easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

astell

chamb

certavistisque

cartee

skrowaczewski

sebasti

intitles

saccular

tollito

savine

litation

sackamaker

rakers

malvacearum

stiffelio

campbelle

weippe

prety


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: essayers
cipher variations:
fttbzfst guucagtu hvvdbhuv iwwecivw jxxfdjwx
kyygekxy lzzhflyz maaigmza nbbjhnab occkiobc
pddljpcd qeemkqde rffnlref sggomsfg thhpntgh
uiiqouhi vjjrpvij wkksqwjk xlltrxkl ymmusylm
znnvtzmn aoowuano bppxvbop cqqywcpq drrzxdqr

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: essayers
Cipher: vhhzbvih

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: essayers
Cipher: AABAA BAAAB BAAAB AAAAA BABBA AABAA BAAAA BAAAB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: essayers
cipher variations:
fttbzfstnddbvnadvnnbrvindxxbndqxlhhbjlyhtrrbftgrjllbxjwlrvvbtrev
zffbpzmfhppblhuppzzbhpczxjjbdxkjguucagtuoeecwobewoocswjoeyycoery
miickmziusscguhskmmcykxmswwcusfwaggcqangiqqcmivqqaaciqdaykkceylk
hvvdbhuvpffdxpcfxppdtxkpfzzdpfsznjjdlnajvttdhvitlnndzlyntxxdvtgx
bhhdrbohjrrdnjwrrbbdjrebzlldfzmliwwecivwqggeyqdgyqqeuylqgaaeqgta
okkemobkwuueiwjumooeamzouyyewuhyciiescpiksseokxsscceksfcammeganm
jxxfdjwxrhhfzrehzrrfvzmrhbbfrhubpllfnpclxvvfjxkvnppfbnapvzzfxviz
djjftdqjlttfplyttddfltgdbnnfhbonkyygekxysiigasfiassgwansiccgsivc
qmmgoqdmywwgkylwoqqgcobqwaagywjaekkguerkmuugqmzuueegmuhecoogicpo
lzzhflyztjjhbtgjbtthxbotjddhtjwdrnnhprenzxxhlzmxprrhdpcrxbbhzxkb
fllhvfslnvvhrnavvffhnvifdpphjdqpmaaigmzaukkicuhkcuuiycpukeeiukxe
sooiqsfoayyimanyqssieqdsycciaylcgmmiwgtmowwisobwwggiowjgeqqikerq
nbbjhnabvlljdvildvvjzdqvlffjvlyftppjrtgpbzzjnbozrttjfretzddjbzmd
hnnjxhunpxxjtpcxxhhjpxkhfrrjlfsrocckiobcwmmkewjmewwkaerwmggkwmzg
uqqksuhqcaakocpasuukgsfuaeekcaneiookyivoqyykuqdyyiikqyligsskmgts
pddljpcdxnnlfxknfxxlbfsxnhhlxnahvrrltvirdbblpdqbtvvlhtgvbffldbof
jpplzjwprzzlvrezzjjlrzmjhttlnhutqeemkqdeyoomgylogyymcgtyoiimyobi
wssmuwjseccmqercuwwmiuhwcggmecpgkqqmakxqsaamwsfaakkmsankiuumoivu
rffnlrefzppnhzmphzzndhuzpjjnzpcjxttnvxktfddnrfsdvxxnjvixdhhnfdqh
lrrnblyrtbbnxtgbbllntboljvvnpjwvsggomsfgaqqoianqiaaoeivaqkkoaqdk
yuuowylugeeosgtewyyokwjyeiiogerimssocmzsuccoyuhccmmoucpmkwwoqkxw
thhpntghbrrpjborjbbpfjwbrllpbrelzvvpxzmvhffpthufxzzplxkzfjjphfsj
nttpdnatvddpzviddnnpvdqnlxxprlyxuiiqouhicssqkcpskccqgkxcsmmqcsfm
awwqyanwiggquivgyaaqmylagkkqigtkouuqeobuweeqawjeeooqweromyyqsmzy
vjjrpvijdttrldqtlddrhlydtnnrdtgnbxxrzboxjhhrvjwhzbbrnzmbhllrjhul
pvvrfpcvxffrbxkffpprxfspnzzrtnazwkksqwjkeuusmerumeesimzeuooseuho
cyysacpykiiswkxiaccsoancimmskivmqwwsgqdwyggscylggqqsygtqoaasuoba
xlltrxklfvvtnfsvnfftjnafvpptfvipdzztbdqzljjtxlyjbddtpbodjnntljwn
rxxthrexzhhtdzmhhrrtzhurpbbtvpcbymmusylmgwwuogtwoggukobgwqqugwjq
eaauceramkkuymzkceeuqcpekooumkxosyyuisfyaiiueaniissuaivsqccuwqdc
znnvtzmnhxxvphuxphhvlpchxrrvhxkrfbbvdfsbnllvznaldffvrdqflppvnlyp
tzzvjtgzbjjvfbojjttvbjwtrddvxredaoowuanoiyywqivyqiiwmqdiysswiyls
gccwegtcommwaobmeggwsergmqqwomzquaawkuhackkwgcpkkuuwckxuseewysfe
bppxvbopjzzxrjwzrjjxnrejzttxjzmthddxfhudpnnxbpcnfhhxtfshnrrxpnar
vbbxlvibdllxhdqllvvxdlyvtffxztgfcqqywcpqkaayskxaskkyosfkauuykanu
ieeygiveqooycqdogiiyugtiossyqobswccymwjcemmyiermmwwyemzwuggyauhg
drrzxdqrlbbztlybtllzptglbvvzlbovjffzhjwfrppzdrephjjzvhujpttzrpct
xddznxkdfnnzjfsnnxxzfnaxvhhzbvihessayersmccaumzcummaquhmcwwamcpw
kggaikxgsqqaesfqikkawivkquuasqduyeeaoylegooakgtooyyagobywiiacwji

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: essayers
Cipher: rffnlref

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: essayers
Cipher: 5134341145512434

Extended Methods:
Method #1

Plaintext: essayers
method variations:
kxxfdkwxpcclipbcuhhqoughznnvtzmn

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
e s s a y e r s 
5 3 3 1 4 5 2 3 
1 4 4 1 5 1 4 4 
They are then read out in rows:
5331452314415144
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: essayers
Cipher: pcymqdet

Read more ...
Method #3

Plaintext: essayers
method variations:
lodqzfoy odqzfoyl dqzfoylo
qzfoylod zfoylodq foylodqz
oylodqzf ylodqzfo

