easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

fruhbeck

suprahyoid

interruptions

indented

imperitantis

forweend

stickley

rubik

monjakov

furtimque

cartilagineous

rolle

fimple

compluribus

munires

aminoacetone

dromos

interfrontal


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: extremusque
cipher variations:
fyusfnvtrvf gzvtgowuswg hawuhpxvtxh ibxviqywuyi jcywjrzxvzj
kdzxksaywak leayltbzxbl mfbzmucaycm ngcanvdbzdn ohdbowecaeo
piecpxfdbfp qjfdqygecgq rkgerzhfdhr slhfsaigeis tmigtbjhfjt
unjhuckigku vokivdljhlv wpljwemkimw xqmkxfnljnx yrnlygomkoy
zsomzhpnlpz atpnaiqomqa buqobjrpnrb cvrpcksqosc dwsqdltrptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: extremusque
Cipher: vcgivnfhjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: extremusque
Cipher: AABAA BABAB BAABA BAAAA AABAA ABABB BAABB BAAAB ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: extremusque
cipher variations:
fyusfnvtrvfnsganljdxjnvmsivjxndxvdgeqdhlxjldlaqylfzhpzltucgtdnrvntjiawjzplhpjrcmerxdvndr
zwymzvrftrzhqkuhtfpzfhpkwcprtzftpxeikxphjlhxgzvtgowuswgothbomkeykowntjwkyoeywehfreimykme
mbrzmgaiqamuvdhueoswoukjbxkaqmiqksdnfsyewoesaxznawsgusairlviugqagiqlxdqsuaguqyfjlyqikmiy
hawuhpxvtxhpuicpnlfzlpxoukxlzpfzxfigsfjnzlnfncsanhbjrbnvweivfptxpvlkcylbrnjrlteogtzfxpft
byaobxthvtbjsmwjvhrbhjrmyertvbhvrzgkmzrjlnjzibxviqywuyiqvjdqomgamqypvlymaqgaygjhtgkoamog
odtboickscowxfjwgquyqwmldzmcsoksmufphuagyqguczbpcyuiwucktnxkwisciksnzfsuwciwsahlnaskmoka
jcywjrzxvzjrwkerpnhbnrzqwmznbrhbzhkiuhlpbnphpeucpjdltdpxygkxhrvzrxnmeandtpltnvgqivbhzrhv
dacqdzvjxvdluoylxjtdjltoagtvxdjxtbimobtlnplbkdzxksaywaksxlfsqoicosarxnaocsicailjvimqcoqi
qfvdqkemueqyzhlyiswasyonfboeuqmuowhrjwciasiwebdreawkywemvpzmykuekmupbhuwyekyucjnpcumoqmc
leayltbzxbltymgtrpjdptbsyobpdtjdbjmkwjnrdprjrgwerlfnvfrzaimzjtxbtzpogcpfvrnvpxiskxdjbtjx
fcesfbxlzxfnwqanzlvflnvqcivxzflzvdkoqdvnprndmfbzmucaycmuznhusqkequctzpcqeukecknlxkoseqsk
shxfsmgowgsabjnakuycuaqphdqgwsowqyjtlyekcukygdftgcymaygoxrboamwgmowrdjwyagmawelprewoqsoe
ngcanvdbzdnvaoivtrlfrvduaqdrfvlfdlomylptfrtltiygtnhpxhtbckoblvzdvbrqierhxtpxrzkumzfldvlz
heguhdznbzhpyscpbnxhnpxsekxzbhnbxfmqsfxprtpfohdbowecaeowbpjwusmgswevbresgwmgempnzmqugsum
ujzhuoiqyiucdlpcmwaewcsrjfsiyuqysalvnagmewmaifhvieaocaiqztdqcoyioqytflyaciocygnrtgyqsuqg
piecpxfdbfpxcqkxvtnhtxfwcsfthxnhfnqoanrvhtvnvkaivpjrzjvdemqdnxbfxdtskgtjzvrztbmwobhnfxnb
jgiwjfbpdbjrauerdpzjprzugmzbdjpdzhosuhzrtvrhqjfdqygecgqydrlywuoiuygxdtguiyoigorpboswiuwo
wlbjwqksakwefnreoycgyeutlhukawsaucnxpciogyockhjxkgcqecksbvfseqakqsavhnacekqeaiptviasuwsi
rkgerzhfdhrzesmzxvpjvzhyeuhvjzpjhpsqcptxjvxpxmckxrltblxfgosfpzdhzfvumivlbxtbvdoyqdjphzpd
likylhdrfdltcwgtfrblrtbwiobdflrfbjquwjbtvxtjslhfsaigeisaftnaywqkwaizfviwkaqkiqtrdquykwyq
yndlysmucmyghptgqaeiagwvnjwmcyucwepzrekqiaqemjlzmiesgemudxhugscmsucxjpcegmsgckrvxkcuwyuk
tmigtbjhfjtbguobzxrlxbjagwjxlbrljruservzlxzrzoemztnvdnzhiquhrbfjbhxwokxndzvdxfqasflrjbrf
nkmanjfthfnveyivhtdntvdykqdfhnthdlswyldvxzvlunjhuckigkuchvpcaysmyckbhxkymcsmksvtfswamyas
apfnauoweoaijrviscgkciyxplyoeaweygrbtgmskcsgolnbokguigowfzjwiueouwezlregiouiemtxzmewyawm
vokivdljhlvdiwqdbztnzdlciylzndtnltwugtxbnzbtbqgobvpxfpbjkswjtdhldjzyqmzpfbxfzhscuhntldth
pmocplhvjhpxgakxjvfpvxfamsfhjpvjfnuyanfxzbxnwpljwemkimwejxrecauoaemdjzmaoeuomuxvhuycoacu
crhpcwqygqckltxkueimekazrnaqgcygaitdvioumeuiqnpdqmiwkiqyhblykwgqwygbntgikqwkgovzbogyacyo
xqmkxfnljnxfkysfdbvpbfnekanbpfvpnvywivzdpbdvdsiqdxrzhrdlmuylvfjnflbasobrhdzhbjuewjpvnfvj
roqernjxljrzicmzlxhrxzhcouhjlrxlhpwacphzbdzpyrnlygomkoyglztgecwqcgoflbocqgwqowzxjwaeqcew
etjreysaisemnvzmwgkogmcbtpcsieaickvfxkqwogwksprfsokymksajdnamyisyaidpvikmsymiqxbdqiaceaq
zsomzhpnlpzhmauhfdxrdhpgmcpdrhxrpxaykxbfrdfxfuksfztbjtfnowanxhlphndcuqdtjfbjdlwgylrxphxl
tqsgtplznltbkeobnzjtzbjeqwjlntznjrycerjbdfbratpnaiqomqainbvigeyseiqhndqesiysqybzlycgsegy
gvltgauckugopxboyimqioedvreukgckemxhzmsyqiymurthuqmaomuclfpcoakuackfrxkmouaokszdfskcegcs
buqobjrpnrbjocwjhfztfjrioerftjztrzcamzdhtfhzhwmuhbvdlvhpqycpzjnrjpfewsfvlhdlfnyiantzrjzn
vsuivrnbpnvdmgqdpblvbdlgsylnpvbpltaegtldfhdtcvrpcksqosckpdxkigaugksjpfsgukausadbnaeiugia
ixnvicwemwiqrzdqakoskqgfxtgwmiemgozjbouaskaowtvjwsocqowenhreqcmwcemhtzmoqwcqmubfhumegieu
dwsqdltrptdlqeyljhbvhltkqgthvlbvtbecobfjvhjbjyowjdxfnxjrsaerblptlrhgyuhxnjfnhpakcpvbtlbp
xuwkxtpdrpxfoisfrdnxdfniuanprxdrnvcgivnfhjfvextremusquemrfzmkicwimulrhuiwmcwucfdpcgkwikc
kzpxkeygoykstbfscmqumsihzviyokgoiqbldqwcumcqyvxlyuqesqygpjtgseoyegojvboqsyesowdhjwogikgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: extremusque
Cipher: rkgerzhfdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: extremusque
Cipher: 5135442451235434145451

Extended Methods:
Method #1

Plaintext: extremusque
method variations:
kcywkrzxvzkphdbpwecaepunigubkhfkuzsomzgpnlpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
e x t r e m u s q u e 
5 3 4 2 5 2 5 3 1 5 5 
1 5 4 4 1 3 4 4 4 4 1 
They are then read out in rows:
5342525315515441344441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: extremusque
Cipher: pikpveudstd

Read more ...
Method #3

Plaintext: extremusque
method variations:
luiyfxodyyv uiyfxodyyvl iyfxodyyvlu
yfxodyyvlui fxodyyvluiy xodyyvluiyf
odyyvluiyfx dyyvluiyfxo yyvluiyfxod
yvluiyfxody vluiyfxodyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: extremusque

