnlns fealnlsn fealnnls fealnnsl fealnsnl fealnsln
fealslnn fealslnn fealsnln fealsnnl fealsnnl fealsnln feasnlln feasnlnl feasnlln feasnlnl feasnnll
feasnnll feaslnln feaslnnl feasllnn feasllnn feaslnln feaslnnl feasllnn feasllnn feaslnln feaslnnl
feaslnnl feaslnln feasnlln feasnlnl feasnlln feasnlnl feasnnll feasnnll fenanlls fenanlsl fenanlls
fenanlsl fenansll fenansll fenalnls fenalnsl fenallns fenallsn fenalsln fenalsnl fenallns fenallsn
fenalnls fenalnsl fenalsnl fenalsln fenaslln fenaslnl fenaslln fenaslnl fenasnll fenasnll fennalls
fennalsl fennalls fennalsl fennasll fennasll fennlals fennlasl fennllas fennllsa fennlsla fennlsal
fennllas fennllsa fennlals fennlasl fennlsal fennlsla fennslla fennslal fennslla fennslal fennsall
fennsall fenlnals fenlnasl fenlnlas fenlnlsa fenlnsla fenlnsal fenlanls fenlansl fenlalns fenlalsn
fenlasln fenlasnl fenllans fenllasn fenllnas fenllnsa fenllsna fenllsan fenlsaln fenlsanl fenlslan
fenlslna fenlsnla fenlsnal fenlnlas fenlnlsa fenlnals fenlnasl fenlnsal fenlnsla fenllnas fenllnsa
fenllans fenllasn fenllsan fenllsna fenlalns fenlalsn fenlanls fenlansl fenlasnl fenlasln fenlslan
fenlslna fenlsaln fenlsanl fenlsnal fenlsnla fensnlla fensnlal fensnlla fensnlal fensnall fensnall
fenslnla fenslnal fensllna fensllan fenslaln fenslanl fensllna fensllan fenslnla fenslnal fenslanl
fenslaln fensalln fensalnl fensalln fensalnl fensanll fensanll fennalls fennalsl fennalls fennalsl
fennasll fennasll fennlals fennlasl fennllas fennllsa fennlsla fennlsal fennllas fennllsa fennlals
fennlasl fennlsal fennlsla fennslla fennslal fennslla fennslal fennsall fennsall fenanlls fenanlsl
fenanlls fenanlsl fenansll fenansll fenalnls fenalnsl fenallns fenallsn fenalsln fenalsnl fenallns
fenallsn fenalnls fenalnsl fenalsnl fenalsln fenaslln fenaslnl fenaslln fenaslnl fenasnll fenasnll
fenlanls fenlansl fenlalns fenlalsn fenlasln fenlasnl fenlnals fenlnasl fenlnlas fenlnlsa fenlnsla
fenlnsal fenllnas fenllnsa fenllans fenllasn fenllsan fenllsna fenlsnla fenlsnal fenlslna fenlslan
fenlsaln fenlsanl fenlalns fenlalsn fenlanls fenlansl fenlasnl fenlasln fenllans fenllasn fenllnas
fenllnsa fenllsna fenllsan fenlnlas fenlnlsa fenlnals fenlnasl fenlnsal fenlnsla fenlslna fenlslan
fenlsnla fenlsnal fenlsanl fenlsaln fensalln fensalnl fensalln fensalnl fensanll fensanll fenslaln
fenslanl fensllan fensllna fenslnla fenslnal fensllan fensllna fenslaln fenslanl fenslnal fenslnla
fensnlla fensnlal fensnlla fensnlal fensnall fensnall felnnals felnnasl felnnlas felnnlsa felnnsla
felnnsal felnanls felnansl felnalns felnalsn felnasln felnasnl felnlans felnlasn felnlnas felnlnsa
felnlsna felnlsan felnsaln felnsanl felnslan felnslna felnsnla felnsnal felnnals felnnasl felnnlas
felnnlsa felnnsla felnnsal felnanls felnansl felnalns felnalsn felnasln felnasnl felnlans felnlasn
felnlnas felnlnsa felnlsna felnlsan felnsaln felnsanl felnslan felnslna felnsnla felnsnal felannls
felannsl felanlns felanlsn felansln felansnl felannls felannsl felanlns felanlsn felansln felansnl
felalnns felalnsn felalnns felalnsn felalsnn felalsnn felasnln felasnnl felaslnn felaslnn felasnln