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: essayers

first 5040 cipher variations(40320 total)
essayers essayesr essayres essayrse essaysre essayser essaeyrs essaeysr essaerys essaersy essaesry
essaesyr essareys essaresy essaryes essaryse essarsye essarsey essasery essaseyr essasrey essasrye
essasyre essasyer essyaers essyaesr essyares essyarse essyasre essyaser essyears essyeasr essyeras
essyersa essyesra essyesar essyreas essyresa essyraes essyrase essyrsae essyrsea essysera essysear
essysrea essysrae essysare essysaer esseyars esseyasr esseyras esseyrsa esseysra esseysar esseayrs
esseaysr essearys essearsy esseasry esseasyr esserays esserasy esseryas esserysa essersya essersay
essesary essesayr essesray essesrya essesyra essesyar essryeas essryesa essryaes essryase essrysae
essrysea essreyas essreysa essreays essreasy essresay essresya essraeys essraesy essrayes essrayse
essrasye essrasey essrseay essrseya essrsaey essrsaye essrsyae essrsyea esssyera esssyear esssyrea
esssyrae esssyare esssyaer essseyra essseyar essserya essseray essseary essseayr esssreya esssreay
esssryea esssryae esssraye esssraey esssaery esssaeyr esssarey esssarye esssayre esssayer esasyers
esasyesr esasyres esasyrse esasysre esasyser esaseyrs esaseysr esaserys esasersy esasesry esasesyr
esasreys esasresy esasryes esasryse esasrsye esasrsey esassery esasseyr esassrey esassrye esassyre
esassyer esaysers esaysesr esaysres esaysrse esayssre esaysser esayesrs esayessr esayerss esayerss
esayesrs esayessr esayress esayress esayrses esayrsse esayrsse esayrses esaysers esaysesr esaysres
esaysrse esayssre esaysser esaeysrs esaeyssr esaeyrss esaeyrss esaeysrs esaeyssr esaesyrs esaesysr
esaesrys esaesrsy esaessry esaessyr esaersys esaerssy esaeryss esaeryss esaersys esaerssy esaessry
esaessyr esaesrsy esaesrys esaesyrs esaesysr esaryess esaryess esaryses esarysse esarysse esaryses
esareyss esareyss esaresys esaressy esaressy esaresys esarseys esarsesy esarsyes esarsyse esarssye
esarssey esarsesy esarseys esarssey esarssye esarsyse esarsyes esasyers esasyesr esasyres esasyrse
esasysre esasyser esaseyrs esaseysr esaserys esasersy esasesry esasesyr esasreys esasresy esasryes
esasryse esasrsye esasrsey esassery esasseyr esassrey esassrye esassyre esassyer esyasers esyasesr
esyasres esyasrse esyassre esyasser esyaesrs esyaessr esyaerss esyaerss esyaesrs esyaessr esyaress
esyaress esyarses esyarsse esyarsse esyarses esyasers esyasesr esyasres esyasrse esyassre esyasser
esysaers esysaesr esysares esysarse esysasre esysaser esysears esyseasr esyseras esysersa esysesra
esysesar esysreas esysresa esysraes esysrase esysrsae esysrsea esyssera esyssear esyssrea esyssrae
esyssare esyssaer esyesars esyesasr esyesras esyesrsa esyessra esyessar esyeasrs esyeassr esyearss
esyearss esyeasrs esyeassr esyerass esyerass esyersas esyerssa esyerssa esyersas esyesars esyesasr
esyesras esyesrsa esyessra esyessar esyrseas esyrsesa esyrsaes esyrsase esyrssae esyrssea esyresas
esyressa esyreass esyreass esyresas esyressa esyraess esyraess esyrases esyrasse esyrasse esyrases
esyrseas esyrsesa esyrsaes esyrsase esyrssae esyrssea esyssera esyssear esyssrea esyssrae esyssare
esyssaer esysesra esysesar esysersa esyseras esysears esyseasr esysresa esysreas esysrsea esysrsae
esysrase esysraes esysaers esysaesr esysares esysarse esysasre esysaser eseaysrs eseayssr eseayrss
eseayrss eseaysrs eseayssr eseasyrs eseasysr eseasrys eseasrsy eseassry eseassyr esearsys esearssy
esearyss esearyss esearsys esearssy eseassry eseassyr eseasrsy eseasrys eseasyrs eseasysr eseyasrs
eseyassr eseyarss eseyarss eseyasrs eseyassr eseysars eseysasr eseysras eseysrsa eseyssra eseyssar
eseyrsas eseyrssa eseyrass eseyrass eseyrsas eseyrssa eseyssra eseyssar eseysrsa eseysras eseysars
eseysasr esesyars esesyasr esesyras esesyrsa esesysra esesysar esesayrs esesaysr esesarys esesarsy
esesasry esesasyr esesrays esesrasy esesryas esesrysa esesrsya esesrsay esessary esessayr esessray
esessrya esessyra esessyar eserysas eseryssa eseryass eseryass eserysas eseryssa esersyas esersysa
esersays esersasy eserssay eserssya eserasys eserassy eserayss eserayss eserasys eserassy eserssay
eserssya esersasy esersays esersyas esersysa esesysra esesysar esesyrsa esesyras esesyars esesyasr
esessyra esessyar esessrya esessray esessary esessayr esesrsya esesrsay esesrysa esesryas esesrays
esesrasy esesasry esesasyr esesarsy esesarys esesayrs esesaysr esrayess esrayess esrayses esraysse
esraysse esrayses esraeyss esraeyss esraesys esraessy esraessy esraesys esraseys esrasesy esrasyes
esrasyse esrassye esrassey esrasesy esraseys esrassey esrassye esrasyse esrasyes esryaess esryaess
esryases esryasse esryasse esryases esryeass esryeass esryesas esryessa esryessa esryesas esryseas
esrysesa esrysaes esrysase esryssae esryssea esrysesa esryseas esryssea esryssae esrysase esrysaes
esreyass esreyass esreysas esreyssa esreyssa esreysas esreayss esreayss esreasys esreassy esreassy
esreasys esresays esresasy esresyas esresysa esressya esressay esresasy esresays esressay esressya
esresysa esresyas esrsyeas esrsyesa esrsyaes esrsyase esrsysae esrsysea esrseyas esrseysa esrseays
esrseasy esrsesay esrsesya esrsaeys esrsaesy esrsayes esrsayse esrsasye esrsasey esrsseay esrsseya
esrssaey esrssaye esrssyae esrssyea esrsyesa esrsyeas esrsysea esrsysae esrsyase esrsyaes esrseysa
esrseyas esrsesya esrsesay esrseasy esrseays esrsseya esrsseay esrssyea esrssyae esrssaye esrssaey
esrsaesy esrsaeys esrsasey esrsasye esrsayse esrsayes essayers essayesr essayres essayrse essaysre
essayser essaeyrs essaeysr essaerys essaersy essaesry essaesyr essareys essaresy essaryes essaryse
essarsye essarsey essasery essaseyr essasrey essasrye essasyre essasyer essyaers essyaesr essyares
essyarse essyasre essyaser essyears essyeasr essyeras essyersa essyesra essyesar essyreas essyresa
essyraes essyrase essyrsae essyrsea essysera essysear essysrea essysrae essysare essysaer esseyars
esseyasr esseyras esseyrsa esseysra esseysar esseayrs esseaysr essearys essearsy esseasry esseasyr
esserays esserasy esseryas esserysa essersya essersay essesary essesayr essesray essesrya essesyra
essesyar essryeas essryesa essryaes essryase essrysae essrysea essreyas essreysa essreays essreasy
essresay essresya essraeys essraesy essrayes essrayse essrasye essrasey essrseay essrseya essrsaey
essrsaye essrsyae essrsyea esssyera esssyear esssyrea esssyrae esssyare esssyaer essseyra essseyar
essserya essseray essseary essseayr esssreya esssreay esssryea esssryae esssraye esssraey esssaery