first 5040 cipher variations(39615626 total)
extremusque extremusqeu extremusuqe extremusueq extremuseuq extremusequ extremuqsue extremuqseu extremuquse extremuques
extremuqeus extremuqesu extremuuqse extremuuqes extremuusqe extremuuseq extremuuesq extremuueqs extremuequs extremueqsu
extremueuqs extremueusq extremuesuq extremuesqu extremsuque extremsuqeu extremsuuqe extremsuueq extremsueuq extremsuequ
extremsquue extremsqueu extremsquue extremsqueu extremsqeuu extremsqeuu extremsuque extremsuqeu extremsuuqe extremsuueq
extremsueuq extremsuequ extremsequu extremsequu extremseuqu extremseuuq extremseuuq extremseuqu extremqsuue extremqsueu
extremqsuue extremqsueu extremqseuu extremqseuu extremqusue extremquseu extremquuse extremquues extremqueus extremquesu
extremquuse extremquues extremqusue extremquseu extremquesu extremqueus extremqeuus extremqeusu extremqeuus extremqeusu
extremqesuu extremqesuu extremusque extremusqeu extremusuqe extremusueq extremuseuq extremusequ extremuqsue extremuqseu
extremuquse extremuques extremuqeus extremuqesu extremuuqse extremuuqes extremuusqe extremuuseq extremuuesq extremuueqs
extremuequs extremueqsu extremueuqs extremueusq extremuesuq extremuesqu extremesquu extremesquu extremesuqu extremesuuq
extremesuuq extremesuqu extremeqsuu extremeqsuu extremequsu extremequus extremequus extremequsu extremeuqsu extremeuqus
extremeusqu extremeusuq extremeuusq extremeuuqs extremeuqus extremeuqsu extremeuuqs extremeuusq extremeusuq extremeusqu
extreumsque extreumsqeu extreumsuqe extreumsueq extreumseuq extreumsequ extreumqsue extreumqseu extreumquse extreumques
extreumqeus extreumqesu extreumuqse extreumuqes extreumusqe extreumuseq extreumuesq extreumueqs extreumequs extreumeqsu
extreumeuqs extreumeusq extreumesuq extreumesqu extreusmque extreusmqeu extreusmuqe extreusmueq extreusmeuq extreusmequ
extreusqmue extreusqmeu extreusqume extreusquem extreusqeum extreusqemu extreusuqme extreusuqem extreusumqe extreusumeq
extreusuemq extreusueqm extreusequm extreuseqmu extreuseuqm extreuseumq extreusemuq extreusemqu extreuqsmue extreuqsmeu
extreuqsume extreuqsuem extreuqseum extreuqsemu extreuqmsue extreuqmseu extreuqmuse extreuqmues extreuqmeus extreuqmesu
extreuqumse extreuqumes extreuqusme extreuqusem extreuquesm extreuquems extreuqemus extreuqemsu extreuqeums extreuqeusm
extreuqesum extreuqesmu extreuusqme extreuusqem extreuusmqe extreuusmeq extreuusemq extreuuseqm extreuuqsme extreuuqsem
extreuuqmse extreuuqmes extreuuqems extreuuqesm extreuumqse extreuumqes extreuumsqe extreuumseq extreuumesq extreuumeqs
extreuueqms extreuueqsm extreuuemqs extreuuemsq extreuuesmq extreuuesqm extreuesqum extreuesqmu extreuesuqm extreuesumq
extreuesmuq extreuesmqu extreueqsum extreueqsmu extreuequsm extreuequms extreueqmus extreueqmsu extreueuqsm extreueuqms
extreueusqm extreueusmq extreueumsq extreueumqs extreuemqus extreuemqsu extreuemuqs extreuemusq extreuemsuq extreuemsqu
extresumque extresumqeu extresumuqe extresumueq extresumeuq extresumequ extresuqmue extresuqmeu extresuqume extresuquem
extresuqeum extresuqemu extresuuqme extresuuqem extresuumqe extresuumeq extresuuemq extresuueqm extresuequm extresueqmu
extresueuqm extresueumq extresuemuq extresuemqu extresmuque extresmuqeu extresmuuqe extresmuueq extresmueuq extresmuequ
extresmquue extresmqueu extresmquue extresmqueu extresmqeuu extresmqeuu extresmuque extresmuqeu extresmuuqe extresmuueq
extresmueuq extresmuequ extresmequu extresmequu extresmeuqu extresmeuuq extresmeuuq extresmeuqu extresqmuue extresqmueu
extresqmuue extresqmueu extresqmeuu extresqmeuu extresqumue extresqumeu extresquume extresquuem extresqueum extresquemu
extresquume extresquuem extresqumue extresqumeu extresquemu extresqueum extresqeuum extresqeumu extresqeuum extresqeumu
extresqemuu extresqemuu extresumque extresumqeu extresumuqe extresumueq extresumeuq extresumequ extresuqmue extresuqmeu
extresuqume extresuquem extresuqeum extresuqemu extresuuqme extresuuqem extresuumqe extresuumeq extresuuemq extresuueqm
extresuequm extresueqmu extresueuqm extresueumq extresuemuq extresuemqu extresemquu extresemquu extresemuqu extresemuuq
extresemuuq extresemuqu extreseqmuu extreseqmuu extresequmu extresequum extresequum extresequmu extreseuqmu extreseuqum
extreseumqu extreseumuq extreseuumq extreseuuqm extreseuqum extreseuqmu extreseuuqm extreseuumq extreseumuq extreseumqu
extrequsmue extrequsmeu extrequsume extrequsuem extrequseum extrequsemu extrequmsue extrequmseu extrequmuse extrequmues
extrequmeus extrequmesu extrequumse extrequumes extrequusme extrequusem extrequuesm extrequuems extrequemus extrequemsu
extrequeums extrequeusm extrequesum extrequesmu extreqsumue extreqsumeu extreqsuume extreqsuuem extreqsueum extreqsuemu
extreqsmuue extreqsmueu extreqsmuue extreqsmueu extreqsmeuu extreqsmeuu extreqsumue extreqsumeu extreqsuume extreqsuuem
extreqsueum extreqsuemu extreqsemuu extreqsemuu extreqseumu extreqseuum extreqseuum extreqseumu extreqmsuue extreqmsueu
extreqmsuue extreqmsueu extreqmseuu extreqmseuu extreqmusue extreqmuseu extreqmuuse extreqmuues extreqmueus extreqmuesu
extreqmuuse extreqmuues extreqmusue extreqmuseu extreqmuesu extreqmueus extreqmeuus extreqmeusu extreqmeuus extreqmeusu
extreqmesuu extreqmesuu extrequsmue extrequsmeu extrequsume extrequsuem extrequseum extrequsemu extrequmsue extrequmseu
extrequmuse extrequmues extrequmeus extrequmesu extrequumse extrequumes extrequusme extrequusem extrequuesm extrequuems
extrequemus extrequemsu extrequeums extrequeusm extrequesum extrequesmu extreqesmuu extreqesmuu extreqesumu extreqesuum
extreqesuum extreqesumu extreqemsuu extreqemsuu extreqemusu extreqemuus extreqemuus extreqemusu extreqeumsu extreqeumus
extreqeusmu extreqeusum extreqeuusm extreqeuums extreqeumus extreqeumsu extreqeuums extreqeuusm extreqeusum extreqeusmu
extreuusqme extreuusqem extreuusmqe extreuusmeq extreuusemq extreuuseqm extreuuqsme extreuuqsem extreuuqmse extreuuqmes
extreuuqems extreuuqesm extreuumqse extreuumqes extreuumsqe extreuumseq extreuumesq extreuumeqs extreuueqms extreuueqsm
extreuuemqs extreuuemsq extreuuesmq extreuuesqm extreusuqme extreusuqem extreusumqe extreusumeq extreusuemq extreusueqm
extreusqume extreusquem extreusqmue extreusqmeu extreusqemu extreusqeum extreusmque extreusmqeu extreusmuqe extreusmueq
extreusmeuq extreusmequ extreuseqmu extreusequm extreusemqu extreusemuq extreuseumq extreuseuqm extreuqsume extreuqsuem
extreuqsmue extreuqsmeu extreuqsemu extreuqseum extreuqusme extreuqusem extreuqumse extreuqumes extreuquems extreuquesm
extreuqmuse extreuqmues extreuqmsue extreuqmseu extreuqmesu extreuqmeus extreuqeums extreuqeusm extreuqemus extreuqemsu
extreuqesmu extreuqesum extreumsque extreumsqeu extreumsuqe extreumsueq extreumseuq extreumsequ extreumqsue extreumqseu
extreumquse extreumques extreumqeus extreumqesu extreumuqse extreumuqes extreumusqe extreumuseq extreumuesq extreumueqs
extreumequs extreumeqsu extreumeuqs extreumeusq extreumesuq extreumesqu extreuesqmu extreuesqum extreuesmqu extreuesmuq
extreuesumq extreuesuqm extreueqsmu extreueqsum extreueqmsu extreueqmus extreuequms extreuequsm extreuemqsu extreuemqus
extreuemsqu extreuemsuq extreuemusq extreuemuqs extreueuqms extreueuqsm extreueumqs extreueumsq extreueusmq extreueusqm
extreeusqum extreeusqmu extreeusuqm extreeusumq extreeusmuq extreeusmqu extreeuqsum extreeuqsmu extreeuqusm extreeuqums
extreeuqmus extreeuqmsu extreeuuqsm extreeuuqms extreeuusqm extreeuusmq extreeuumsq extreeuumqs extreeumqus extreeumqsu
extreeumuqs extreeumusq extreeumsuq extreeumsqu extreesuqum extreesuqmu extreesuuqm extreesuumq extreesumuq extreesumqu
extreesquum extreesqumu extreesquum extreesqumu extreesqmuu extreesqmuu extreesuqum extreesuqmu extreesuuqm extreesuumq
extreesumuq extreesumqu extreesmquu extreesmquu extreesmuqu extreesmuuq extreesmuuq extreesmuqu extreeqsuum extreeqsumu
extreeqsuum extreeqsumu extreeqsmuu extreeqsmuu extreequsum extreequsmu extreequusm extreequums extreequmus extreequmsu
extreequusm extreequums extreequsum extreequsmu extreequmsu extreequmus extreeqmuus extreeqmusu extreeqmuus extreeqmusu
extreeqmsuu extreeqmsuu extreeusqum extreeusqmu extreeusuqm extreeusumq extreeusmuq extreeusmqu extreeuqsum extreeuqsmu
extreeuqusm extreeuqums extreeuqmus extreeuqmsu extreeuuqsm extreeuuqms extreeuusqm extreeuusmq extreeuumsq extreeuumqs
extreeumqus extreeumqsu extreeumuqs extreeumusq extreeumsuq extreeumsqu extreemsquu extreemsquu extreemsuqu extreemsuuq
extreemsuuq extreemsuqu extreemqsuu extreemqsuu extreemqusu extreemquus extreemquus extreemqusu extreemuqsu extreemuqus
extreemusqu extreemusuq extreemuusq extreemuuqs extreemuqus extreemuqsu extreemuuqs extreemuusq extreemusuq extreemusqu