felasnnl fellnans fellnasn fellnnas fellnnsa fellnsna fellnsan fellanns fellansn fellanns fellansn
fellasnn fellasnn fellnans fellnasn fellnnas fellnnsa fellnsna fellnsan fellsann fellsann fellsnan
fellsnna fellsnna fellsnan felsnaln felsnanl felsnlan felsnlna felsnnla felsnnal felsanln felsannl
felsalnn felsalnn felsanln felsannl felslann felslann felslnan felslnna felslnna felslnan felsnaln
felsnanl felsnlan felsnlna felsnnla felsnnal felnnlas felnnlsa felnnals felnnasl felnnsal felnnsla
felnlnas felnlnsa felnlans felnlasn felnlsan felnlsna felnalns felnalsn felnanls felnansl felnasnl
felnasln felnslan felnslna felnsaln felnsanl felnsnal felnsnla felnnlas felnnlsa felnnals felnnasl
felnnsal felnnsla felnlnas felnlnsa felnlans felnlasn felnlsan felnlsna felnalns felnalsn felnanls
felnansl felnasnl felnasln felnslan felnslna felnsaln felnsanl felnsnal felnsnla fellnnas fellnnsa
fellnans fellnasn fellnsan fellnsna fellnnas fellnnsa fellnans fellnasn fellnsan fellnsna fellanns
fellansn fellanns fellansn fellasnn fellasnn fellsnan fellsnna fellsann fellsann fellsnan fellsnna
felanlns felanlsn felannls felannsl felansnl felansln felalnns felalnsn felalnns felalnsn felalsnn
felalsnn felanlns felanlsn felannls felannsl felansnl felansln felaslnn felaslnn felasnln felasnnl
felasnnl felasnln felsnlan felsnlna felsnaln felsnanl felsnnal felsnnla felslnan felslnna felslann
felslann felslnan felslnna felsalnn felsalnn felsanln felsannl felsannl felsanln felsnlan felsnlna
felsnaln felsnanl felsnnal felsnnla fesnnlla fesnnlal fesnnlla fesnnlal fesnnall fesnnall fesnlnla
fesnlnal fesnllna fesnllan fesnlaln fesnlanl fesnllna fesnllan fesnlnla fesnlnal fesnlanl fesnlaln
fesnalln fesnalnl fesnalln fesnalnl fesnanll fesnanll fesnnlla fesnnlal fesnnlla fesnnlal fesnnall
fesnnall fesnlnla fesnlnal fesnllna fesnllan fesnlaln fesnlanl fesnllna fesnllan fesnlnla fesnlnal
fesnlanl fesnlaln fesnalln fesnalnl fesnalln fesnalnl fesnanll fesnanll feslnnla feslnnal feslnlna
feslnlan feslnaln feslnanl feslnnla feslnnal feslnlna feslnlan feslnaln feslnanl fesllnna fesllnan
fesllnna fesllnan fesllann fesllann feslanln feslannl feslalnn feslalnn feslanln feslannl feslnlna
feslnlan feslnnla feslnnal feslnanl feslnaln fesllnna fesllnan fesllnna fesllnan fesllann fesllann
feslnlna feslnlan feslnnla feslnnal feslnanl feslnaln feslalnn feslalnn feslanln feslannl feslannl
feslanln fesanlln fesanlnl fesanlln fesanlnl fesannll fesannll fesalnln fesalnnl fesallnn fesallnn
fesalnln fesalnnl fesallnn fesallnn fesalnln fesalnnl fesalnnl fesalnln fesanlln fesanlnl fesanlln
fesanlnl fesannll fesannll flannels flannesl flannles flannlse flannsle flannsel flanenls flanensl
flanelns flanelsn flanesln flanesnl flanlens flanlesn flanlnes flanlnse flanlsne flanlsen flanseln
flansenl flanslen flanslne flansnle flansnel flannels flannesl flannles flannlse flannsle flannsel
flanenls flanensl flanelns flanelsn flanesln flanesnl flanlens flanlesn flanlnes flanlnse flanlsne
flanlsen flanseln flansenl flanslen flanslne flansnle flansnel flaennls flaennsl flaenlns flaenlsn
flaensln flaensnl flaennls flaennsl flaenlns flaenlsn flaensln flaensnl flaelnns flaelnsn flaelnns