esssaeyr esssarey esssarye esssayre esssayer essayers essayesr essayres essayrse essaysre essayser
essaeyrs essaeysr essaerys essaersy essaesry essaesyr essareys essaresy essaryes essaryse essarsye
essarsey essasery essaseyr essasrey essasrye essasyre essasyer essyaers essyaesr essyares essyarse
essyasre essyaser essyears essyeasr essyeras essyersa essyesra essyesar essyreas essyresa essyraes
essyrase essyrsae essyrsea essysera essysear essysrea essysrae essysare essysaer esseyars esseyasr
esseyras esseyrsa esseysra esseysar esseayrs esseaysr essearys essearsy esseasry esseasyr esserays
esserasy esseryas esserysa essersya essersay essesary essesayr essesray essesrya essesyra essesyar
essryeas essryesa essryaes essryase essrysae essrysea essreyas essreysa essreays essreasy essresay
essresya essraeys essraesy essrayes essrayse essrasye essrasey essrseay essrseya essrsaey essrsaye
essrsyae essrsyea esssyera esssyear esssyrea esssyrae esssyare esssyaer essseyra essseyar essserya
essseray essseary essseayr esssreya esssreay esssryea esssryae esssraye esssraey esssaery esssaeyr
esssarey esssarye esssayre esssayer esasyers esasyesr esasyres esasyrse esasysre esasyser esaseyrs
esaseysr esaserys esasersy esasesry esasesyr esasreys esasresy esasryes esasryse esasrsye esasrsey
esassery esasseyr esassrey esassrye esassyre esassyer esaysers esaysesr esaysres esaysrse esayssre
esaysser esayesrs esayessr esayerss esayerss esayesrs esayessr esayress esayress esayrses esayrsse
esayrsse esayrses esaysers esaysesr esaysres esaysrse esayssre esaysser esaeysrs esaeyssr esaeyrss
esaeyrss esaeysrs esaeyssr esaesyrs esaesysr esaesrys esaesrsy esaessry esaessyr esaersys esaerssy
esaeryss esaeryss esaersys esaerssy esaessry esaessyr esaesrsy esaesrys esaesyrs esaesysr esaryess
esaryess esaryses esarysse esarysse esaryses esareyss esareyss esaresys esaressy esaressy esaresys
esarseys esarsesy esarsyes esarsyse esarssye esarssey esarsesy esarseys esarssey esarssye esarsyse
esarsyes esasyers esasyesr esasyres esasyrse esasysre esasyser esaseyrs esaseysr esaserys esasersy
esasesry esasesyr esasreys esasresy esasryes esasryse esasrsye esasrsey esassery esasseyr esassrey
esassrye esassyre esassyer esyasers esyasesr esyasres esyasrse esyassre esyasser esyaesrs esyaessr
esyaerss esyaerss esyaesrs esyaessr esyaress esyaress esyarses esyarsse esyarsse esyarses esyasers
esyasesr esyasres esyasrse esyassre esyasser esysaers esysaesr esysares esysarse esysasre esysaser
esysears esyseasr esyseras esysersa esysesra esysesar esysreas esysresa esysraes esysrase esysrsae
esysrsea esyssera esyssear esyssrea esyssrae esyssare esyssaer esyesars esyesasr esyesras esyesrsa
esyessra esyessar esyeasrs esyeassr esyearss esyearss esyeasrs esyeassr esyerass esyerass esyersas
esyerssa esyerssa esyersas esyesars esyesasr esyesras esyesrsa esyessra esyessar esyrseas esyrsesa
esyrsaes esyrsase esyrssae esyrssea esyresas esyressa esyreass esyreass esyresas esyressa esyraess
esyraess esyrases esyrasse esyrasse esyrases esyrseas esyrsesa esyrsaes esyrsase esyrssae esyrssea
esyssera esyssear esyssrea esyssrae esyssare esyssaer esysesra esysesar esysersa esyseras esysears
esyseasr esysresa esysreas esysrsea esysrsae esysrase esysraes esysaers esysaesr esysares esysarse
esysasre esysaser eseaysrs eseayssr eseayrss eseayrss eseaysrs eseayssr eseasyrs eseasysr eseasrys
eseasrsy eseassry eseassyr esearsys esearssy esearyss esearyss esearsys esearssy eseassry eseassyr
eseasrsy eseasrys eseasyrs eseasysr eseyasrs eseyassr eseyarss eseyarss eseyasrs eseyassr eseysars
eseysasr eseysras eseysrsa eseyssra eseyssar eseyrsas eseyrssa eseyrass eseyrass eseyrsas eseyrssa
eseyssra eseyssar eseysrsa eseysras eseysars eseysasr esesyars esesyasr esesyras esesyrsa esesysra
esesysar esesayrs esesaysr esesarys esesarsy esesasry esesasyr esesrays esesrasy esesryas esesrysa
esesrsya esesrsay esessary esessayr esessray esessrya esessyra esessyar eserysas eseryssa eseryass
eseryass eserysas eseryssa esersyas esersysa esersays esersasy eserssay eserssya eserasys eserassy
eserayss eserayss eserasys eserassy eserssay eserssya esersasy esersays esersyas esersysa esesysra
esesysar esesyrsa esesyras esesyars esesyasr esessyra esessyar esessrya esessray esessary esessayr
esesrsya esesrsay esesrysa esesryas esesrays esesrasy esesasry esesasyr esesarsy esesarys esesayrs
esesaysr esrayess esrayess esrayses esraysse esraysse esrayses esraeyss esraeyss esraesys esraessy
esraessy esraesys esraseys esrasesy esrasyes esrasyse esrassye esrassey esrasesy esraseys esrassey
esrassye esrasyse esrasyes esryaess esryaess esryases esryasse esryasse esryases esryeass esryeass
esryesas esryessa esryessa esryesas esryseas esrysesa esrysaes esrysase esryssae esryssea esrysesa
esryseas esryssea esryssae esrysase esrysaes esreyass esreyass esreysas esreyssa esreyssa esreysas
esreayss esreayss esreasys esreassy esreassy esreasys esresays esresasy esresyas esresysa esressya
esressay esresasy esresays esressay esressya esresysa esresyas esrsyeas esrsyesa esrsyaes esrsyase
esrsysae esrsysea esrseyas esrseysa esrseays esrseasy esrsesay esrsesya esrsaeys esrsaesy esrsayes
esrsayse esrsasye esrsasey esrsseay esrsseya esrssaey esrssaye esrssyae esrssyea esrsyesa esrsyeas
esrsysea esrsysae esrsyase esrsyaes esrseysa esrseyas esrsesya esrsesay esrseasy esrseays esrsseya
esrsseay esrssyea esrssyae esrssaye esrssaey esrsaesy esrsaeys esrsasey esrsasye esrsayse esrsayes
essayers essayesr essayres essayrse essaysre essayser essaeyrs essaeysr essaerys essaersy essaesry
essaesyr essareys essaresy essaryes essaryse essarsye essarsey essasery essaseyr essasrey essasrye
essasyre essasyer essyaers essyaesr essyares essyarse essyasre essyaser essyears essyeasr essyeras
essyersa essyesra essyesar essyreas essyresa essyraes essyrase essyrsae essyrsea essysera essysear
essysrea essysrae essysare essysaer esseyars esseyasr esseyras esseyrsa esseysra esseysar esseayrs
esseaysr essearys essearsy esseasry esseasyr esserays esserasy esseryas esserysa essersya essersay
essesary essesayr essesray essesrya essesyra essesyar essryeas essryesa essryaes essryase essrysae
essrysea essreyas essreysa essreays essreasy essresay essresya essraeys essraesy essrayes essrayse
essrasye essrasey essrseay essrseya essrsaey essrsaye essrsyae essrsyea esssyera esssyear esssyrea
esssyrae esssyare esssyaer essseyra essseyar essserya essseray essseary essseayr esssreya esssreay