extrmeusque extrmeusqeu extrmeusuqe extrmeusueq extrmeuseuq extrmeusequ extrmeuqsue extrmeuqseu extrmeuquse extrmeuques
extrmeuqeus extrmeuqesu extrmeuuqse extrmeuuqes extrmeuusqe extrmeuuseq extrmeuuesq extrmeuueqs extrmeuequs extrmeueqsu
extrmeueuqs extrmeueusq extrmeuesuq extrmeuesqu extrmesuque extrmesuqeu extrmesuuqe extrmesuueq extrmesueuq extrmesuequ
extrmesquue extrmesqueu extrmesquue extrmesqueu extrmesqeuu extrmesqeuu extrmesuque extrmesuqeu extrmesuuqe extrmesuueq
extrmesueuq extrmesuequ extrmesequu extrmesequu extrmeseuqu extrmeseuuq extrmeseuuq extrmeseuqu extrmeqsuue extrmeqsueu
extrmeqsuue extrmeqsueu extrmeqseuu extrmeqseuu extrmequsue extrmequseu extrmequuse extrmequues extrmequeus extrmequesu
extrmequuse extrmequues extrmequsue extrmequseu extrmequesu extrmequeus extrmeqeuus extrmeqeusu extrmeqeuus extrmeqeusu
extrmeqesuu extrmeqesuu extrmeusque extrmeusqeu extrmeusuqe extrmeusueq extrmeuseuq extrmeusequ extrmeuqsue extrmeuqseu
extrmeuquse extrmeuques extrmeuqeus extrmeuqesu extrmeuuqse extrmeuuqes extrmeuusqe extrmeuuseq extrmeuuesq extrmeuueqs
extrmeuequs extrmeueqsu extrmeueuqs extrmeueusq extrmeuesuq extrmeuesqu extrmeesquu extrmeesquu extrmeesuqu extrmeesuuq
extrmeesuuq extrmeesuqu extrmeeqsuu extrmeeqsuu extrmeequsu extrmeequus extrmeequus extrmeequsu extrmeeuqsu extrmeeuqus
extrmeeusqu extrmeeusuq extrmeeuusq extrmeeuuqs extrmeeuqus extrmeeuqsu extrmeeuuqs extrmeeuusq extrmeeusuq extrmeeusqu
extrmuesque extrmuesqeu extrmuesuqe extrmuesueq extrmueseuq extrmuesequ extrmueqsue extrmueqseu extrmuequse extrmueques
extrmueqeus extrmueqesu extrmueuqse extrmueuqes extrmueusqe extrmueuseq extrmueuesq extrmueueqs extrmueequs extrmueeqsu
extrmueeuqs extrmueeusq extrmueesuq extrmueesqu extrmuseque extrmuseqeu extrmuseuqe extrmuseueq extrmuseeuq extrmuseequ
extrmusqeue extrmusqeeu extrmusquee extrmusquee extrmusqeue extrmusqeeu extrmusuqee extrmusuqee extrmusueqe extrmusueeq
extrmusueeq extrmusueqe extrmuseque extrmuseqeu extrmuseuqe extrmuseueq extrmuseeuq extrmuseequ extrmuqseue extrmuqseeu
extrmuqsuee extrmuqsuee extrmuqseue extrmuqseeu extrmuqesue extrmuqeseu extrmuqeuse extrmuqeues extrmuqeeus extrmuqeesu
extrmuquese extrmuquees extrmuqusee extrmuqusee extrmuquese extrmuquees extrmuqeeus extrmuqeesu extrmuqeues extrmuqeuse
extrmuqesue extrmuqeseu extrmuusqee extrmuusqee extrmuuseqe extrmuuseeq extrmuuseeq extrmuuseqe extrmuuqsee extrmuuqsee
extrmuuqese extrmuuqees extrmuuqees extrmuuqese extrmuueqse extrmuueqes extrmuuesqe extrmuueseq extrmuueesq extrmuueeqs
extrmuueqes extrmuueqse extrmuueeqs extrmuueesq extrmuueseq extrmuuesqe extrmuesque extrmuesqeu extrmuesuqe extrmuesueq
extrmueseuq extrmuesequ extrmueqsue extrmueqseu extrmuequse extrmueques extrmueqeus extrmueqesu extrmueuqse extrmueuqes
extrmueusqe extrmueuseq extrmueuesq extrmueueqs extrmueequs extrmueeqsu extrmueeuqs extrmueeusq extrmueesuq extrmueesqu
extrmsueque extrmsueqeu extrmsueuqe extrmsueueq extrmsueeuq extrmsueequ extrmsuqeue extrmsuqeeu extrmsuquee extrmsuquee
extrmsuqeue extrmsuqeeu extrmsuuqee extrmsuuqee extrmsuueqe extrmsuueeq extrmsuueeq extrmsuueqe extrmsueque extrmsueqeu
extrmsueuqe extrmsueueq extrmsueeuq extrmsueequ extrmseuque extrmseuqeu extrmseuuqe extrmseuueq extrmseueuq extrmseuequ
extrmsequue extrmsequeu extrmsequue extrmsequeu extrmseqeuu extrmseqeuu extrmseuque extrmseuqeu extrmseuuqe extrmseuueq
extrmseueuq extrmseuequ extrmseequu extrmseequu extrmseeuqu extrmseeuuq extrmseeuuq extrmseeuqu extrmsqeuue extrmsqeueu
extrmsqeuue extrmsqeueu extrmsqeeuu extrmsqeeuu extrmsqueue extrmsqueeu extrmsquuee extrmsquuee extrmsqueue extrmsqueeu
extrmsquuee extrmsquuee extrmsqueue extrmsqueeu extrmsqueeu extrmsqueue extrmsqeuue extrmsqeueu extrmsqeuue extrmsqeueu
extrmsqeeuu extrmsqeeuu extrmsueque extrmsueqeu extrmsueuqe extrmsueueq extrmsueeuq extrmsueequ extrmsuqeue extrmsuqeeu
extrmsuquee extrmsuquee extrmsuqeue extrmsuqeeu extrmsuuqee extrmsuuqee extrmsuueqe extrmsuueeq extrmsuueeq extrmsuueqe
extrmsueque extrmsueqeu extrmsueuqe extrmsueueq extrmsueeuq extrmsueequ extrmseequu extrmseequu extrmseeuqu extrmseeuuq
extrmseeuuq extrmseeuqu extrmseqeuu extrmseqeuu extrmsequeu extrmsequue extrmsequue extrmsequeu extrmseuqeu extrmseuque
extrmseuequ extrmseueuq extrmseuueq extrmseuuqe extrmseuque extrmseuqeu extrmseuuqe extrmseuueq extrmseueuq extrmseuequ
extrmquseue extrmquseeu extrmqusuee extrmqusuee extrmquseue extrmquseeu extrmquesue extrmqueseu extrmqueuse extrmqueues
extrmqueeus extrmqueesu extrmquuese extrmquuees extrmquusee extrmquusee extrmquuese extrmquuees extrmqueeus extrmqueesu
extrmqueues extrmqueuse extrmquesue extrmqueseu extrmqsueue extrmqsueeu extrmqsuuee extrmqsuuee extrmqsueue extrmqsueeu
extrmqseuue extrmqseueu extrmqseuue extrmqseueu extrmqseeuu extrmqseeuu extrmqsueue extrmqsueeu extrmqsuuee extrmqsuuee
extrmqsueue extrmqsueeu extrmqseeuu extrmqseeuu extrmqseueu extrmqseuue extrmqseuue extrmqseueu extrmqesuue extrmqesueu
extrmqesuue extrmqesueu extrmqeseuu extrmqeseuu extrmqeusue extrmqeuseu extrmqeuuse extrmqeuues extrmqeueus extrmqeuesu
extrmqeuuse extrmqeuues extrmqeusue extrmqeuseu extrmqeuesu extrmqeueus extrmqeeuus extrmqeeusu extrmqeeuus extrmqeeusu
extrmqeesuu extrmqeesuu extrmquseue extrmquseeu extrmqusuee extrmqusuee extrmquseue extrmquseeu extrmquesue extrmqueseu
extrmqueuse extrmqueues extrmqueeus extrmqueesu extrmquuese extrmquuees extrmquusee extrmquusee extrmquuese extrmquuees
extrmqueeus extrmqueesu extrmqueues extrmqueuse extrmquesue extrmqueseu extrmqeseuu extrmqeseuu extrmqesueu extrmqesuue
extrmqesuue extrmqesueu extrmqeesuu extrmqeesuu extrmqeeusu extrmqeeuus extrmqeeuus extrmqeeusu extrmqeuesu extrmqeueus
extrmqeuseu extrmqeusue extrmqeuuse extrmqeuues extrmqeueus extrmqeuesu extrmqeuues extrmqeuuse extrmqeusue extrmqeuseu
extrmuusqee extrmuusqee extrmuuseqe extrmuuseeq extrmuuseeq extrmuuseqe extrmuuqsee extrmuuqsee extrmuuqese extrmuuqees
extrmuuqees extrmuuqese extrmuueqse extrmuueqes extrmuuesqe extrmuueseq extrmuueesq extrmuueeqs extrmuueqes extrmuueqse
extrmuueeqs extrmuueesq extrmuueseq extrmuuesqe extrmusuqee extrmusuqee extrmusueqe extrmusueeq extrmusueeq extrmusueqe
extrmusquee extrmusquee extrmusqeue extrmusqeeu extrmusqeeu extrmusqeue extrmuseque extrmuseqeu extrmuseuqe extrmuseueq
extrmuseeuq extrmuseequ extrmuseqeu extrmuseque extrmuseequ extrmuseeuq extrmuseueq extrmuseuqe extrmuqsuee extrmuqsuee
extrmuqseue extrmuqseeu extrmuqseeu extrmuqseue extrmuqusee extrmuqusee extrmuquese extrmuquees extrmuquees extrmuquese
extrmuqeuse extrmuqeues extrmuqesue extrmuqeseu extrmuqeesu extrmuqeeus extrmuqeues extrmuqeuse extrmuqeeus extrmuqeesu
extrmuqeseu extrmuqesue extrmuesque extrmuesqeu extrmuesuqe extrmuesueq extrmueseuq extrmuesequ extrmueqsue extrmueqseu
extrmuequse extrmueques extrmueqeus extrmueqesu extrmueuqse extrmueuqes extrmueusqe extrmueuseq extrmueuesq extrmueueqs
extrmueequs extrmueeqsu extrmueeuqs extrmueeusq extrmueesuq extrmueesqu extrmuesqeu extrmuesque extrmuesequ extrmueseuq
extrmuesueq extrmuesuqe extrmueqseu extrmueqsue extrmueqesu extrmueqeus extrmueques extrmuequse extrmueeqsu extrmueequs
extrmueesqu extrmueesuq extrmueeusq extrmueeuqs extrmueuqes extrmueuqse extrmueueqs extrmueuesq extrmueuseq extrmueusqe
extrmeusque extrmeusqeu extrmeusuqe extrmeusueq extrmeuseuq extrmeusequ extrmeuqsue extrmeuqseu extrmeuquse extrmeuques
extrmeuqeus extrmeuqesu extrmeuuqse extrmeuuqes extrmeuusqe extrmeuuseq extrmeuuesq extrmeuueqs extrmeuequs extrmeueqsu
extrmeueuqs extrmeueusq extrmeuesuq extrmeuesqu extrmesuque extrmesuqeu extrmesuuqe extrmesuueq extrmesueuq extrmesuequ
extrmesquue extrmesqueu extrmesquue extrmesqueu extrmesqeuu extrmesqeuu extrmesuque extrmesuqeu extrmesuuqe extrmesuueq
extrmesueuq extrmesuequ extrmesequu extrmesequu extrmeseuqu extrmeseuuq extrmeseuuq extrmeseuqu extrmeqsuue extrmeqsueu
extrmeqsuue extrmeqsueu extrmeqseuu extrmeqseuu extrmequsue extrmequseu extrmequuse extrmequues extrmequeus extrmequesu
extrmequuse extrmequues extrmequsue extrmequseu extrmequesu extrmequeus extrmeqeuus extrmeqeusu extrmeqeuus extrmeqeusu
extrmeqesuu extrmeqesuu extrmeusque extrmeusqeu extrmeusuqe extrmeusueq extrmeuseuq extrmeusequ extrmeuqsue extrmeuqseu
extrmeuquse extrmeuques extrmeuqeus extrmeuqesu extrmeuuqse extrmeuuqes extrmeuusqe extrmeuuseq extrmeuuesq extrmeuueqs
extrmeuequs extrmeueqsu extrmeueuqs extrmeueusq extrmeuesuq extrmeuesqu extrmeesquu extrmeesquu extrmeesuqu extrmeesuuq
extrmeesuuq extrmeesuqu extrmeeqsuu extrmeeqsuu extrmeequsu extrmeequus extrmeequus extrmeequsu extrmeeuqsu extrmeeuqus
extrmeeusqu extrmeeusuq extrmeeuusq extrmeeuuqs extrmeeuqus extrmeeuqsu extrmeeuuqs extrmeeuusq extrmeeusuq extrmeeusqu