flaelnsn flaelsnn flaelsnn flaesnln flaesnnl flaeslnn flaeslnn flaesnln flaesnnl flalnens flalnesn
flalnnes flalnnse flalnsne flalnsen flalenns flalensn flalenns flalensn flalesnn flalesnn flalnens
flalnesn flalnnes flalnnse flalnsne flalnsen flalsenn flalsenn flalsnen flalsnne flalsnne flalsnen
flasneln flasnenl flasnlen flasnlne flasnnle flasnnel flasenln flasennl flaselnn flaselnn flasenln
flasennl flaslenn flaslenn flaslnen flaslnne flaslnne flaslnen flasneln flasnenl flasnlen flasnlne
flasnnle flasnnel flnanels flnanesl flnanles flnanlse flnansle flnansel flnaenls flnaensl flnaelns
flnaelsn flnaesln flnaesnl flnalens flnalesn flnalnes flnalnse flnalsne flnalsen flnaseln flnasenl
flnaslen flnaslne flnasnle flnasnel flnnaels flnnaesl flnnales flnnalse flnnasle flnnasel flnneals
flnneasl flnnelas flnnelsa flnnesla flnnesal flnnleas flnnlesa flnnlaes flnnlase flnnlsae flnnlsea
flnnsela flnnseal flnnslea flnnslae flnnsale flnnsael flnenals flnenasl flnenlas flnenlsa flnensla
flnensal flneanls flneansl flnealns flnealsn flneasln flneasnl flnelans flnelasn flnelnas flnelnsa
flnelsna flnelsan flnesaln flnesanl flneslan flneslna flnesnla flnesnal flnlneas flnlnesa flnlnaes
flnlnase flnlnsae flnlnsea flnlenas flnlensa flnleans flnleasn flnlesan flnlesna flnlaens flnlaesn
flnlanes flnlanse flnlasne flnlasen flnlsean flnlsena flnlsaen flnlsane flnlsnae flnlsnea flnsnela
flnsneal flnsnlea flnsnlae flnsnale flnsnael flnsenla flnsenal flnselna flnselan flnsealn flnseanl
flnslena flnslean flnslnea flnslnae flnslane flnslaen flnsaeln flnsaenl flnsalen flnsalne flnsanle
flnsanel flnnaels flnnaesl flnnales flnnalse flnnasle flnnasel flnneals flnneasl flnnelas flnnelsa
flnnesla flnnesal flnnleas flnnlesa flnnlaes flnnlase flnnlsae flnnlsea flnnsela flnnseal flnnslea
flnnslae flnnsale flnnsael flnanels flnanesl flnanles flnanlse flnansle flnansel flnaenls flnaensl
flnaelns flnaelsn flnaesln flnaesnl flnalens flnalesn flnalnes flnalnse flnalsne flnalsen flnaseln
flnasenl flnaslen flnaslne flnasnle flnasnel flneanls flneansl flnealns flnealsn flneasln flneasnl
flnenals flnenasl flnenlas flnenlsa flnensla flnensal flnelnas flnelnsa flnelans flnelasn flnelsan
flnelsna flnesnla flnesnal flneslna flneslan flnesaln flnesanl flnlaens flnlaesn flnlanes flnlanse
flnlasne flnlasen flnleans flnleasn flnlenas flnlensa flnlesna flnlesan flnlneas flnlnesa flnlnaes
flnlnase flnlnsae flnlnsea flnlsena flnlsean flnlsnea flnlsnae flnlsane flnlsaen flnsaeln flnsaenl
flnsalen flnsalne flnsanle flnsanel flnsealn flnseanl flnselan flnselna flnsenla flnsenal flnslean
flnslena flnslaen flnslane flnslnae flnslnea flnsnela flnsneal flnsnlea flnsnlae flnsnale flnsnael
flennals flennasl flennlas flennlsa flennsla flennsal flenanls flenansl flenalns flenalsn flenasln
flenasnl flenlans flenlasn flenlnas flenlnsa flenlsna flenlsan flensaln flensanl flenslan flenslna
flensnla flensnal flennals flennasl flennlas flennlsa flennsla flennsal flenanls flenansl flenalns
flenalsn flenasln flenasnl flenlans flenlasn flenlnas flenlnsa flenlsna flenlsan flensaln flensanl