esssryea esssryae esssraye esssraey esssaery esssaeyr esssarey esssarye esssayre esssayer eassyers
eassyesr eassyres eassyrse eassysre eassyser easseyrs easseysr easserys eassersy eassesry eassesyr
eassreys eassresy eassryes eassryse eassrsye eassrsey easssery eassseyr easssrey easssrye easssyre
easssyer easysers easysesr easysres easysrse easyssre easysser easyesrs easyessr easyerss easyerss
easyesrs easyessr easyress easyress easyrses easyrsse easyrsse easyrses easysers easysesr easysres
easysrse easyssre easysser easeysrs easeyssr easeyrss easeyrss easeysrs easeyssr easesyrs easesysr
easesrys easesrsy easessry easessyr easersys easerssy easeryss easeryss easersys easerssy easessry
easessyr easesrsy easesrys easesyrs easesysr easryess easryess easryses easrysse easrysse easryses
easreyss easreyss easresys easressy easressy easresys easrseys easrsesy easrsyes easrsyse easrssye
easrssey easrsesy easrseys easrssey easrssye easrsyse easrsyes eassyers eassyesr eassyres eassyrse
eassysre eassyser easseyrs easseysr easserys eassersy eassesry eassesyr eassreys eassresy eassryes
eassryse eassrsye eassrsey easssery eassseyr easssrey easssrye easssyre easssyer eassyers eassyesr
eassyres eassyrse eassysre eassyser easseyrs easseysr easserys eassersy eassesry eassesyr eassreys
eassresy eassryes eassryse eassrsye eassrsey easssery eassseyr easssrey easssrye easssyre easssyer
easysers easysesr easysres easysrse easyssre easysser easyesrs easyessr easyerss easyerss easyesrs
easyessr easyress easyress easyrses easyrsse easyrsse easyrses easysers easysesr easysres easysrse
easyssre easysser easeysrs easeyssr easeyrss easeyrss easeysrs easeyssr easesyrs easesysr easesrys
easesrsy easessry easessyr easersys easerssy easeryss easeryss easersys easerssy easessry easessyr
easesrsy easesrys easesyrs easesysr easryess easryess easryses easrysse easrysse easryses easreyss
easreyss easresys easressy easressy easresys easrseys easrsesy easrsyes easrsyse easrssye easrssey
easrsesy easrseys easrssey easrssye easrsyse easrsyes eassyers eassyesr eassyres eassyrse eassysre
eassyser easseyrs easseysr easserys eassersy eassesry eassesyr eassreys eassresy eassryes eassryse
eassrsye eassrsey easssery eassseyr easssrey easssrye easssyre easssyer eayssers eayssesr eayssres
eayssrse eaysssre eayssser eaysesrs eaysessr eayserss eayserss eaysesrs eaysessr eaysress eaysress
eaysrses eaysrsse eaysrsse eaysrses eayssers eayssesr eayssres eayssrse eaysssre eayssser eayssers
eayssesr eayssres eayssrse eaysssre eayssser eaysesrs eaysessr eayserss eayserss eaysesrs eaysessr
eaysress eaysress eaysrses eaysrsse eaysrsse eaysrses eayssers eayssesr eayssres eayssrse eaysssre
eayssser eayessrs eayesssr eayesrss eayesrss eayessrs eayesssr eayessrs eayesssr eayesrss eayesrss
eayessrs eayesssr eayersss eayersss eayersss eayersss eayersss eayersss eayessrs eayesssr eayesrss
eayesrss eayessrs eayesssr eayrsess eayrsess eayrsses eayrssse eayrssse eayrsses eayresss eayresss
eayresss eayresss eayresss eayresss eayrsess eayrsess eayrsses eayrssse eayrssse eayrsses eayrsess
eayrsess eayrsses eayrssse eayrssse eayrsses eayssers eayssesr eayssres eayssrse eaysssre eayssser
eaysesrs eaysessr eayserss eayserss eaysesrs eaysessr eaysress eaysress eaysrses eaysrsse eaysrsse
eaysrses eayssers eayssesr eayssres eayssrse eaysssre eayssser eaesysrs eaesyssr eaesyrss eaesyrss
eaesysrs eaesyssr eaessyrs eaessysr eaessrys eaessrsy eaesssry eaesssyr eaesrsys eaesrssy eaesryss
eaesryss eaesrsys eaesrssy eaesssry eaesssyr eaessrsy eaessrys eaessyrs eaessysr eaeyssrs eaeysssr
eaeysrss eaeysrss eaeyssrs eaeysssr eaeyssrs eaeysssr eaeysrss eaeysrss eaeyssrs eaeysssr eaeyrsss
eaeyrsss eaeyrsss eaeyrsss eaeyrsss eaeyrsss eaeyssrs eaeysssr eaeysrss eaeysrss eaeyssrs eaeysssr
eaesysrs eaesyssr eaesyrss eaesyrss eaesysrs eaesyssr eaessyrs eaessysr eaessrys eaessrsy eaesssry
eaesssyr eaesrsys eaesrssy eaesryss eaesryss eaesrsys eaesrssy eaesssry eaesssyr eaessrsy eaessrys
eaessyrs eaessysr eaerysss eaerysss eaerysss eaerysss eaerysss eaerysss eaersyss eaersyss eaerssys
eaersssy eaersssy eaerssys eaerssys eaersssy eaersyss eaersyss eaerssys eaersssy eaersssy eaerssys
eaersssy eaerssys eaersyss eaersyss eaesysrs eaesyssr eaesyrss eaesyrss eaesysrs eaesyssr eaessyrs
eaessysr eaessrys eaessrsy eaesssry eaesssyr eaesrsys eaesrssy eaesryss eaesryss eaesrsys eaesrssy
eaesssry eaesssyr eaessrsy eaessrys eaessyrs eaessysr earsyess earsyess earsyses earsysse earsysse
earsyses earseyss earseyss earsesys earsessy earsessy earsesys earsseys earssesy earssyes earssyse
earsssye earsssey earssesy earsseys earsssey earsssye earssyse earssyes earysess earysess earysses
earyssse earyssse earysses earyesss earyesss earyesss earyesss earyesss earyesss earysess earysess
earysses earyssse earyssse earysses earysess earysess earysses earyssse earyssse earysses eareysss
eareysss eareysss eareysss eareysss eareysss earesyss earesyss earessys earesssy earesssy earessys
earessys earesssy earesyss earesyss earessys earesssy earesssy earessys earesssy earessys earesyss
earesyss earsyess earsyess earsyses earsysse earsysse earsyses earseyss earseyss earsesys earsessy
earsessy earsesys earsseys earssesy earssyes earssyse earsssye earsssey earssesy earsseys earsssey
earsssye earssyse earssyes earsyess earsyess earsyses earsysse earsysse earsyses earseyss earseyss
earsesys earsessy earsessy earsesys earsseys earssesy earssyes earssyse earsssye earsssey earssesy
earsseys earsssey earsssye earssyse earssyes eassyers eassyesr eassyres eassyrse eassysre eassyser
easseyrs easseysr easserys eassersy eassesry eassesyr eassreys eassresy eassryes eassryse eassrsye
eassrsey easssery eassseyr easssrey easssrye easssyre easssyer easysers easysesr easysres easysrse
easyssre easysser easyesrs easyessr easyerss easyerss easyesrs easyessr easyress easyress easyrses
easyrsse easyrsse easyrses easysers easysesr easysres easysrse easyssre easysser easeysrs easeyssr
easeyrss easeyrss easeysrs easeyssr easesyrs easesysr easesrys easesrsy easessry easessyr easersys
easerssy easeryss easeryss easersys easerssy easessry easessyr easesrsy easesrys easesyrs easesysr
easryess easryess easryses easrysse easrysse easryses easreyss easreyss easresys easressy easressy
easresys easrseys easrsesy easrsyes easrsyse easrssye easrssey easrsesy easrseys easrssey easrssye
easrsyse easrsyes eassyers eassyesr eassyres eassyrse eassysre eassyser easseyrs easseysr easserys
eassersy eassesry eassesyr eassreys eassresy eassryes eassryse eassrsye eassrsey easssery eassseyr