extrumesque extrumesqeu extrumesuqe extrumesueq extrumeseuq extrumesequ extrumeqsue extrumeqseu extrumequse extrumeques
extrumeqeus extrumeqesu extrumeuqse extrumeuqes extrumeusqe extrumeuseq extrumeuesq extrumeueqs extrumeequs extrumeeqsu
extrumeeuqs extrumeeusq extrumeesuq extrumeesqu extrumseque extrumseqeu extrumseuqe extrumseueq extrumseeuq extrumseequ
extrumsqeue extrumsqeeu extrumsquee extrumsquee extrumsqeue extrumsqeeu extrumsuqee extrumsuqee extrumsueqe extrumsueeq
extrumsueeq extrumsueqe extrumseque extrumseqeu extrumseuqe extrumseueq extrumseeuq extrumseequ extrumqseue extrumqseeu
extrumqsuee extrumqsuee extrumqseue extrumqseeu extrumqesue extrumqeseu extrumqeuse extrumqeues extrumqeeus extrumqeesu
extrumquese extrumquees extrumqusee extrumqusee extrumquese extrumquees extrumqeeus extrumqeesu extrumqeues extrumqeuse
extrumqesue extrumqeseu extrumusqee extrumusqee extrumuseqe extrumuseeq extrumuseeq extrumuseqe extrumuqsee extrumuqsee
extrumuqese extrumuqees extrumuqees extrumuqese extrumueqse extrumueqes extrumuesqe extrumueseq extrumueesq extrumueeqs
extrumueqes extrumueqse extrumueeqs extrumueesq extrumueseq extrumuesqe extrumesque extrumesqeu extrumesuqe extrumesueq
extrumeseuq extrumesequ extrumeqsue extrumeqseu extrumequse extrumeques extrumeqeus extrumeqesu extrumeuqse extrumeuqes
extrumeusqe extrumeuseq extrumeuesq extrumeueqs extrumeequs extrumeeqsu extrumeeuqs extrumeeusq extrumeesuq extrumeesqu
extruemsque extruemsqeu extruemsuqe extruemsueq extruemseuq extruemsequ extruemqsue extruemqseu extruemquse extruemques
extruemqeus extruemqesu extruemuqse extruemuqes extruemusqe extruemuseq extruemuesq extruemueqs extruemequs extruemeqsu
extruemeuqs extruemeusq extruemesuq extruemesqu extruesmque extruesmqeu extruesmuqe extruesmueq extruesmeuq extruesmequ
extruesqmue extruesqmeu extruesqume extruesquem extruesqeum extruesqemu extruesuqme extruesuqem extruesumqe extruesumeq
extruesuemq extruesueqm extruesequm extrueseqmu extrueseuqm extrueseumq extruesemuq extruesemqu extrueqsmue extrueqsmeu
extrueqsume extrueqsuem extrueqseum extrueqsemu extrueqmsue extrueqmseu extrueqmuse extrueqmues extrueqmeus extrueqmesu
extruequmse extruequmes extruequsme extruequsem extruequesm extruequems extrueqemus extrueqemsu extrueqeums extrueqeusm
extrueqesum extrueqesmu extrueusqme extrueusqem extrueusmqe extrueusmeq extrueusemq extrueuseqm extrueuqsme extrueuqsem
extrueuqmse extrueuqmes extrueuqems extrueuqesm extrueumqse extrueumqes extrueumsqe extrueumseq extrueumesq extrueumeqs
extrueueqms extrueueqsm extrueuemqs extrueuemsq extrueuesmq extrueuesqm extrueesqum extrueesqmu extrueesuqm extrueesumq
extrueesmuq extrueesmqu extrueeqsum extrueeqsmu extrueequsm extrueequms extrueeqmus extrueeqmsu extrueeuqsm extrueeuqms
extrueeusqm extrueeusmq extrueeumsq extrueeumqs extrueemqus extrueemqsu extrueemuqs extrueemusq extrueemsuq extrueemsqu
extrusemque extrusemqeu extrusemuqe extrusemueq extrusemeuq extrusemequ extruseqmue extruseqmeu extrusequme extrusequem
extruseqeum extruseqemu extruseuqme extruseuqem extruseumqe extruseumeq extruseuemq extruseueqm extruseequm extruseeqmu
extruseeuqm extruseeumq extruseemuq extruseemqu extrusmeque extrusmeqeu extrusmeuqe extrusmeueq extrusmeeuq extrusmeequ
extrusmqeue extrusmqeeu extrusmquee extrusmquee extrusmqeue extrusmqeeu extrusmuqee extrusmuqee extrusmueqe extrusmueeq
extrusmueeq extrusmueqe extrusmeque extrusmeqeu extrusmeuqe extrusmeueq extrusmeeuq extrusmeequ extrusqmeue extrusqmeeu
extrusqmuee extrusqmuee extrusqmeue extrusqmeeu extrusqemue extrusqemeu extrusqeume extrusqeuem extrusqeeum extrusqeemu
extrusqueme extrusqueem extrusqumee extrusqumee extrusqueme extrusqueem extrusqeeum extrusqeemu extrusqeuem extrusqeume
extrusqemue extrusqemeu extrusumqee extrusumqee extrusumeqe extrusumeeq extrusumeeq extrusumeqe extrusuqmee extrusuqmee
extrusuqeme extrusuqeem extrusuqeem extrusuqeme extrusueqme extrusueqem extrusuemqe extrusuemeq extrusueemq extrusueeqm
extrusueqem extrusueqme extrusueeqm extrusueemq extrusuemeq extrusuemqe extrusemque extrusemqeu extrusemuqe extrusemueq
extrusemeuq extrusemequ extruseqmue extruseqmeu extrusequme extrusequem extruseqeum extruseqemu extruseuqme extruseuqem
extruseumqe extruseumeq extruseuemq extruseueqm extruseequm extruseeqmu extruseeuqm extruseeumq extruseemuq extruseemqu
extruqesmue extruqesmeu extruqesume extruqesuem extruqeseum extruqesemu extruqemsue extruqemseu extruqemuse extruqemues
extruqemeus extruqemesu extruqeumse extruqeumes extruqeusme extruqeusem extruqeuesm extruqeuems extruqeemus extruqeemsu
extruqeeums extruqeeusm extruqeesum extruqeesmu extruqsemue extruqsemeu extruqseume extruqseuem extruqseeum extruqseemu
extruqsmeue extruqsmeeu extruqsmuee extruqsmuee extruqsmeue extruqsmeeu extruqsumee extruqsumee extruqsueme extruqsueem
extruqsueem extruqsueme extruqsemue extruqsemeu extruqseume extruqseuem extruqseeum extruqseemu extruqmseue extruqmseeu
extruqmsuee extruqmsuee extruqmseue extruqmseeu extruqmesue extruqmeseu extruqmeuse extruqmeues extruqmeeus extruqmeesu
extruqmuese extruqmuees extruqmusee extruqmusee extruqmuese extruqmuees extruqmeeus extruqmeesu extruqmeues extruqmeuse
extruqmesue extruqmeseu extruqusmee extruqusmee extruquseme extruquseem extruquseem extruquseme extruqumsee extruqumsee
extruqumese extruqumees extruqumees extruqumese extruquemse extruquemes extruquesme extruquesem extruqueesm extruqueems
extruquemes extruquemse extruqueems extruqueesm extruquesem extruquesme extruqesmue extruqesmeu extruqesume extruqesuem
extruqeseum extruqesemu extruqemsue extruqemseu extruqemuse extruqemues extruqemeus extruqemesu extruqeumse extruqeumes
extruqeusme extruqeusem extruqeuesm extruqeuems extruqeemus extruqeemsu extruqeeums extruqeeusm extruqeesum extruqeesmu
extruuesqme extruuesqem extruuesmqe extruuesmeq extruuesemq extruueseqm extruueqsme extruueqsem extruueqmse extruueqmes
extruueqems extruueqesm extruuemqse extruuemqes extruuemsqe extruuemseq extruuemesq extruuemeqs extruueeqms extruueeqsm
extruueemqs extruueemsq extruueesmq extruueesqm extruuseqme extruuseqem extruusemqe extruusemeq extruuseemq extruuseeqm
extruusqeme extruusqeem extruusqmee extruusqmee extruusqeme extruusqeem extruusmqee extruusmqee extruusmeqe extruusmeeq
extruusmeeq extruusmeqe extruuseqme extruuseqem extruusemqe extruusemeq extruuseemq extruuseeqm extruuqseme extruuqseem
extruuqsmee extruuqsmee extruuqseme extruuqseem extruuqesme extruuqesem extruuqemse extruuqemes extruuqeems extruuqeesm
extruuqmese extruuqmees extruuqmsee extruuqmsee extruuqmese extruuqmees extruuqeems extruuqeesm extruuqemes extruuqemse
extruuqesme extruuqesem extruumsqee extruumsqee extruumseqe extruumseeq extruumseeq extruumseqe extruumqsee extruumqsee
extruumqese extruumqees extruumqees extruumqese extruumeqse extruumeqes extruumesqe extruumeseq extruumeesq extruumeeqs
extruumeqes extruumeqse extruumeeqs extruumeesq extruumeseq extruumesqe extruuesqme extruuesqem extruuesmqe extruuesmeq
extruuesemq extruueseqm extruueqsme extruueqsem extruueqmse extruueqmes extruueqems extruueqesm extruuemqse extruuemqes
extruuemsqe extruuemseq extruuemesq extruuemeqs extruueeqms extruueeqsm extruueemqs extruueemsq extruueesmq extruueesqm
extrueesqum extrueesqmu extrueesuqm extrueesumq extrueesmuq extrueesmqu extrueeqsum extrueeqsmu extrueequsm extrueequms
extrueeqmus extrueeqmsu extrueeuqsm extrueeuqms extrueeusqm extrueeusmq extrueeumsq extrueeumqs extrueemqus extrueemqsu
extrueemuqs extrueemusq extrueemsuq extrueemsqu extruesequm extrueseqmu extrueseuqm extrueseumq extruesemuq extruesemqu
extruesqeum extruesqemu extruesquem extruesqume extruesqmue extruesqmeu extruesuqem extruesuqme extruesueqm extruesuemq
extruesumeq extruesumqe extruesmque extruesmqeu extruesmuqe extruesmueq extruesmeuq extruesmequ extrueqseum extrueqsemu
extrueqsuem extrueqsume extrueqsmue extrueqsmeu extrueqesum extrueqesmu extrueqeusm extrueqeums extrueqemus extrueqemsu
extruequesm extruequems extruequsem extruequsme extruequmse extruequmes extrueqmeus extrueqmesu extrueqmues extrueqmuse
extrueqmsue extrueqmseu extrueusqem extrueusqme extrueuseqm extrueusemq extrueusmeq extrueusmqe extrueuqsem extrueuqsme
extrueuqesm extrueuqems extrueuqmes extrueuqmse extrueueqsm extrueueqms extrueuesqm extrueuesmq extrueuemsq extrueuemqs
extrueumqes extrueumqse extrueumeqs extrueumesq extrueumseq extrueumsqe extruemsque extruemsqeu extruemsuqe extruemsueq
extruemseuq extruemsequ extruemqsue extruemqseu extruemquse extruemques extruemqeus extruemqesu extruemuqse extruemuqes
extruemusqe extruemuseq extruemuesq extruemueqs extruemequs extruemeqsu extruemeuqs extruemeusq extruemesuq extruemesqu