flenslan flenslna flensnla flensnal fleannls fleannsl fleanlns fleanlsn fleansln fleansnl fleannls
fleannsl fleanlns fleanlsn fleansln fleansnl flealnns flealnsn flealnns flealnsn flealsnn flealsnn
fleasnln fleasnnl fleaslnn fleaslnn fleasnln fleasnnl flelnans flelnasn flelnnas flelnnsa flelnsna
flelnsan flelanns flelansn flelanns flelansn flelasnn flelasnn flelnans flelnasn flelnnas flelnnsa
flelnsna flelnsan flelsann flelsann flelsnan flelsnna flelsnna flelsnan flesnaln flesnanl flesnlan
flesnlna flesnnla flesnnal flesanln flesannl flesalnn flesalnn flesanln flesannl fleslann fleslann
fleslnan fleslnna fleslnna fleslnan flesnaln flesnanl flesnlan flesnlna flesnnla flesnnal fllnneas
fllnnesa fllnnaes fllnnase fllnnsae fllnnsea fllnenas fllnensa fllneans fllneasn fllnesan fllnesna
fllnaens fllnaesn fllnanes fllnanse fllnasne fllnasen fllnsean fllnsena fllnsaen fllnsane fllnsnae
fllnsnea fllnneas fllnnesa fllnnaes fllnnase fllnnsae fllnnsea fllnenas fllnensa fllneans fllneasn
fllnesan fllnesna fllnaens fllnaesn fllnanes fllnanse fllnasne fllnasen fllnsean fllnsena fllnsaen
fllnsane fllnsnae fllnsnea fllennas fllennsa fllenans fllenasn fllensan fllensna fllennas fllennsa
fllenans fllenasn fllensan fllensna flleanns flleansn flleanns flleansn flleasnn flleasnn fllesnan
fllesnna fllesann fllesann fllesnan fllesnna fllanens fllanesn fllannes fllannse fllansne fllansen
fllaenns fllaensn fllaenns fllaensn fllaesnn fllaesnn fllanens fllanesn fllannes fllannse fllansne
fllansen fllasenn fllasenn fllasnen fllasnne fllasnne fllasnen fllsnean fllsnena fllsnaen fllsnane
fllsnnae fllsnnea fllsenan fllsenna fllseann fllseann fllsenan fllsenna fllsaenn fllsaenn fllsanen
fllsanne fllsanne fllsanen fllsnean fllsnena fllsnaen fllsnane fllsnnae fllsnnea flsnnela flsnneal
flsnnlea flsnnlae flsnnale flsnnael flsnenla flsnenal flsnelna flsnelan flsnealn flsneanl flsnlena
flsnlean flsnlnea flsnlnae flsnlane flsnlaen flsnaeln flsnaenl flsnalen flsnalne flsnanle flsnanel
flsnnela flsnneal flsnnlea flsnnlae flsnnale flsnnael flsnenla flsnenal flsnelna flsnelan flsnealn
flsneanl flsnlena flsnlean flsnlnea flsnlnae flsnlane flsnlaen flsnaeln flsnaenl flsnalen flsnalne
flsnanle flsnanel flsennla flsennal flsenlna flsenlan flsenaln flsenanl flsennla flsennal flsenlna
flsenlan flsenaln flsenanl flselnna flselnan flselnna flselnan flselann flselann flseanln flseannl
flsealnn flsealnn flseanln flseannl flslnena flslnean flslnnea flslnnae flslnane flslnaen flslenna
flslenan flslenna flslenan flsleann flsleann flslnena flslnean flslnnea flslnnae flslnane flslnaen
flslaenn flslaenn flslanen flslanne flslanne flslanen flsaneln flsanenl flsanlen flsanlne flsannle
flsannel flsaenln flsaennl flsaelnn flsaelnn flsaenln flsaennl flsalenn flsalenn flsalnen flsalnne
flsalnne flsalnen flsaneln flsanenl flsanlen flsanlne flsannle flsannel fsannell fsannell fsannlel
fsannlle fsannlle fsannlel fsanenll fsanenll fsanelnl fsanelln fsanelln fsanelnl fsanlenl fsanleln
fsanlnel fsanlnle fsanllne fsanllen fsanleln fsanlenl fsanllen fsanllne fsanlnle fsanlnel fsannell
fsannell fsannlel fsannlle fsannlle fsannlel fsanenll fsanenll fsanelnl fsanelln fsanelln fsanelnl