easssrey easssrye easssyre easssyer eysasers eysasesr eysasres eysasrse eysassre eysasser eysaesrs
eysaessr eysaerss eysaerss eysaesrs eysaessr eysaress eysaress eysarses eysarsse eysarsse eysarses
eysasers eysasesr eysasres eysasrse eysassre eysasser eyssaers eyssaesr eyssares eyssarse eyssasre
eyssaser eyssears eysseasr eysseras eyssersa eyssesra eyssesar eyssreas eyssresa eyssraes eyssrase
eyssrsae eyssrsea eysssera eysssear eysssrea eysssrae eysssare eysssaer eysesars eysesasr eysesras
eysesrsa eysessra eysessar eyseasrs eyseassr eysearss eysearss eyseasrs eyseassr eyserass eyserass
eysersas eyserssa eyserssa eysersas eysesars eysesasr eysesras eysesrsa eysessra eysessar eysrseas
eysrsesa eysrsaes eysrsase eysrssae eysrssea eysresas eysressa eysreass eysreass eysresas eysressa
eysraess eysraess eysrases eysrasse eysrasse eysrases eysrseas eysrsesa eysrsaes eysrsase eysrssae
eysrssea eysssera eysssear eysssrea eysssrae eysssare eysssaer eyssesra eyssesar eyssersa eysseras
eyssears eysseasr eyssresa eyssreas eyssrsea eyssrsae eyssrase eyssraes eyssaers eyssaesr eyssares
eyssarse eyssasre eyssaser eyassers eyassesr eyassres eyassrse eyasssre eyassser eyasesrs eyasessr
eyaserss eyaserss eyasesrs eyasessr eyasress eyasress eyasrses eyasrsse eyasrsse eyasrses eyassers
eyassesr eyassres eyassrse eyasssre eyassser eyassers eyassesr eyassres eyassrse eyasssre eyassser
eyasesrs eyasessr eyaserss eyaserss eyasesrs eyasessr eyasress eyasress eyasrses eyasrsse eyasrsse
eyasrses eyassers eyassesr eyassres eyassrse eyasssre eyassser eyaessrs eyaesssr eyaesrss eyaesrss
eyaessrs eyaesssr eyaessrs eyaesssr eyaesrss eyaesrss eyaessrs eyaesssr eyaersss eyaersss eyaersss
eyaersss eyaersss eyaersss eyaessrs eyaesssr eyaesrss eyaesrss eyaessrs eyaesssr eyarsess eyarsess
eyarsses eyarssse eyarssse eyarsses eyaresss eyaresss eyaresss eyaresss eyaresss eyaresss eyarsess
eyarsess eyarsses eyarssse eyarssse eyarsses eyarsess eyarsess eyarsses eyarssse eyarssse eyarsses
eyassers eyassesr eyassres eyassrse eyasssre eyassser eyasesrs eyasessr eyaserss eyaserss eyasesrs
eyasessr eyasress eyasress eyasrses eyasrsse eyasrsse eyasrses eyassers eyassesr eyassres eyassrse
eyasssre eyassser eysasers eysasesr eysasres eysasrse eysassre eysasser eysaesrs eysaessr eysaerss
eysaerss eysaesrs eysaessr eysaress eysaress eysarses eysarsse eysarsse eysarses eysasers eysasesr
eysasres eysasrse eysassre eysasser eyssaers eyssaesr eyssares eyssarse eyssasre eyssaser eyssears
eysseasr eysseras eyssersa eyssesra eyssesar eyssreas eyssresa eyssraes eyssrase eyssrsae eyssrsea
eysssera eysssear eysssrea eysssrae eysssare eysssaer eysesars eysesasr eysesras eysesrsa eysessra
eysessar eyseasrs eyseassr eysearss eysearss eyseasrs eyseassr eyserass eyserass eysersas eyserssa
eyserssa eysersas eysesars eysesasr eysesras eysesrsa eysessra eysessar eysrseas eysrsesa eysrsaes
eysrsase eysrssae eysrssea eysresas eysressa eysreass eysreass eysresas eysressa eysraess eysraess
eysrases eysrasse eysrasse eysrases eysrseas eysrsesa eysrsaes eysrsase eysrssae eysrssea eysssera
eysssear eysssrea eysssrae eysssare eysssaer eyssesra eyssesar eyssersa eysseras eyssears eysseasr
eyssresa eyssreas eyssrsea eyssrsae eyssrase eyssraes eyssaers eyssaesr eyssares eyssarse eyssasre
eyssaser eyeassrs eyeasssr eyeasrss eyeasrss eyeassrs eyeasssr eyeassrs eyeasssr eyeasrss eyeasrss
eyeassrs eyeasssr eyearsss eyearsss eyearsss eyearsss eyearsss eyearsss eyeassrs eyeasssr eyeasrss
eyeasrss eyeassrs eyeasssr eyesasrs eyesassr eyesarss eyesarss eyesasrs eyesassr eyessars eyessasr
eyessras eyessrsa eyesssra eyesssar eyesrsas eyesrssa eyesrass eyesrass eyesrsas eyesrssa eyesssra
eyesssar eyessrsa eyessras eyessars eyessasr eyessars eyessasr eyessras eyessrsa eyesssra eyesssar
eyesasrs eyesassr eyesarss eyesarss eyesasrs eyesassr eyesrass eyesrass eyesrsas eyesrssa eyesrssa
eyesrsas eyessars eyessasr eyessras eyessrsa eyesssra eyesssar eyerssas eyersssa eyersass eyersass
eyerssas eyersssa eyerssas eyersssa eyersass eyersass eyerssas eyersssa eyerasss eyerasss eyerasss
eyerasss eyerasss eyerasss eyerssas eyersssa eyersass eyersass eyerssas eyersssa eyesssra eyesssar
eyessrsa eyessras eyessars eyessasr eyesssra eyesssar eyessrsa eyessras eyessars eyessasr eyesrssa
eyesrsas eyesrssa eyesrsas eyesrass eyesrass eyesasrs eyesassr eyesarss eyesarss eyesasrs eyesassr
eyrasess eyrasess eyrasses eyrassse eyrassse eyrasses eyraesss eyraesss eyraesss eyraesss eyraesss
eyraesss eyrasess eyrasess eyrasses eyrassse eyrassse eyrasses eyrasess eyrasess eyrasses eyrassse
eyrassse eyrasses eyrsaess eyrsaess eyrsases eyrsasse eyrsasse eyrsases eyrseass eyrseass eyrsesas
eyrsessa eyrsessa eyrsesas eyrsseas eyrssesa eyrssaes eyrssase eyrsssae eyrsssea eyrssesa eyrsseas
eyrsssea eyrsssae eyrssase eyrssaes eyresass eyresass eyressas eyresssa eyresssa eyressas eyreasss
eyreasss eyreasss eyreasss eyreasss eyreasss eyresass eyresass eyressas eyresssa eyresssa eyressas
eyresass eyresass eyressas eyresssa eyresssa eyressas eyrsseas eyrssesa eyrssaes eyrssase eyrsssae
eyrsssea eyrsesas eyrsessa eyrseass eyrseass eyrsesas eyrsessa eyrsaess eyrsaess eyrsases eyrsasse
eyrsasse eyrsases eyrsseas eyrssesa eyrssaes eyrssase eyrsssae eyrsssea eyrssesa eyrsseas eyrsssea
eyrsssae eyrssase eyrssaes eyrsessa eyrsesas eyrsessa eyrsesas eyrseass eyrseass eyrssesa eyrsseas
eyrsssea eyrsssae eyrssase eyrssaes eyrsaess eyrsaess eyrsases eyrsasse eyrsasse eyrsases eysasers
eysasesr eysasres eysasrse eysassre eysasser eysaesrs eysaessr eysaerss eysaerss eysaesrs eysaessr
eysaress eysaress eysarses eysarsse eysarsse eysarses eysasers eysasesr eysasres eysasrse eysassre
eysasser eyssaers eyssaesr eyssares eyssarse eyssasre eyssaser eyssears eysseasr eysseras eyssersa
eyssesra eyssesar eyssreas eyssresa eyssraes eyssrase eyssrsae eyssrsea eysssera eysssear eysssrea
eysssrae eysssare eysssaer eysesars eysesasr eysesras eysesrsa eysessra eysessar eyseasrs eyseassr
eysearss eysearss eyseasrs eyseassr eyserass eyserass eysersas eyserssa eyserssa eysersas eysesars
eysesasr eysesras eysesrsa eysessra eysessar eysrseas eysrsesa eysrsaes eysrsase eysrssae eysrssea
eysresas eysressa eysreass eysreass eysresas eysressa eysraess eysraess eysrases eysrasse eysrasse
eysrases eysrseas eysrsesa eysrsaes eysrsase eysrssae eysrssea eysssera eysssear eysssrea eysssrae
eysssare eysssaer eyssesra eyssesar eyssersa eysseras eyssears eysseasr eyssresa eyssreas eyssrsea
eyssrsae eyssrase eyssraes eyssaers eyssaesr eyssares eyssarse eyssasre eyssaser eesaysrs eesayssr