extrsmueque extrsmueqeu extrsmueuqe extrsmueueq extrsmueeuq extrsmueequ extrsmuqeue extrsmuqeeu extrsmuquee extrsmuquee
extrsmuqeue extrsmuqeeu extrsmuuqee extrsmuuqee extrsmuueqe extrsmuueeq extrsmuueeq extrsmuueqe extrsmueque extrsmueqeu
extrsmueuqe extrsmueueq extrsmueeuq extrsmueequ extrsmeuque extrsmeuqeu extrsmeuuqe extrsmeuueq extrsmeueuq extrsmeuequ
extrsmequue extrsmequeu extrsmequue extrsmequeu extrsmeqeuu extrsmeqeuu extrsmeuque extrsmeuqeu extrsmeuuqe extrsmeuueq
extrsmeueuq extrsmeuequ extrsmeequu extrsmeequu extrsmeeuqu extrsmeeuuq extrsmeeuuq extrsmeeuqu extrsmqeuue extrsmqeueu
extrsmqeuue extrsmqeueu extrsmqeeuu extrsmqeeuu extrsmqueue extrsmqueeu extrsmquuee extrsmquuee extrsmqueue extrsmqueeu
extrsmquuee extrsmquuee extrsmqueue extrsmqueeu extrsmqueeu extrsmqueue extrsmqeuue extrsmqeueu extrsmqeuue extrsmqeueu
extrsmqeeuu extrsmqeeuu extrsmueque extrsmueqeu extrsmueuqe extrsmueueq extrsmueeuq extrsmueequ extrsmuqeue extrsmuqeeu
extrsmuquee extrsmuquee extrsmuqeue extrsmuqeeu extrsmuuqee extrsmuuqee extrsmuueqe extrsmuueeq extrsmuueeq extrsmuueqe
extrsmueque extrsmueqeu extrsmueuqe extrsmueueq extrsmueeuq extrsmueequ extrsmeequu extrsmeequu extrsmeeuqu extrsmeeuuq
extrsmeeuuq extrsmeeuqu extrsmeqeuu extrsmeqeuu extrsmequeu extrsmequue extrsmequue extrsmequeu extrsmeuqeu extrsmeuque
extrsmeuequ extrsmeueuq extrsmeuueq extrsmeuuqe extrsmeuque extrsmeuqeu extrsmeuuqe extrsmeuueq extrsmeueuq extrsmeuequ
extrsumeque extrsumeqeu extrsumeuqe extrsumeueq extrsumeeuq extrsumeequ extrsumqeue extrsumqeeu extrsumquee extrsumquee
extrsumqeue extrsumqeeu extrsumuqee extrsumuqee extrsumueqe extrsumueeq extrsumueeq extrsumueqe extrsumeque extrsumeqeu
extrsumeuqe extrsumeueq extrsumeeuq extrsumeequ extrsuemque extrsuemqeu extrsuemuqe extrsuemueq extrsuemeuq extrsuemequ
extrsueqmue extrsueqmeu extrsuequme extrsuequem extrsueqeum extrsueqemu extrsueuqme extrsueuqem extrsueumqe extrsueumeq
extrsueuemq extrsueueqm extrsueequm extrsueeqmu extrsueeuqm extrsueeumq extrsueemuq extrsueemqu extrsuqemue extrsuqemeu
extrsuqeume extrsuqeuem extrsuqeeum extrsuqeemu extrsuqmeue extrsuqmeeu extrsuqmuee extrsuqmuee extrsuqmeue extrsuqmeeu
extrsuqumee extrsuqumee extrsuqueme extrsuqueem extrsuqueem extrsuqueme extrsuqemue extrsuqemeu extrsuqeume extrsuqeuem
extrsuqeeum extrsuqeemu extrsuueqme extrsuueqem extrsuuemqe extrsuuemeq extrsuueemq extrsuueeqm extrsuuqeme extrsuuqeem
extrsuuqmee extrsuuqmee extrsuuqeme extrsuuqeem extrsuumqee extrsuumqee extrsuumeqe extrsuumeeq extrsuumeeq extrsuumeqe
extrsuueqme extrsuueqem extrsuuemqe extrsuuemeq extrsuueemq extrsuueeqm extrsueequm extrsueeqmu extrsueeuqm extrsueeumq
extrsueemuq extrsueemqu extrsueqeum extrsueqemu extrsuequem extrsuequme extrsueqmue extrsueqmeu extrsueuqem extrsueuqme
extrsueueqm extrsueuemq extrsueumeq extrsueumqe extrsuemque extrsuemqeu extrsuemuqe extrsuemueq extrsuemeuq extrsuemequ
extrseumque extrseumqeu extrseumuqe extrseumueq extrseumeuq extrseumequ extrseuqmue extrseuqmeu extrseuqume extrseuquem
extrseuqeum extrseuqemu extrseuuqme extrseuuqem extrseuumqe extrseuumeq extrseuuemq extrseuueqm extrseuequm extrseueqmu
extrseueuqm extrseueumq extrseuemuq extrseuemqu extrsemuque extrsemuqeu extrsemuuqe extrsemuueq extrsemueuq extrsemuequ
extrsemquue extrsemqueu extrsemquue extrsemqueu extrsemqeuu extrsemqeuu extrsemuque extrsemuqeu extrsemuuqe extrsemuueq
extrsemueuq extrsemuequ extrsemequu extrsemequu extrsemeuqu extrsemeuuq extrsemeuuq extrsemeuqu extrseqmuue extrseqmueu
extrseqmuue extrseqmueu extrseqmeuu extrseqmeuu extrsequmue extrsequmeu extrsequume extrsequuem extrsequeum extrsequemu
extrsequume extrsequuem extrsequmue extrsequmeu extrsequemu extrsequeum extrseqeuum extrseqeumu extrseqeuum extrseqeumu
extrseqemuu extrseqemuu extrseumque extrseumqeu extrseumuqe extrseumueq extrseumeuq extrseumequ extrseuqmue extrseuqmeu
extrseuqume extrseuquem extrseuqeum extrseuqemu extrseuuqme extrseuuqem extrseuumqe extrseuumeq extrseuuemq extrseuueqm
extrseuequm extrseueqmu extrseueuqm extrseueumq extrseuemuq extrseuemqu extrseemquu extrseemquu extrseemuqu extrseemuuq
extrseemuuq extrseemuqu extrseeqmuu extrseeqmuu extrseequmu extrseequum extrseequum extrseequmu extrseeuqmu extrseeuqum
extrseeumqu extrseeumuq extrseeuumq extrseeuuqm extrseeuqum extrseeuqmu extrseeuuqm extrseeuumq extrseeumuq extrseeumqu
extrsquemue extrsquemeu extrsqueume extrsqueuem extrsqueeum extrsqueemu extrsqumeue extrsqumeeu extrsqumuee extrsqumuee
extrsqumeue extrsqumeeu extrsquumee extrsquumee extrsquueme extrsquueem extrsquueem extrsquueme extrsquemue extrsquemeu
extrsqueume extrsqueuem extrsqueeum extrsqueemu extrsqeumue extrsqeumeu extrsqeuume extrsqeuuem extrsqeueum extrsqeuemu
extrsqemuue extrsqemueu extrsqemuue extrsqemueu extrsqemeuu extrsqemeuu extrsqeumue extrsqeumeu extrsqeuume extrsqeuuem
extrsqeueum extrsqeuemu extrsqeemuu extrsqeemuu extrsqeeumu extrsqeeuum extrsqeeuum extrsqeeumu extrsqmeuue extrsqmeueu
extrsqmeuue extrsqmeueu extrsqmeeuu extrsqmeeuu extrsqmueue extrsqmueeu extrsqmuuee extrsqmuuee extrsqmueue extrsqmueeu
extrsqmuuee extrsqmuuee extrsqmueue extrsqmueeu extrsqmueeu extrsqmueue extrsqmeuue extrsqmeueu extrsqmeuue extrsqmeueu
extrsqmeeuu extrsqmeeuu extrsquemue extrsquemeu extrsqueume extrsqueuem extrsqueeum extrsqueemu extrsqumeue extrsqumeeu
extrsqumuee extrsqumuee extrsqumeue extrsqumeeu extrsquumee extrsquumee extrsquueme extrsquueem extrsquueem extrsquueme
extrsquemue extrsquemeu extrsqueume extrsqueuem extrsqueeum extrsqueemu extrsqeemuu extrsqeemuu extrsqeeumu extrsqeeuum
extrsqeeuum extrsqeeumu extrsqemeuu extrsqemeuu extrsqemueu extrsqemuue extrsqemuue extrsqemueu extrsqeumeu extrsqeumue
extrsqeuemu extrsqeueum extrsqeuuem extrsqeuume extrsqeumue extrsqeumeu extrsqeuume extrsqeuuem extrsqeueum extrsqeuemu
extrsuueqme extrsuueqem extrsuuemqe extrsuuemeq extrsuueemq extrsuueeqm extrsuuqeme extrsuuqeem extrsuuqmee extrsuuqmee
extrsuuqeme extrsuuqeem extrsuumqee extrsuumqee extrsuumeqe extrsuumeeq extrsuumeeq extrsuumeqe extrsuueqme extrsuueqem
extrsuuemqe extrsuuemeq extrsuueemq extrsuueeqm extrsueuqme extrsueuqem extrsueumqe extrsueumeq extrsueuemq extrsueueqm
extrsuequme extrsuequem extrsueqmue extrsueqmeu extrsueqemu extrsueqeum extrsuemque extrsuemqeu extrsuemuqe extrsuemueq
extrsuemeuq extrsuemequ extrsueeqmu extrsueequm extrsueemqu extrsueemuq extrsueeumq extrsueeuqm extrsuqeume extrsuqeuem
extrsuqemue extrsuqemeu extrsuqeemu extrsuqeeum extrsuqueme extrsuqueem extrsuqumee extrsuqumee extrsuqueme extrsuqueem
extrsuqmuee extrsuqmuee extrsuqmeue extrsuqmeeu extrsuqmeeu extrsuqmeue extrsuqeume extrsuqeuem extrsuqemue extrsuqemeu
extrsuqeemu extrsuqeeum extrsumeque extrsumeqeu extrsumeuqe extrsumeueq extrsumeeuq extrsumeequ extrsumqeue extrsumqeeu
extrsumquee extrsumquee extrsumqeue extrsumqeeu extrsumuqee extrsumuqee extrsumueqe extrsumueeq extrsumueeq extrsumueqe
extrsumeque extrsumeqeu extrsumeuqe extrsumeueq extrsumeeuq extrsumeequ extrsueeqmu extrsueequm extrsueemqu extrsueemuq
extrsueeumq extrsueeuqm extrsueqemu extrsueqeum extrsueqmeu extrsueqmue extrsuequme extrsuequem extrsuemqeu extrsuemque
extrsuemequ extrsuemeuq extrsuemueq extrsuemuqe extrsueuqme extrsueuqem extrsueumqe extrsueumeq extrsueuemq extrsueueqm
extrseuequm extrseueqmu extrseueuqm extrseueumq extrseuemuq extrseuemqu extrseuqeum extrseuqemu extrseuquem extrseuqume
extrseuqmue extrseuqmeu extrseuuqem extrseuuqme extrseuueqm extrseuuemq extrseuumeq extrseuumqe extrseumque extrseumqeu
extrseumuqe extrseumueq extrseumeuq extrseumequ extrseeuqum extrseeuqmu extrseeuuqm extrseeuumq extrseeumuq extrseeumqu
extrseequum extrseequmu extrseequum extrseequmu extrseeqmuu extrseeqmuu extrseeuqum extrseeuqmu extrseeuuqm extrseeuumq
extrseeumuq extrseeumqu extrseemquu extrseemquu extrseemuqu extrseemuuq extrseemuuq extrseemuqu extrseqeuum extrseqeumu
extrseqeuum extrseqeumu extrseqemuu extrseqemuu extrsequeum extrsequemu extrsequuem extrsequume extrsequmue extrsequmeu
extrsequuem extrsequume extrsequeum extrsequemu extrsequmeu extrsequmue extrseqmuue extrseqmueu extrseqmuue extrseqmueu
extrseqmeuu extrseqmeuu extrseuequm extrseueqmu extrseueuqm extrseueumq extrseuemuq extrseuemqu extrseuqeum extrseuqemu
extrseuquem extrseuqume extrseuqmue extrseuqmeu extrseuuqem extrseuuqme extrseuueqm extrseuuemq extrseuumeq extrseuumqe
extrseumque extrseumqeu extrseumuqe extrseumueq extrseumeuq extrseumequ extrsemequu extrsemequu extrsemeuqu extrsemeuuq
extrsemeuuq extrsemeuqu extrsemqeuu extrsemqeuu extrsemqueu extrsemquue extrsemquue extrsemqueu extrsemuqeu extrsemuque
extrsemuequ extrsemueuq extrsemuueq extrsemuuqe extrsemuque extrsemuqeu extrsemuuqe extrsemuueq extrsemueuq extrsemuequ