fsanlenl fsanleln fsanlnel fsanlnle fsanllne fsanllen fsanleln fsanlenl fsanllen fsanllne fsanlnle
fsanlnel fsaennll fsaennll fsaenlnl fsaenlln fsaenlln fsaenlnl fsaennll fsaennll fsaenlnl fsaenlln
fsaenlln fsaenlnl fsaelnnl fsaelnln fsaelnnl fsaelnln fsaellnn fsaellnn fsaelnln fsaelnnl fsaellnn
fsaellnn fsaelnln fsaelnnl fsalnenl fsalneln fsalnnel fsalnnle fsalnlne fsalnlen fsalennl fsalenln
fsalennl fsalenln fsalelnn fsalelnn fsalnenl fsalneln fsalnnel fsalnnle fsalnlne fsalnlen fsallenn
fsallenn fsallnen fsallnne fsallnne fsallnen fsalneln fsalnenl fsalnlen fsalnlne fsalnnle fsalnnel
fsalenln fsalennl fsalelnn fsalelnn fsalenln fsalennl fsallenn fsallenn fsallnen fsallnne fsallnne
fsallnen fsalneln fsalnenl fsalnlen fsalnlne fsalnnle fsalnnel fsnanell fsnanell fsnanlel fsnanlle
fsnanlle fsnanlel fsnaenll fsnaenll fsnaelnl fsnaelln fsnaelln fsnaelnl fsnalenl fsnaleln fsnalnel
fsnalnle fsnallne fsnallen fsnaleln fsnalenl fsnallen fsnallne fsnalnle fsnalnel fsnnaell fsnnaell
fsnnalel fsnnalle fsnnalle fsnnalel fsnneall fsnneall fsnnelal fsnnella fsnnella fsnnelal fsnnleal
fsnnlela fsnnlael fsnnlale fsnnllae fsnnllea fsnnlela fsnnleal fsnnllea fsnnllae fsnnlale fsnnlael
fsnenall fsnenall fsnenlal fsnenlla fsnenlla fsnenlal fsneanll fsneanll fsnealnl fsnealln fsnealln
fsnealnl fsnelanl fsnelaln fsnelnal fsnelnla fsnellna fsnellan fsnelaln fsnelanl fsnellan fsnellna
fsnelnla fsnelnal fsnlneal fsnlnela fsnlnael fsnlnale fsnlnlae fsnlnlea fsnlenal fsnlenla fsnleanl
fsnlealn fsnlelan fsnlelna fsnlaenl fsnlaeln fsnlanel fsnlanle fsnlalne fsnlalen fsnllean fsnllena
fsnllaen fsnllane fsnllnae fsnllnea fsnlnela fsnlneal fsnlnlea fsnlnlae fsnlnale fsnlnael fsnlenla
fsnlenal fsnlelna fsnlelan fsnlealn fsnleanl fsnllena fsnllean fsnllnea fsnllnae fsnllane fsnllaen
fsnlaeln fsnlaenl fsnlalen fsnlalne fsnlanle fsnlanel fsnnaell fsnnaell fsnnalel fsnnalle fsnnalle
fsnnalel fsnneall fsnneall fsnnelal fsnnella fsnnella fsnnelal fsnnleal fsnnlela fsnnlael fsnnlale
fsnnllae fsnnllea fsnnlela fsnnleal fsnnllea fsnnllae fsnnlale fsnnlael fsnanell fsnanell fsnanlel
fsnanlle fsnanlle fsnanlel fsnaenll fsnaenll fsnaelnl fsnaelln fsnaelln fsnaelnl fsnalenl fsnaleln
fsnalnel fsnalnle fsnallne fsnallen fsnaleln fsnalenl fsnallen fsnallne fsnalnle fsnalnel fsneanll
fsneanll fsnealnl fsnealln fsnealln fsnealnl fsnenall fsnenall fsnenlal fsnenlla fsnenlla fsnenlal
fsnelnal fsnelnla fsnelanl fsnelaln fsnellan fsnellna fsnelnla fsnelnal fsnellna fsnellan fsnelaln
fsnelanl fsnlaenl fsnlaeln fsnlanel fsnlanle fsnlalne fsnlalen fsnleanl fsnlealn fsnlenal fsnlenla
fsnlelna fsnlelan fsnlneal fsnlnela fsnlnael fsnlnale fsnlnlae fsnlnlea fsnllena fsnllean fsnllnea
fsnllnae fsnllane fsnllaen fsnlaeln fsnlaenl fsnlalen fsnlalne fsnlanle fsnlanel fsnlealn fsnleanl
fsnlelan fsnlelna fsnlenla fsnlenal fsnllean fsnllena fsnllaen fsnllane fsnllnae fsnllnea fsnlnela
fsnlneal fsnlnlea fsnlnlae fsnlnale fsnlnael fsennall fsennall fsennlal fsennlla fsennlla fsennlal
fsenanll fsenanll fsenalnl fsenalln fsenalln fsenalnl fsenlanl fsenlaln fsenlnal fsenlnla fsenllna