eesayrss eesayrss eesaysrs eesayssr eesasyrs eesasysr eesasrys eesasrsy eesassry eesassyr eesarsys
eesarssy eesaryss eesaryss eesarsys eesarssy eesassry eesassyr eesasrsy eesasrys eesasyrs eesasysr
eesyasrs eesyassr eesyarss eesyarss eesyasrs eesyassr eesysars eesysasr eesysras eesysrsa eesyssra
eesyssar eesyrsas eesyrssa eesyrass eesyrass eesyrsas eesyrssa eesyssra eesyssar eesysrsa eesysras
eesysars eesysasr eessyars eessyasr eessyras eessyrsa eessysra eessysar eessayrs eessaysr eessarys
eessarsy eessasry eessasyr eessrays eessrasy eessryas eessrysa eessrsya eessrsay eesssary eesssayr
eesssray eesssrya eesssyra eesssyar eesrysas eesryssa eesryass eesryass eesrysas eesryssa eesrsyas
eesrsysa eesrsays eesrsasy eesrssay eesrssya eesrasys eesrassy eesrayss eesrayss eesrasys eesrassy
eesrssay eesrssya eesrsasy eesrsays eesrsyas eesrsysa eessysra eessysar eessyrsa eessyras eessyars
eessyasr eesssyra eesssyar eesssrya eesssray eesssary eesssayr eessrsya eessrsay eessrysa eessryas
eessrays eessrasy eessasry eessasyr eessarsy eessarys eessayrs eessaysr eeasysrs eeasyssr eeasyrss
eeasyrss eeasysrs eeasyssr eeassyrs eeassysr eeassrys eeassrsy eeasssry eeasssyr eeasrsys eeasrssy
eeasryss eeasryss eeasrsys eeasrssy eeasssry eeasssyr eeassrsy eeassrys eeassyrs eeassysr eeayssrs
eeaysssr eeaysrss eeaysrss eeayssrs eeaysssr eeayssrs eeaysssr eeaysrss eeaysrss eeayssrs eeaysssr
eeayrsss eeayrsss eeayrsss eeayrsss eeayrsss eeayrsss eeayssrs eeaysssr eeaysrss eeaysrss eeayssrs
eeaysssr eeasysrs eeasyssr eeasyrss eeasyrss eeasysrs eeasyssr eeassyrs eeassysr eeassrys eeassrsy
eeasssry eeasssyr eeasrsys eeasrssy eeasryss eeasryss eeasrsys eeasrssy eeasssry eeasssyr eeassrsy
eeassrys eeassyrs eeassysr eearysss eearysss eearysss eearysss eearysss eearysss eearsyss eearsyss
eearssys eearsssy eearsssy eearssys eearssys eearsssy eearsyss eearsyss eearssys eearsssy eearsssy
eearssys eearsssy eearssys eearsyss eearsyss eeasysrs eeasyssr eeasyrss eeasyrss eeasysrs eeasyssr
eeassyrs eeassysr eeassrys eeassrsy eeasssry eeasssyr eeasrsys eeasrssy eeasryss eeasryss eeasrsys
eeasrssy eeasssry eeasssyr eeassrsy eeassrys eeassyrs eeassysr eeyassrs eeyasssr eeyasrss eeyasrss
eeyassrs eeyasssr eeyassrs eeyasssr eeyasrss eeyasrss eeyassrs eeyasssr eeyarsss eeyarsss eeyarsss
eeyarsss eeyarsss eeyarsss eeyassrs eeyasssr eeyasrss eeyasrss eeyassrs eeyasssr eeysasrs eeysassr
eeysarss eeysarss eeysasrs eeysassr eeyssars eeyssasr eeyssras eeyssrsa eeysssra eeysssar eeysrsas
eeysrssa eeysrass eeysrass eeysrsas eeysrssa eeysssra eeysssar eeyssrsa eeyssras eeyssars eeyssasr
eeyssars eeyssasr eeyssras eeyssrsa eeysssra eeysssar eeysasrs eeysassr eeysarss eeysarss eeysasrs
eeysassr eeysrass eeysrass eeysrsas eeysrssa eeysrssa eeysrsas eeyssars eeyssasr eeyssras eeyssrsa
eeysssra eeysssar eeyrssas eeyrsssa eeyrsass eeyrsass eeyrssas eeyrsssa eeyrssas eeyrsssa eeyrsass
eeyrsass eeyrssas eeyrsssa eeyrasss eeyrasss eeyrasss eeyrasss eeyrasss eeyrasss eeyrssas eeyrsssa
eeyrsass eeyrsass eeyrssas eeyrsssa eeysssra eeysssar eeyssrsa eeyssras eeyssars eeyssasr eeysssra
eeysssar eeyssrsa eeyssras eeyssars eeyssasr eeysrssa eeysrsas eeysrssa eeysrsas eeysrass eeysrass
eeysasrs eeysassr eeysarss eeysarss eeysasrs eeysassr eesaysrs eesayssr eesayrss eesayrss eesaysrs
eesayssr eesasyrs eesasysr eesasrys eesasrsy eesassry eesassyr eesarsys eesarssy eesaryss eesaryss
eesarsys eesarssy eesassry eesassyr eesasrsy eesasrys eesasyrs eesasysr eesyasrs eesyassr eesyarss
eesyarss eesyasrs eesyassr eesysars eesysasr eesysras eesysrsa eesyssra eesyssar eesyrsas eesyrssa
eesyrass eesyrass eesyrsas eesyrssa eesyssra eesyssar eesysrsa eesysras eesysars eesysasr eessyars
eessyasr eessyras eessyrsa eessysra eessysar eessayrs eessaysr eessarys eessarsy eessasry eessasyr
eessrays eessrasy eessryas eessrysa eessrsya eessrsay eesssary eesssayr eesssray eesssrya eesssyra
eesssyar eesrysas eesryssa eesryass eesryass eesrysas eesryssa eesrsyas eesrsysa eesrsays eesrsasy
eesrssay eesrssya eesrasys eesrassy eesrayss eesrayss eesrasys eesrassy eesrssay eesrssya eesrsasy
eesrsays eesrsyas eesrsysa eessysra eessysar eessyrsa eessyras eessyars eessyasr eesssyra eesssyar
eesssrya eesssray eesssary eesssayr eessrsya eessrsay eessrysa eessryas eessrays eessrasy eessasry
eessasyr eessarsy eessarys eessayrs eessaysr eeraysss eeraysss eeraysss eeraysss eeraysss eeraysss
eerasyss eerasyss eerassys eerasssy eerasssy eerassys eerassys eerasssy eerasyss eerasyss eerassys
eerasssy eerasssy eerassys eerasssy eerassys eerasyss eerasyss eeryasss eeryasss eeryasss eeryasss
eeryasss eeryasss eerysass eerysass eeryssas eerysssa eerysssa eeryssas eeryssas eerysssa eerysass
eerysass eeryssas eerysssa eerysssa eeryssas eerysssa eeryssas eerysass eerysass eersyass eersyass
eersysas eersyssa eersyssa eersysas eersayss eersayss eersasys eersassy eersassy eersasys eerssays
eerssasy eerssyas eerssysa eersssya eersssay eerssasy eerssays eersssay eersssya eerssysa eerssyas
eersysas eersyssa eersyass eersyass eersysas eersyssa eerssyas eerssysa eerssays eerssasy eersssay
eersssya eersasys eersassy eersayss eersayss eersasys eersassy eersssay eersssya eerssasy eerssays
eerssyas eerssysa eersyssa eersysas eersyssa eersysas eersyass eersyass eerssysa eerssyas eersssya
eersssay eerssasy eerssays eersssya eersssay eerssysa eerssyas eerssays eerssasy eersassy eersasys
eersassy eersasys eersayss eersayss eesaysrs eesayssr eesayrss eesayrss eesaysrs eesayssr eesasyrs
eesasysr eesasrys eesasrsy eesassry eesassyr eesarsys eesarssy eesaryss eesaryss eesarsys eesarssy
eesassry eesassyr eesasrsy eesasrys eesasyrs eesasysr eesyasrs eesyassr eesyarss eesyarss eesyasrs
eesyassr eesysars eesysasr eesysras eesysrsa eesyssra eesyssar eesyrsas eesyrssa eesyrass eesyrass
eesyrsas eesyrssa eesyssra eesyssar eesysrsa eesysras eesysars eesysasr eessyars eessyasr eessyras
eessyrsa eessysra eessysar eessayrs eessaysr eessarys eessarsy eessasry eessasyr eessrays eessrasy
eessryas eessrysa eessrsya eessrsay eesssary eesssayr eesssray eesssrya eesssyra eesssyar eesrysas
eesryssa eesryass eesryass eesrysas eesryssa eesrsyas eesrsysa eesrsays eesrsasy eesrssay eesrssya
eesrasys eesrassy eesrayss eesrayss eesrasys eesrassy eesrssay eesrssya eesrsasy eesrsays eesrsyas
eesrsysa eessysra eessysar eessyrsa eessyras eessyars eessyasr eesssyra eesssyar eesssrya eesssray
eesssary eesssayr eessrsya eessrsay eessrysa eessryas eessrays eessrasy eessasry eessasyr eessarsy