extrqmuseue extrqmuseeu extrqmusuee extrqmusuee extrqmuseue extrqmuseeu extrqmuesue extrqmueseu extrqmueuse extrqmueues
extrqmueeus extrqmueesu extrqmuuese extrqmuuees extrqmuusee extrqmuusee extrqmuuese extrqmuuees extrqmueeus extrqmueesu
extrqmueues extrqmueuse extrqmuesue extrqmueseu extrqmsueue extrqmsueeu extrqmsuuee extrqmsuuee extrqmsueue extrqmsueeu
extrqmseuue extrqmseueu extrqmseuue extrqmseueu extrqmseeuu extrqmseeuu extrqmsueue extrqmsueeu extrqmsuuee extrqmsuuee
extrqmsueue extrqmsueeu extrqmseeuu extrqmseeuu extrqmseueu extrqmseuue extrqmseuue extrqmseueu extrqmesuue extrqmesueu
extrqmesuue extrqmesueu extrqmeseuu extrqmeseuu extrqmeusue extrqmeuseu extrqmeuuse extrqmeuues extrqmeueus extrqmeuesu
extrqmeuuse extrqmeuues extrqmeusue extrqmeuseu extrqmeuesu extrqmeueus extrqmeeuus extrqmeeusu extrqmeeuus extrqmeeusu
extrqmeesuu extrqmeesuu extrqmuseue extrqmuseeu extrqmusuee extrqmusuee extrqmuseue extrqmuseeu extrqmuesue extrqmueseu
extrqmueuse extrqmueues extrqmueeus extrqmueesu extrqmuuese extrqmuuees extrqmuusee extrqmuusee extrqmuuese extrqmuuees
extrqmueeus extrqmueesu extrqmueues extrqmueuse extrqmuesue extrqmueseu extrqmeseuu extrqmeseuu extrqmesueu extrqmesuue
extrqmesuue extrqmesueu extrqmeesuu extrqmeesuu extrqmeeusu extrqmeeuus extrqmeeuus extrqmeeusu extrqmeuesu extrqmeueus
extrqmeuseu extrqmeusue extrqmeuuse extrqmeuues extrqmeueus extrqmeuesu extrqmeuues extrqmeuuse extrqmeusue extrqmeuseu
extrqumseue extrqumseeu extrqumsuee extrqumsuee extrqumseue extrqumseeu extrqumesue extrqumeseu extrqumeuse extrqumeues
extrqumeeus extrqumeesu extrqumuese extrqumuees extrqumusee extrqumusee extrqumuese extrqumuees extrqumeeus extrqumeesu
extrqumeues extrqumeuse extrqumesue extrqumeseu extrqusmeue extrqusmeeu extrqusmuee extrqusmuee extrqusmeue extrqusmeeu
extrqusemue extrqusemeu extrquseume extrquseuem extrquseeum extrquseemu extrqusueme extrqusueem extrqusumee extrqusumee
extrqusueme extrqusueem extrquseeum extrquseemu extrquseuem extrquseume extrqusemue extrqusemeu extrquesmue extrquesmeu
extrquesume extrquesuem extrqueseum extrquesemu extrquemsue extrquemseu extrquemuse extrquemues extrquemeus extrquemesu
extrqueumse extrqueumes extrqueusme extrqueusem extrqueuesm extrqueuems extrqueemus extrqueemsu extrqueeums extrqueeusm
extrqueesum extrqueesmu extrquuseme extrquuseem extrquusmee extrquusmee extrquuseme extrquuseem extrquuesme extrquuesem
extrquuemse extrquuemes extrquueems extrquueesm extrquumese extrquumees extrquumsee extrquumsee extrquumese extrquumees
extrquueems extrquueesm extrquuemes extrquuemse extrquuesme extrquuesem extrqueseum extrquesemu extrquesuem extrquesume
extrquesmue extrquesmeu extrqueesum extrqueesmu extrqueeusm extrqueeums extrqueemus extrqueemsu extrqueuesm extrqueuems
extrqueusem extrqueusme extrqueumse extrqueumes extrquemeus extrquemesu extrquemues extrquemuse extrquemsue extrquemseu
extrqsumeue extrqsumeeu extrqsumuee extrqsumuee extrqsumeue extrqsumeeu extrqsuemue extrqsuemeu extrqsueume extrqsueuem
extrqsueeum extrqsueemu extrqsuueme extrqsuueem extrqsuumee extrqsuumee extrqsuueme extrqsuueem extrqsueeum extrqsueemu
extrqsueuem extrqsueume extrqsuemue extrqsuemeu extrqsmueue extrqsmueeu extrqsmuuee extrqsmuuee extrqsmueue extrqsmueeu
extrqsmeuue extrqsmeueu extrqsmeuue extrqsmeueu extrqsmeeuu extrqsmeeuu extrqsmueue extrqsmueeu extrqsmuuee extrqsmuuee
extrqsmueue extrqsmueeu extrqsmeeuu extrqsmeeuu extrqsmeueu extrqsmeuue extrqsmeuue extrqsmeueu extrqsemuue extrqsemueu
extrqsemuue extrqsemueu extrqsemeuu extrqsemeuu extrqseumue extrqseumeu extrqseuume extrqseuuem extrqseueum extrqseuemu
extrqseuume extrqseuuem extrqseumue extrqseumeu extrqseuemu extrqseueum extrqseeuum extrqseeumu extrqseeuum extrqseeumu
extrqseemuu extrqseemuu extrqsumeue extrqsumeeu extrqsumuee extrqsumuee extrqsumeue extrqsumeeu extrqsuemue extrqsuemeu
extrqsueume extrqsueuem extrqsueeum extrqsueemu extrqsuueme extrqsuueem extrqsuumee extrqsuumee extrqsuueme extrqsuueem
extrqsueeum extrqsueemu extrqsueuem extrqsueume extrqsuemue extrqsuemeu extrqsemeuu extrqsemeuu extrqsemueu extrqsemuue
extrqsemuue extrqsemueu extrqseemuu extrqseemuu extrqseeumu extrqseeuum extrqseeuum extrqseeumu extrqseuemu extrqseueum
extrqseumeu extrqseumue extrqseuume extrqseuuem extrqseueum extrqseuemu extrqseuuem extrqseuume extrqseumue extrqseumeu
extrqeusmue extrqeusmeu extrqeusume extrqeusuem extrqeuseum extrqeusemu extrqeumsue extrqeumseu extrqeumuse extrqeumues
extrqeumeus extrqeumesu extrqeuumse extrqeuumes extrqeuusme extrqeuusem extrqeuuesm extrqeuuems extrqeuemus extrqeuemsu
extrqeueums extrqeueusm extrqeuesum extrqeuesmu extrqesumue extrqesumeu extrqesuume extrqesuuem extrqesueum extrqesuemu
extrqesmuue extrqesmueu extrqesmuue extrqesmueu extrqesmeuu extrqesmeuu extrqesumue extrqesumeu extrqesuume extrqesuuem
extrqesueum extrqesuemu extrqesemuu extrqesemuu extrqeseumu extrqeseuum extrqeseuum extrqeseumu extrqemsuue extrqemsueu
extrqemsuue extrqemsueu extrqemseuu extrqemseuu extrqemusue extrqemuseu extrqemuuse extrqemuues extrqemueus extrqemuesu
extrqemuuse extrqemuues extrqemusue extrqemuseu extrqemuesu extrqemueus extrqemeuus extrqemeusu extrqemeuus extrqemeusu
extrqemesuu extrqemesuu extrqeusmue extrqeusmeu extrqeusume extrqeusuem extrqeuseum extrqeusemu extrqeumsue extrqeumseu
extrqeumuse extrqeumues extrqeumeus extrqeumesu extrqeuumse extrqeuumes extrqeuusme extrqeuusem extrqeuuesm extrqeuuems
extrqeuemus extrqeuemsu extrqeueums extrqeueusm extrqeuesum extrqeuesmu extrqeesmuu extrqeesmuu extrqeesumu extrqeesuum
extrqeesuum extrqeesumu extrqeemsuu extrqeemsuu extrqeemusu extrqeemuus extrqeemuus extrqeemusu extrqeeumsu extrqeeumus
extrqeeusmu extrqeeusum extrqeeuusm extrqeeuums extrqeeumus extrqeeumsu extrqeeuums extrqeeuusm extrqeeusum extrqeeusmu
extrquuseme extrquuseem extrquusmee extrquusmee extrquuseme extrquuseem extrquuesme extrquuesem extrquuemse extrquuemes
extrquueems extrquueesm extrquumese extrquumees extrquumsee extrquumsee extrquumese extrquumees extrquueems extrquueesm
extrquuemes extrquuemse extrquuesme extrquuesem extrqusueme extrqusueem extrqusumee extrqusumee extrqusueme extrqusueem
extrquseume extrquseuem extrqusemue extrqusemeu extrquseemu extrquseeum extrqusmeue extrqusmeeu extrqusmuee extrqusmuee
extrqusmeue extrqusmeeu extrquseemu extrquseeum extrqusemeu extrqusemue extrquseume extrquseuem extrquesume extrquesuem
extrquesmue extrquesmeu extrquesemu extrqueseum extrqueusme extrqueusem extrqueumse extrqueumes extrqueuems extrqueuesm
extrquemuse extrquemues extrquemsue extrquemseu extrquemesu extrquemeus extrqueeums extrqueeusm extrqueemus extrqueemsu
extrqueesmu extrqueesum extrqumseue extrqumseeu extrqumsuee extrqumsuee extrqumseue extrqumseeu extrqumesue extrqumeseu
extrqumeuse extrqumeues extrqumeeus extrqumeesu extrqumuese extrqumuees extrqumusee extrqumusee extrqumuese extrqumuees
extrqumeeus extrqumeesu extrqumeues extrqumeuse extrqumesue extrqumeseu extrquesemu extrqueseum extrquesmeu extrquesmue
extrquesume extrquesuem extrqueesmu extrqueesum extrqueemsu extrqueemus extrqueeums extrqueeusm extrquemesu extrquemeus
extrquemseu extrquemsue extrquemuse extrquemues extrqueuems extrqueuesm extrqueumes extrqueumse extrqueusme extrqueusem
extrqeuseum extrqeusemu extrqeusuem extrqeusume extrqeusmue extrqeusmeu extrqeuesum extrqeuesmu extrqeueusm extrqeueums
extrqeuemus extrqeuemsu extrqeuuesm extrqeuuems extrqeuusem extrqeuusme extrqeuumse extrqeuumes extrqeumeus extrqeumesu
extrqeumues extrqeumuse extrqeumsue extrqeumseu extrqesueum extrqesuemu extrqesuuem extrqesuume extrqesumue extrqesumeu
extrqeseuum extrqeseumu extrqeseuum extrqeseumu extrqesemuu extrqesemuu extrqesueum extrqesuemu extrqesuuem extrqesuume
extrqesumue extrqesumeu extrqesmeuu extrqesmeuu extrqesmueu extrqesmuue extrqesmuue extrqesmueu extrqeesuum extrqeesumu
extrqeesuum extrqeesumu extrqeesmuu extrqeesmuu extrqeeusum extrqeeusmu extrqeeuusm extrqeeuums extrqeeumus extrqeeumsu
extrqeeuusm extrqeeuums extrqeeusum extrqeeusmu extrqeeumsu extrqeeumus extrqeemuus extrqeemusu extrqeemuus extrqeemusu
extrqeemsuu extrqeemsuu extrqeuseum extrqeusemu extrqeusuem extrqeusume extrqeusmue extrqeusmeu extrqeuesum extrqeuesmu
extrqeueusm extrqeueums extrqeuemus extrqeuemsu extrqeuuesm extrqeuuems extrqeuusem extrqeuusme extrqeuumse extrqeuumes
extrqeumeus extrqeumesu extrqeumues extrqeumuse extrqeumsue extrqeumseu extrqemseuu extrqemseuu extrqemsueu extrqemsuue
extrqemsuue extrqemsueu extrqemesuu extrqemesuu extrqemeusu extrqemeuus extrqemeuus extrqemeusu extrqemuesu extrqemueus
extrqemuseu extrqemusue extrqemuuse extrqemuues extrqemueus extrqemuesu extrqemuues extrqemuuse extrqemusue extrqemuseu