fsenllan fsenlaln fsenlanl fsenllan fsenllna fsenlnla fsenlnal fsennall fsennall fsennlal fsennlla
fsennlla fsennlal fsenanll fsenanll fsenalnl fsenalln fsenalln fsenalnl fsenlanl fsenlaln fsenlnal
fsenlnla fsenllna fsenllan fsenlaln fsenlanl fsenllan fsenllna fsenlnla fsenlnal fseannll fseannll
fseanlnl fseanlln fseanlln fseanlnl fseannll fseannll fseanlnl fseanlln fseanlln fseanlnl fsealnnl
fsealnln fsealnnl fsealnln fseallnn fseallnn fsealnln fsealnnl fseallnn fseallnn fsealnln fsealnnl
fselnanl fselnaln fselnnal fselnnla fselnlna fselnlan fselannl fselanln fselannl fselanln fselalnn
fselalnn fselnanl fselnaln fselnnal fselnnla fselnlna fselnlan fsellann fsellann fsellnan fsellnna
fsellnna fsellnan fselnaln fselnanl fselnlan fselnlna fselnnla fselnnal fselanln fselannl fselalnn
fselalnn fselanln fselannl fsellann fsellann fsellnan fsellnna fsellnna fsellnan fselnaln fselnanl
fselnlan fselnlna fselnnla fselnnal fslnneal fslnnela fslnnael fslnnale fslnnlae fslnnlea fslnenal
fslnenla fslneanl fslnealn fslnelan fslnelna fslnaenl fslnaeln fslnanel fslnanle fslnalne fslnalen
fslnlean fslnlena fslnlaen fslnlane fslnlnae fslnlnea fslnneal fslnnela fslnnael fslnnale fslnnlae
fslnnlea fslnenal fslnenla fslneanl fslnealn fslnelan fslnelna fslnaenl fslnaeln fslnanel fslnanle
fslnalne fslnalen fslnlean fslnlena fslnlaen fslnlane fslnlnae fslnlnea fslennal fslennla fslenanl
fslenaln fslenlan fslenlna fslennal fslennla fslenanl fslenaln fslenlan fslenlna fsleannl fsleanln
fsleannl fsleanln fslealnn fslealnn fslelnan fslelnna fslelann fslelann fslelnan fslelnna fslanenl
fslaneln fslannel fslannle fslanlne fslanlen fslaennl fslaenln fslaennl fslaenln fslaelnn fslaelnn
fslanenl fslaneln fslannel fslannle fslanlne fslanlen fslalenn fslalenn fslalnen fslalnne fslalnne
fslalnen fsllnean fsllnena fsllnaen fsllnane fsllnnae fsllnnea fsllenan fsllenna fslleann fslleann
fsllenan fsllenna fsllaenn fsllaenn fsllanen fsllanne fsllanne fsllanen fsllnean fsllnena fsllnaen
fsllnane fsllnnae fsllnnea fslnnela fslnneal fslnnlea fslnnlae fslnnale fslnnael fslnenla fslnenal
fslnelna fslnelan fslnealn fslneanl fslnlena fslnlean fslnlnea fslnlnae fslnlane fslnlaen fslnaeln
fslnaenl fslnalen fslnalne fslnanle fslnanel fslnnela fslnneal fslnnlea fslnnlae fslnnale fslnnael
fslnenla fslnenal fslnelna fslnelan fslnealn fslneanl fslnlena fslnlean fslnlnea fslnlnae fslnlane
fslnlaen fslnaeln fslnaenl fslnalen fslnalne fslnanle fslnanel fslennla fslennal fslenlna fslenlan
fslenaln fslenanl fslennla fslennal fslenlna fslenlan fslenaln fslenanl fslelnna fslelnan fslelnna
fslelnan fslelann fslelann fsleanln fsleannl fslealnn fslealnn fsleanln fsleannl fsllnena fsllnean
fsllnnea fsllnnae fsllnane fsllnaen fsllenna fsllenan fsllenna fsllenan fslleann fslleann fsllnena
fsllnean fsllnnea fsllnnae fsllnane fsllnaen fsllaenn fsllaenn fsllanen fsllanne fsllanne fsllanen
fslaneln fslanenl fslanlen fslanlne fslannle fslannel fslaenln fslaennl fslaelnn fslaelnn fslaenln
fslaennl fslalenn fslalenn fslalnen fslalnne fslalnne fslalnen fslaneln fslanenl fslanlen fslanlne
fslannle fslannel

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us