eessarys eessayrs eessaysr ersayess ersayess ersayses ersaysse ersaysse ersayses ersaeyss ersaeyss
ersaesys ersaessy ersaessy ersaesys ersaseys ersasesy ersasyes ersasyse ersassye ersassey ersasesy
ersaseys ersassey ersassye ersasyse ersasyes ersyaess ersyaess ersyases ersyasse ersyasse ersyases
ersyeass ersyeass ersyesas ersyessa ersyessa ersyesas ersyseas ersysesa ersysaes ersysase ersyssae
ersyssea ersysesa ersyseas ersyssea ersyssae ersysase ersysaes erseyass erseyass erseysas erseyssa
erseyssa erseysas erseayss erseayss erseasys erseassy erseassy erseasys ersesays ersesasy ersesyas
ersesysa ersessya ersessay ersesasy ersesays ersessay ersessya ersesysa ersesyas erssyeas erssyesa
erssyaes erssyase erssysae erssysea ersseyas ersseysa ersseays ersseasy erssesay erssesya erssaeys
erssaesy erssayes erssayse erssasye erssasey erssseay erssseya ersssaey ersssaye ersssyae ersssyea
erssyesa erssyeas erssysea erssysae erssyase erssyaes ersseysa ersseyas erssesya erssesay ersseasy
ersseays erssseya erssseay ersssyea ersssyae ersssaye ersssaey erssaesy erssaeys erssasey erssasye
erssayse erssayes erasyess erasyess erasyses erasysse erasysse erasyses eraseyss eraseyss erasesys
erasessy erasessy erasesys erasseys erassesy erassyes erassyse erasssye erasssey erassesy erasseys
erasssey erasssye erassyse erassyes eraysess eraysess eraysses erayssse erayssse eraysses erayesss
erayesss erayesss erayesss erayesss erayesss eraysess eraysess eraysses erayssse erayssse eraysses
eraysess eraysess eraysses erayssse erayssse eraysses eraeysss eraeysss eraeysss eraeysss eraeysss
eraeysss eraesyss eraesyss eraessys eraesssy eraesssy eraessys eraessys eraesssy eraesyss eraesyss
eraessys eraesssy eraesssy eraessys eraesssy eraessys eraesyss eraesyss erasyess erasyess erasyses
erasysse erasysse erasyses eraseyss eraseyss erasesys erasessy erasessy erasesys erasseys erassesy
erassyes erassyse erasssye erasssey erassesy erasseys erasssey erasssye erassyse erassyes erasyess
erasyess erasyses erasysse erasysse erasyses eraseyss eraseyss erasesys erasessy erasessy erasesys
erasseys erassesy erassyes erassyse erasssye erasssey erassesy erasseys erasssey erasssye erassyse
erassyes eryasess eryasess eryasses eryassse eryassse eryasses eryaesss eryaesss eryaesss eryaesss
eryaesss eryaesss eryasess eryasess eryasses eryassse eryassse eryasses eryasess eryasess eryasses
eryassse eryassse eryasses erysaess erysaess erysases erysasse erysasse erysases eryseass eryseass
erysesas erysessa erysessa erysesas erysseas eryssesa eryssaes eryssase erysssae erysssea eryssesa
erysseas erysssea erysssae eryssase eryssaes eryesass eryesass eryessas eryesssa eryesssa eryessas
eryeasss eryeasss eryeasss eryeasss eryeasss eryeasss eryesass eryesass eryessas eryesssa eryesssa
eryessas eryesass eryesass eryessas eryesssa eryesssa eryessas erysseas eryssesa eryssaes eryssase
erysssae erysssea erysesas erysessa eryseass eryseass erysesas erysessa erysaess erysaess erysases
erysasse erysasse erysases erysseas eryssesa eryssaes eryssase erysssae erysssea eryssesa erysseas
erysssea erysssae eryssase eryssaes erysessa erysesas erysessa erysesas eryseass eryseass eryssesa
erysseas erysssea erysssae eryssase eryssaes erysaess erysaess erysases erysasse erysasse erysases
ereaysss ereaysss ereaysss ereaysss ereaysss ereaysss ereasyss ereasyss ereassys ereasssy ereasssy
ereassys ereassys ereasssy ereasyss ereasyss ereassys ereasssy ereasssy ereassys ereasssy ereassys
ereasyss ereasyss ereyasss ereyasss ereyasss ereyasss ereyasss ereyasss ereysass ereysass ereyssas
ereysssa ereysssa ereyssas ereyssas ereysssa ereysass ereysass ereyssas ereysssa ereysssa ereyssas
ereysssa ereyssas ereysass ereysass eresyass eresyass eresysas eresyssa eresyssa eresysas eresayss
eresayss eresasys eresassy eresassy eresasys eressays eressasy eressyas eressysa eresssya eresssay
eressasy eressays eresssay eresssya eressysa eressyas eresysas eresyssa eresyass eresyass eresysas
eresyssa eressyas eressysa eressays eressasy eresssay eresssya eresasys eresassy eresayss eresayss
eresasys eresassy eresssay eresssya eressasy eressays eressyas eressysa eresyssa eresysas eresyssa
eresysas eresyass eresyass eressysa eressyas eresssya eresssay eressasy eressays eresssya eresssay
eressysa eressyas eressays eressasy eresassy eresasys eresassy eresasys eresayss eresayss ersayess
ersayess ersayses ersaysse ersaysse ersayses ersaeyss ersaeyss ersaesys ersaessy ersaessy ersaesys
ersaseys ersasesy ersasyes ersasyse ersassye ersassey ersasesy ersaseys ersassey ersassye ersasyse
ersasyes ersyaess ersyaess ersyases ersyasse ersyasse ersyases ersyeass ersyeass ersyesas ersyessa
ersyessa ersyesas ersyseas ersysesa ersysaes ersysase ersyssae ersyssea ersysesa ersyseas ersyssea
ersyssae ersysase ersysaes erseyass erseyass erseysas erseyssa erseyssa erseysas erseayss erseayss
erseasys erseassy erseassy erseasys ersesays ersesasy ersesyas ersesysa ersessya ersessay ersesasy
ersesays ersessay ersessya ersesysa ersesyas erssyeas erssyesa erssyaes erssyase erssysae erssysea
ersseyas ersseysa ersseays ersseasy erssesay erssesya erssaeys erssaesy erssayes erssayse erssasye
erssasey erssseay erssseya ersssaey ersssaye ersssyae ersssyea erssyesa erssyeas erssysea erssysae
erssyase erssyaes ersseysa ersseyas erssesya erssesay ersseasy ersseays erssseya erssseay ersssyea
ersssyae ersssaye ersssaey erssaesy erssaeys erssasey erssasye erssayse erssayes ersayess ersayess
ersayses ersaysse ersaysse ersayses ersaeyss ersaeyss ersaesys ersaessy ersaessy ersaesys ersaseys
ersasesy ersasyes ersasyse ersassye ersassey ersasesy ersaseys ersassey ersassye ersasyse ersasyes
ersyaess ersyaess ersyases ersyasse ersyasse ersyases ersyeass ersyeass ersyesas ersyessa ersyessa
ersyesas ersyseas ersysesa ersysaes ersysase ersyssae ersyssea ersysesa ersyseas ersyssea ersyssae
ersysase ersysaes erseyass erseyass erseysas erseyssa erseyssa erseysas erseayss erseayss erseasys
erseassy erseassy erseasys ersesays ersesasy ersesyas ersesysa ersessya ersessay ersesasy ersesays
ersessay ersessya ersesysa ersesyas erssyeas erssyesa erssyaes erssyase erssysae erssysea ersseyas
ersseysa ersseays ersseasy erssesay erssesya erssaeys erssaesy erssayes erssayse erssasye erssasey
erssseay erssseya ersssaey ersssaye ersssyae ersssyea erssyesa erssyeas erssysea erssysae erssyase
erssyaes ersseysa ersseyas erssesya erssesay ersseasy ersseays erssseya erssseay ersssyea ersssyae
ersssaye ersssaey erssaesy erssaeys erssasey erssasye erssayse erssayes essayers essayesr essayres