extrumusqee extrumusqee extrumuseqe extrumuseeq extrumuseeq extrumuseqe extrumuqsee extrumuqsee extrumuqese extrumuqees
extrumuqees extrumuqese extrumueqse extrumueqes extrumuesqe extrumueseq extrumueesq extrumueeqs extrumueqes extrumueqse
extrumueeqs extrumueesq extrumueseq extrumuesqe extrumsuqee extrumsuqee extrumsueqe extrumsueeq extrumsueeq extrumsueqe
extrumsquee extrumsquee extrumsqeue extrumsqeeu extrumsqeeu extrumsqeue extrumseque extrumseqeu extrumseuqe extrumseueq
extrumseeuq extrumseequ extrumseqeu extrumseque extrumseequ extrumseeuq extrumseueq extrumseuqe extrumqsuee extrumqsuee
extrumqseue extrumqseeu extrumqseeu extrumqseue extrumqusee extrumqusee extrumquese extrumquees extrumquees extrumquese
extrumqeuse extrumqeues extrumqesue extrumqeseu extrumqeesu extrumqeeus extrumqeues extrumqeuse extrumqeeus extrumqeesu
extrumqeseu extrumqesue extrumesque extrumesqeu extrumesuqe extrumesueq extrumeseuq extrumesequ extrumeqsue extrumeqseu
extrumequse extrumeques extrumeqeus extrumeqesu extrumeuqse extrumeuqes extrumeusqe extrumeuseq extrumeuesq extrumeueqs
extrumeequs extrumeeqsu extrumeeuqs extrumeeusq extrumeesuq extrumeesqu extrumesqeu extrumesque extrumesequ extrumeseuq
extrumesueq extrumesuqe extrumeqseu extrumeqsue extrumeqesu extrumeqeus extrumeques extrumequse extrumeeqsu extrumeequs
extrumeesqu extrumeesuq extrumeeusq extrumeeuqs extrumeuqes extrumeuqse extrumeueqs extrumeuesq extrumeuseq extrumeusqe
extruumsqee extruumsqee extruumseqe extruumseeq extruumseeq extruumseqe extruumqsee extruumqsee extruumqese extruumqees
extruumqees extruumqese extruumeqse extruumeqes extruumesqe extruumeseq extruumeesq extruumeeqs extruumeqes extruumeqse
extruumeeqs extruumeesq extruumeseq extruumesqe extruusmqee extruusmqee extruusmeqe extruusmeeq extruusmeeq extruusmeqe
extruusqmee extruusqmee extruusqeme extruusqeem extruusqeem extruusqeme extruuseqme extruuseqem extruusemqe extruusemeq
extruuseemq extruuseeqm extruuseqem extruuseqme extruuseeqm extruuseemq extruusemeq extruusemqe extruuqsmee extruuqsmee
extruuqseme extruuqseem extruuqseem extruuqseme extruuqmsee extruuqmsee extruuqmese extruuqmees extruuqmees extruuqmese
extruuqemse extruuqemes extruuqesme extruuqesem extruuqeesm extruuqeems extruuqemes extruuqemse extruuqeems extruuqeesm
extruuqesem extruuqesme extruuesqme extruuesqem extruuesmqe extruuesmeq extruuesemq extruueseqm extruueqsme extruueqsem
extruueqmse extruueqmes extruueqems extruueqesm extruuemqse extruuemqes extruuemsqe extruuemseq extruuemesq extruuemeqs
extruueeqms extruueeqsm extruueemqs extruueemsq extruueesmq extruueesqm extruuesqem extruuesqme extruueseqm extruuesemq
extruuesmeq extruuesmqe extruueqsem extruueqsme extruueqesm extruueqems extruueqmes extruueqmse extruueeqsm extruueeqms
extruueesqm extruueesmq extruueemsq extruueemqs extruuemqes extruuemqse extruuemeqs extruuemesq extruuemseq extruuemsqe
extrusumqee extrusumqee extrusumeqe extrusumeeq extrusumeeq extrusumeqe extrusuqmee extrusuqmee extrusuqeme extrusuqeem
extrusuqeem extrusuqeme extrusueqme extrusueqem extrusuemqe extrusuemeq extrusueemq extrusueeqm extrusueqem extrusueqme
extrusueeqm extrusueemq extrusuemeq extrusuemqe extrusmuqee extrusmuqee extrusmueqe extrusmueeq extrusmueeq extrusmueqe
extrusmquee extrusmquee extrusmqeue extrusmqeeu extrusmqeeu extrusmqeue extrusmeque extrusmeqeu extrusmeuqe extrusmeueq
extrusmeeuq extrusmeequ extrusmeqeu extrusmeque extrusmeequ extrusmeeuq extrusmeueq extrusmeuqe extrusqmuee extrusqmuee
extrusqmeue extrusqmeeu extrusqmeeu extrusqmeue extrusqumee extrusqumee extrusqueme extrusqueem extrusqueem extrusqueme
extrusqeume extrusqeuem extrusqemue extrusqemeu extrusqeemu extrusqeeum extrusqeuem extrusqeume extrusqeeum extrusqeemu
extrusqemeu extrusqemue extrusemque extrusemqeu extrusemuqe extrusemueq extrusemeuq extrusemequ extruseqmue extruseqmeu
extrusequme extrusequem extruseqeum extruseqemu extruseuqme extruseuqem extruseumqe extruseumeq extruseuemq extruseueqm
extruseequm extruseeqmu extruseeuqm extruseeumq extruseemuq extruseemqu extrusemqeu extrusemque extrusemequ extrusemeuq
extrusemueq extrusemuqe extruseqmeu extruseqmue extruseqemu extruseqeum extrusequem extrusequme extruseeqmu extruseequm
extruseemqu extruseemuq extruseeumq extruseeuqm extruseuqem extruseuqme extruseueqm extruseuemq extruseumeq extruseumqe
extruqusmee extruqusmee extruquseme extruquseem extruquseem extruquseme extruqumsee extruqumsee extruqumese extruqumees
extruqumees extruqumese extruquemse extruquemes extruquesme extruquesem extruqueesm extruqueems extruquemes extruquemse
extruqueems extruqueesm extruquesem extruquesme extruqsumee extruqsumee extruqsueme extruqsueem extruqsueem extruqsueme
extruqsmuee extruqsmuee extruqsmeue extruqsmeeu extruqsmeeu extruqsmeue extruqsemue extruqsemeu extruqseume extruqseuem
extruqseeum extruqseemu extruqsemeu extruqsemue extruqseemu extruqseeum extruqseuem extruqseume extruqmsuee extruqmsuee
extruqmseue extruqmseeu extruqmseeu extruqmseue extruqmusee extruqmusee extruqmuese extruqmuees extruqmuees extruqmuese
extruqmeuse extruqmeues extruqmesue extruqmeseu extruqmeesu extruqmeeus extruqmeues extruqmeuse extruqmeeus extruqmeesu
extruqmeseu extruqmesue extruqesmue extruqesmeu extruqesume extruqesuem extruqeseum extruqesemu extruqemsue extruqemseu
extruqemuse extruqemues extruqemeus extruqemesu extruqeumse extruqeumes extruqeusme extruqeusem extruqeuesm extruqeuems
extruqeemus extruqeemsu extruqeeums extruqeeusm extruqeesum extruqeesmu extruqesmeu extruqesmue extruqesemu extruqeseum
extruqesuem extruqesume extruqemseu extruqemsue extruqemesu extruqemeus extruqemues extruqemuse extruqeemsu extruqeemus
extruqeesmu extruqeesum extruqeeusm extruqeeums extruqeumes extruqeumse extruqeuems extruqeuesm extruqeusem extruqeusme
extrueusqme extrueusqem extrueusmqe extrueusmeq extrueusemq extrueuseqm extrueuqsme extrueuqsem extrueuqmse extrueuqmes
extrueuqems extrueuqesm extrueumqse extrueumqes extrueumsqe extrueumseq extrueumesq extrueumeqs extrueueqms extrueueqsm
extrueuemqs extrueuemsq extrueuesmq extrueuesqm extruesuqme extruesuqem extruesumqe extruesumeq extruesuemq extruesueqm
extruesqume extruesquem extruesqmue extruesqmeu extruesqemu extruesqeum extruesmque extruesmqeu extruesmuqe extruesmueq
extruesmeuq extruesmequ extrueseqmu extruesequm extruesemqu extruesemuq extrueseumq extrueseuqm extrueqsume extrueqsuem
extrueqsmue extrueqsmeu extrueqsemu extrueqseum extruequsme extruequsem extruequmse extruequmes extruequems extruequesm
extrueqmuse extrueqmues extrueqmsue extrueqmseu extrueqmesu extrueqmeus extrueqeums extrueqeusm extrueqemus extrueqemsu
extrueqesmu extrueqesum extruemsque extruemsqeu extruemsuqe extruemsueq extruemseuq extruemsequ extruemqsue extruemqseu
extruemquse extruemques extruemqeus extruemqesu extruemuqse extruemuqes extruemusqe extruemuseq extruemuesq extruemueqs
extruemequs extruemeqsu extruemeuqs extruemeusq extruemesuq extruemesqu extrueesqmu extrueesqum extrueesmqu extrueesmuq
extrueesumq extrueesuqm extrueeqsmu extrueeqsum extrueeqmsu extrueeqmus extrueequms extrueequsm extrueemqsu extrueemqus
extrueemsqu extrueemsuq extrueemusq extrueemuqs extrueeuqms extrueeuqsm extrueeumqs extrueeumsq extrueeusmq extrueeusqm
extrueusqem extrueusqme extrueuseqm extrueusemq extrueusmeq extrueusmqe extrueuqsem extrueuqsme extrueuqesm extrueuqems
extrueuqmes extrueuqmse extrueueqsm extrueueqms extrueuesqm extrueuesmq extrueuemsq extrueuemqs extrueumqes extrueumqse
extrueumeqs extrueumesq extrueumseq extrueumsqe extruesuqem extruesuqme extruesueqm extruesuemq extruesumeq extruesumqe
extruesquem extruesqume extruesqeum extruesqemu extruesqmeu extruesqmue extruesequm extrueseqmu extrueseuqm extrueseumq
extruesemuq extruesemqu extruesmqeu extruesmque extruesmequ extruesmeuq extruesmueq extruesmuqe extrueqsuem extrueqsume
extrueqseum extrueqsemu extrueqsmeu extrueqsmue extruequsem extruequsme extruequesm extruequems extruequmes extruequmse
extrueqeusm extrueqeums extrueqesum extrueqesmu extrueqemsu extrueqemus extrueqmues extrueqmuse extrueqmeus extrueqmesu
extrueqmseu extrueqmsue extrueesqum extrueesqmu extrueesuqm extrueesumq extrueesmuq extrueesmqu extrueeqsum extrueeqsmu
extrueequsm extrueequms extrueeqmus extrueeqmsu extrueeuqsm extrueeuqms extrueeusqm extrueeusmq extrueeumsq extrueeumqs
extrueemqus extrueemqsu extrueemuqs extrueemusq extrueemsuq extrueemsqu extruemsqeu extruemsque extruemsequ extruemseuq
extruemsueq extruemsuqe extruemqseu extruemqsue extruemqesu extruemqeus extruemques extruemquse extruemeqsu extruemequs
extruemesqu extruemesuq extruemeusq extruemeuqs extruemuqes extruemuqse extruemueqs extruemuesq extruemuseq extruemusqe