essayrse essaysre essayser essaeyrs essaeysr essaerys essaersy essaesry essaesyr essareys essaresy
essaryes essaryse essarsye essarsey essasery essaseyr essasrey essasrye essasyre essasyer essyaers
essyaesr essyares essyarse essyasre essyaser essyears essyeasr essyeras essyersa essyesra essyesar
essyreas essyresa essyraes essyrase essyrsae essyrsea essysera essysear essysrea essysrae essysare
essysaer esseyars esseyasr esseyras esseyrsa esseysra esseysar esseayrs esseaysr essearys essearsy
esseasry esseasyr esserays esserasy esseryas esserysa essersya essersay essesary essesayr essesray
essesrya essesyra essesyar essryeas essryesa essryaes essryase essrysae essrysea essreyas essreysa
essreays essreasy essresay essresya essraeys essraesy essrayes essrayse essrasye essrasey essrseay
essrseya essrsaey essrsaye essrsyae essrsyea esssyera esssyear esssyrea esssyrae esssyare esssyaer
essseyra essseyar essserya essseray essseary essseayr esssreya esssreay esssryea esssryae esssraye
esssraey esssaery esssaeyr esssarey esssarye esssayre esssayer esasyers esasyesr esasyres esasyrse
esasysre esasyser esaseyrs esaseysr esaserys esasersy esasesry esasesyr esasreys esasresy esasryes
esasryse esasrsye esasrsey esassery esasseyr esassrey esassrye esassyre esassyer esaysers esaysesr
esaysres esaysrse esayssre esaysser esayesrs esayessr esayerss esayerss esayesrs esayessr esayress
esayress esayrses esayrsse esayrsse esayrses esaysers esaysesr esaysres esaysrse esayssre esaysser
esaeysrs esaeyssr esaeyrss esaeyrss esaeysrs esaeyssr esaesyrs esaesysr esaesrys esaesrsy esaessry
esaessyr esaersys esaerssy esaeryss esaeryss esaersys esaerssy esaessry esaessyr esaesrsy esaesrys
esaesyrs esaesysr esaryess esaryess esaryses esarysse esarysse esaryses esareyss esareyss esaresys
esaressy esaressy esaresys esarseys esarsesy esarsyes esarsyse esarssye esarssey esarsesy esarseys
esarssey esarssye esarsyse esarsyes esasyers esasyesr esasyres esasyrse esasysre esasyser esaseyrs
esaseysr esaserys esasersy esasesry esasesyr esasreys esasresy esasryes esasryse esasrsye esasrsey
esassery esasseyr esassrey esassrye esassyre esassyer esyasers esyasesr esyasres esyasrse esyassre
esyasser esyaesrs esyaessr esyaerss esyaerss esyaesrs esyaessr esyaress esyaress esyarses esyarsse
esyarsse esyarses esyasers esyasesr esyasres esyasrse esyassre esyasser esysaers esysaesr esysares
esysarse esysasre esysaser esysears esyseasr esyseras esysersa esysesra esysesar esysreas esysresa
esysraes esysrase esysrsae esysrsea esyssera esyssear esyssrea esyssrae esyssare esyssaer esyesars
esyesasr esyesras esyesrsa esyessra esyessar esyeasrs esyeassr esyearss esyearss esyeasrs esyeassr
esyerass esyerass esyersas esyerssa esyerssa esyersas esyesars esyesasr esyesras esyesrsa esyessra
esyessar esyrseas esyrsesa esyrsaes esyrsase esyrssae esyrssea esyresas esyressa esyreass esyreass
esyresas esyressa esyraess esyraess esyrases esyrasse esyrasse esyrases esyrseas esyrsesa esyrsaes
esyrsase esyrssae esyrssea esyssera esyssear esyssrea esyssrae esyssare esyssaer esysesra esysesar
esysersa esyseras esysears esyseasr esysresa esysreas esysrsea esysrsae esysrase esysraes esysaers
esysaesr esysares esysarse esysasre esysaser eseaysrs eseayssr eseayrss eseayrss eseaysrs eseayssr
eseasyrs eseasysr eseasrys eseasrsy eseassry eseassyr esearsys esearssy esearyss esearyss esearsys
esearssy eseassry eseassyr eseasrsy eseasrys eseasyrs eseasysr eseyasrs eseyassr eseyarss eseyarss
eseyasrs eseyassr eseysars eseysasr eseysras eseysrsa eseyssra eseyssar eseyrsas eseyrssa eseyrass
eseyrass eseyrsas eseyrssa eseyssra eseyssar eseysrsa eseysras eseysars eseysasr esesyars esesyasr
esesyras esesyrsa esesysra esesysar esesayrs esesaysr esesarys esesarsy esesasry esesasyr esesrays
esesrasy esesryas esesrysa esesrsya esesrsay esessary esessayr esessray esessrya esessyra esessyar
eserysas eseryssa eseryass eseryass eserysas eseryssa esersyas esersysa esersays esersasy eserssay
eserssya eserasys eserassy eserayss eserayss eserasys eserassy eserssay eserssya esersasy esersays
esersyas esersysa esesysra esesysar esesyrsa esesyras esesyars esesyasr esessyra esessyar esessrya
esessray esessary esessayr esesrsya esesrsay esesrysa esesryas esesrays esesrasy esesasry esesasyr
esesarsy esesarys esesayrs esesaysr esrayess esrayess esrayses esraysse esraysse esrayses esraeyss
esraeyss esraesys esraessy esraessy esraesys esraseys esrasesy esrasyes esrasyse esrassye esrassey
esrasesy esraseys esrassey esrassye esrasyse esrasyes esryaess esryaess esryases esryasse esryasse
esryases esryeass esryeass esryesas esryessa esryessa esryesas esryseas esrysesa esrysaes esrysase
esryssae esryssea esrysesa esryseas esryssea esryssae esrysase esrysaes esreyass esreyass esreysas
esreyssa esreyssa esreysas esreayss esreayss esreasys esreassy esreassy esreasys esresays esresasy
esresyas esresysa esressya esressay esresasy esresays esressay esressya esresysa esresyas esrsyeas
esrsyesa esrsyaes esrsyase esrsysae esrsysea esrseyas esrseysa esrseays esrseasy esrsesay esrsesya
esrsaeys esrsaesy esrsayes esrsayse esrsasye esrsasey esrsseay esrsseya esrssaey esrssaye esrssyae
esrssyea esrsyesa esrsyeas esrsysea esrsysae esrsyase esrsyaes esrseysa esrseyas esrsesya esrsesay
esrseasy esrseays esrsseya esrsseay esrssyea esrssyae esrssaye esrssaey esrsaesy esrsaeys esrsasey
esrsasye esrsayse esrsayes essayers essayesr essayres essayrse essaysre essayser essaeyrs essaeysr
essaerys essaersy essaesry essaesyr essareys essaresy essaryes essaryse essarsye essarsey essasery
essaseyr essasrey essasrye essasyre essasyer essyaers essyaesr essyares essyarse essyasre essyaser
essyears essyeasr essyeras essyersa essyesra essyesar essyreas essyresa essyraes essyrase essyrsae
essyrsea essysera essysear essysrea essysrae essysare essysaer esseyars esseyasr esseyras esseyrsa
esseysra esseysar esseayrs esseaysr essearys essearsy esseasry esseasyr esserays esserasy esseryas
esserysa essersya essersay essesary essesayr essesray essesrya essesyra essesyar essryeas essryesa
essryaes essryase essrysae essrysea essreyas essreysa essreays essreasy essresay essresya essraeys
essraesy essrayes essrayse essrasye essrasey essrseay essrseya essrsaey essrsaye essrsyae essrsyea
esssyera esssyear esssyrea esssyrae esssyare esssyaer essseyra essseyar essserya essseray essseary
essseayr esssreya esssreay esssryea esssryae esssraye esssraey esssaery esssaeyr esssarey esssarye
esssayre esssayer

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us