extremusque extremusqeu extremusuqe extremusueq extremuseuq extremusequ extremuqsue extremuqseu extremuquse extremuques
extremuqeus extremuqesu extremuuqse extremuuqes extremuusqe extremuuseq extremuuesq extremuueqs extremuequs extremueqsu
extremueuqs extremueusq extremuesuq extremuesqu extremsuque extremsuqeu extremsuuqe extremsuueq extremsueuq extremsuequ
extremsquue extremsqueu extremsquue extremsqueu extremsqeuu extremsqeuu extremsuque extremsuqeu extremsuuqe extremsuueq
extremsueuq extremsuequ extremsequu extremsequu extremseuqu extremseuuq extremseuuq extremseuqu extremqsuue extremqsueu
extremqsuue extremqsueu extremqseuu extremqseuu extremqusue extremquseu extremquuse extremquues extremqueus extremquesu
extremquuse extremquues extremqusue extremquseu extremquesu extremqueus extremqeuus extremqeusu extremqeuus extremqeusu
extremqesuu extremqesuu extremusque extremusqeu extremusuqe extremusueq extremuseuq extremusequ extremuqsue extremuqseu
extremuquse extremuques extremuqeus extremuqesu extremuuqse extremuuqes extremuusqe extremuuseq extremuuesq extremuueqs
extremuequs extremueqsu extremueuqs extremueusq extremuesuq extremuesqu extremesquu extremesquu extremesuqu extremesuuq
extremesuuq extremesuqu extremeqsuu extremeqsuu extremequsu extremequus extremequus extremequsu extremeuqsu extremeuqus
extremeusqu extremeusuq extremeuusq extremeuuqs extremeuqus extremeuqsu extremeuuqs extremeuusq extremeusuq extremeusqu
extreumsque extreumsqeu extreumsuqe extreumsueq extreumseuq extreumsequ extreumqsue extreumqseu extreumquse extreumques
extreumqeus extreumqesu extreumuqse extreumuqes extreumusqe extreumuseq extreumuesq extreumueqs extreumequs extreumeqsu
extreumeuqs extreumeusq extreumesuq extreumesqu extreusmque extreusmqeu extreusmuqe extreusmueq extreusmeuq extreusmequ
extreusqmue extreusqmeu extreusqume extreusquem extreusqeum extreusqemu extreusuqme extreusuqem extreusumqe extreusumeq
extreusuemq extreusueqm extreusequm extreuseqmu extreuseuqm extreuseumq extreusemuq extreusemqu extreuqsmue extreuqsmeu
extreuqsume extreuqsuem extreuqseum extreuqsemu extreuqmsue extreuqmseu extreuqmuse extreuqmues extreuqmeus extreuqmesu
extreuqumse extreuqumes extreuqusme extreuqusem extreuquesm extreuquems extreuqemus extreuqemsu extreuqeums extreuqeusm
extreuqesum extreuqesmu extreuusqme extreuusqem extreuusmqe extreuusmeq extreuusemq extreuuseqm extreuuqsme extreuuqsem
extreuuqmse extreuuqmes extreuuqems extreuuqesm extreuumqse extreuumqes extreuumsqe extreuumseq extreuumesq extreuumeqs
extreuueqms extreuueqsm extreuuemqs extreuuemsq extreuuesmq extreuuesqm extreuesqum extreuesqmu extreuesuqm extreuesumq
extreuesmuq extreuesmqu extreueqsum extreueqsmu extreuequsm extreuequms extreueqmus extreueqmsu extreueuqsm extreueuqms
extreueusqm extreueusmq extreueumsq extreueumqs extreuemqus extreuemqsu extreuemuqs extreuemusq extreuemsuq extreuemsqu
extresumque extresumqeu extresumuqe extresumueq extresumeuq extresumequ extresuqmue extresuqmeu extresuqume extresuquem
extresuqeum extresuqemu extresuuqme extresuuqem extresuumqe extresuumeq extresuuemq extresuueqm extresuequm extresueqmu
extresueuqm extresueumq extresuemuq extresuemqu extresmuque extresmuqeu extresmuuqe extresmuueq extresmueuq extresmuequ
extresmquue extresmqueu extresmquue extresmqueu extresmqeuu extresmqeuu extresmuque extresmuqeu extresmuuqe extresmuueq
extresmueuq extresmuequ extresmequu extresmequu extresmeuqu extresmeuuq extresmeuuq extresmeuqu extresqmuue extresqmueu
extresqmuue extresqmueu extresqmeuu extresqmeuu extresqumue extresqumeu extresquume extresquuem extresqueum extresquemu
extresquume extresquuem extresqumue extresqumeu extresquemu extresqueum extresqeuum extresqeumu extresqeuum extresqeumu
extresqemuu extresqemuu extresumque extresumqeu extresumuqe extresumueq extresumeuq extresumequ extresuqmue extresuqmeu
extresuqume extresuquem extresuqeum extresuqemu extresuuqme extresuuqem extresuumqe extresuumeq extresuuemq extresuueqm
extresuequm extresueqmu extresueuqm extresueumq extresuemuq extresuemqu extresemquu extresemquu extresemuqu extresemuuq
extresemuuq extresemuqu extreseqmuu extreseqmuu extresequmu extresequum extresequum extresequmu extreseuqmu extreseuqum
extreseumqu extreseumuq extreseuumq extreseuuqm extreseuqum extreseuqmu extreseuuqm extreseuumq extreseumuq extreseumqu
extrequsmue extrequsmeu extrequsume extrequsuem extrequseum extrequsemu extrequmsue extrequmseu extrequmuse extrequmues
extrequmeus extrequmesu extrequumse extrequumes extrequusme extrequusem extrequuesm extrequuems extrequemus extrequemsu
extrequeums extrequeusm extrequesum extrequesmu extreqsumue extreqsumeu extreqsuume extreqsuuem extreqsueum extreqsuemu
extreqsmuue extreqsmueu extreqsmuue extreqsmueu extreqsmeuu extreqsmeuu extreqsumue extreqsumeu extreqsuume extreqsuuem
extreqsueum extreqsuemu extreqsemuu extreqsemuu extreqseumu extreqseuum extreqseuum extreqseumu extreqmsuue extreqmsueu
extreqmsuue extreqmsueu extreqmseuu extreqmseuu extreqmusue extreqmuseu extreqmuuse extreqmuues extreqmueus extreqmuesu
extreqmuuse extreqmuues extreqmusue extreqmuseu extreqmuesu extreqmueus extreqmeuus extreqmeusu extreqmeuus extreqmeusu
extreqmesuu extreqmesuu extrequsmue extrequsmeu extrequsume extrequsuem extrequseum extrequsemu extrequmsue extrequmseu
extrequmuse extrequmues extrequmeus extrequmesu extrequumse extrequumes extrequusme extrequusem extrequuesm extrequuems
extrequemus extrequemsu extrequeums extrequeusm extrequesum extrequesmu extreqesmuu extreqesmuu extreqesumu extreqesuum
extreqesuum extreqesumu extreqemsuu extreqemsuu extreqemusu extreqemuus extreqemuus extreqemusu extreqeumsu extreqeumus
extreqeusmu extreqeusum extreqeuusm extreqeuums extreqeumus extreqeumsu extreqeuums extreqeuusm extreqeusum extreqeusmu
extreuusqme extreuusqem extreuusmqe extreuusmeq extreuusemq extreuuseqm extreuuqsme extreuuqsem extreuuqmse extreuuqmes
extreuuqems extreuuqesm extreuumqse extreuumqes extreuumsqe extreuumseq extreuumesq extreuumeqs extreuueqms extreuueqsm
extreuuemqs extreuuemsq extreuuesmq extreuuesqm extreusuqme extreusuqem extreusumqe extreusumeq extreusuemq extreusueqm
extreusqume extreusquem extreusqmue extreusqmeu extreusqemu extreusqeum extreusmque extreusmqeu extreusmuqe extreusmueq
extreusmeuq extreusmequ extreuseqmu extreusequm extreusemqu extreusemuq extreuseumq extreuseuqm extreuqsume extreuqsuem
extreuqsmue extreuqsmeu extreuqsemu extreuqseum extreuqusme extreuqusem extreuqumse extreuqumes extreuquems extreuquesm
extreuqmuse extreuqmues extreuqmsue extreuqmseu extreuqmesu extreuqmeus extreuqeums extreuqeusm extreuqemus extreuqemsu
extreuqesmu extreuqesum extreumsque extreumsqeu extreumsuqe extreumsueq extreumseuq extreumsequ extreumqsue extreumqseu
extreumquse extreumques extreumqeus extreumqesu extreumuqse extreumuqes extreumusqe extreumuseq extreumuesq extreumueqs
extreumequs extreumeqsu extreumeuqs extreumeusq extreumesuq extreumesqu extreuesqmu extreuesqum extreuesmqu extreuesmuq
extreuesumq extreuesuqm extreueqsmu extreueqsum extreueqmsu extreueqmus extreuequms extreuequsm extreuemqsu extreuemqus
extreuemsqu extreuemsuq extreuemusq extreuemuqs extreueuqms extreueuqsm extreueumqs extreueumsq extreueusmq extreueusqm
extreeusqum extreeusqmu extreeusuqm extreeusumq extreeusmuq extreeusmqu extreeuqsum extreeuqsmu extreeuqusm extreeuqums
extreeuqmus extreeuqmsu extreeuuqsm extreeuuqms extreeuusqm extreeuusmq extreeuumsq extreeuumqs extreeumqus extreeumqsu
extreeumuqs extreeumusq extreeumsuq extreeumsqu extreesuqum extreesuqmu extreesuuqm extreesuumq extreesumuq extreesumqu
extreesquum extreesqumu extreesquum extreesqumu extreesqmuu extreesqmuu extreesuqum extreesuqmu extreesuuqm extreesuumq
extreesumuq extreesumqu extreesmquu extreesmquu extreesmuqu extreesmuuq extreesmuuq extreesmuqu extreeqsuum extreeqsumu
extreeqsuum extreeqsumu extreeqsmuu extreeqsmuu extreequsum extreequsmu extreequusm extreequums extreequmus extreequmsu
extreequusm extreequums extreequsum extreequsmu extreequmsu extreequmus extreeqmuus extreeqmusu extreeqmuus extreeqmusu
extreeqmsuu extreeqmsuu extreeusqum extreeusqmu extreeusuqm extreeusumq extreeusmuq extreeusmqu extreeuqsum extreeuqsmu
extreeuqusm extreeuqums extreeuqmus extreeuqmsu extreeuuqsm extreeuuqms extreeuusqm extreeuusmq extreeuumsq extreeuumqs
extreeumqus extreeumqsu extreeumuqs extreeumusq extreeumsuq extreeumsqu extreemsquu extreemsquu extreemsuqu extreemsuuq
extreemsuuq extreemsuqu extreemqsuu extreemqsuu extreemqusu extreemquus extreemquus extreemqusu extreemuqsu extreemuqus
extreemusqu extreemusuq extreemuusq extreemuuqs extreemuqus extreemuqsu extreemuuqs extreemuusq extreemusuq extreemusqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us