easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

institutum

lumbrous

westerner

byrsam

schonberg

aucturam

kamal

reaspire

scrobble

myoblast

foraremus

redivisti

topside

leerier

ssteffen

healsomeness

viruscidal

buccinatory


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: emiliania
cipher variations:
fnjmjbojb goknkcpkc hploldqld iqmpmerme jrnqnfsnf
ksorogtog ltpsphuph muqtqivqi nvrurjwrj owsvskxsk
pxtwtlytl qyuxumzum rzvyvnavn sawzwobwo tbxaxpcxp
ucybyqdyq vdzczrezr weadasfas xfbebtgbt ygcfcuhcu
zhdgdvidv aiehewjew bjfifxkfx ckgjgylgy dlhkhzmhz

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: emiliania
Cipher: vnrorzmrz

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: emiliania
Cipher: AABAA ABABB ABAAA ABABA ABAAA AAAAA ABBAA ABAAA AAAAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: emiliania
cipher variations:
fnjmjbojbnlzizbozbvjpepbopbdhfafbofblfvwvbovbtdlslbolbjzrkrborbrxhghbohb
zvxcxboxbhtnynbonbprdudbodbxptqtbotbgoknkcpkcomajacpacwkqfqcpqceigbgcpgc
mgwxwcpwcuemtmcpmckaslscpscsyihicpicawydycpyciuozocpocqsevecpecyqurucpuc
hploldqldpnbkbdqbdxlrgrdqrdfjhchdqhdnhxyxdqxdvfnundqndlbtmtdqtdtzjijdqjd
bxzezdqzdjvpapdqpdrtfwfdqfdzrvsvdqvdiqmpmermeqoclcerceymshsersegkidierie
oiyzyeryewgovoeroemcunuerueuakjkerkecyafaeraekwqbqerqesugxgergeaswtwerwe
jrnqnfsnfrpdmdfsdfzntitfstfhljejfsjfpjzazfszfxhpwpfspfndvovfsvfvblklfslf
dzbgbfsbflxrcrfsrftvhyhfshfbtxuxfsxfksorogtogsqenegtegaoujugtugimkfkgtkg
qkabagtagyiqxqgtqgoewpwgtwgwcmlmgtmgeachcgtcgmysdsgtsguwizigtigcuyvygtyg
ltpsphuphtrfofhufhbpvkvhuvhjnlglhulhrlbcbhubhzjryrhurhpfxqxhuxhxdnmnhunh
fbdidhudhnztethuthvxjajhujhdvzwzhuzhmuqtqivqiusgpgivgicqwlwivwikomhmivmi
smcdcivciakszsivsiqgyryivyiyeonoivoigcejeiveioaufuivuiwykbkivkiewaxaivai
nvrurjwrjvthqhjwhjdrxmxjwxjlpninjwnjtndedjwdjbltatjwtjrhzszjwzjzfpopjwpj
hdfkfjwfjpbvgvjwvjxzlcljwljfxbybjwbjowsvskxskwuirikxikesynykxykmqojokxok
uoefekxekcmubukxuksiatakxakagqpqkxqkieglgkxgkqcwhwkxwkyamdmkxmkgyczckxck
pxtwtlytlxvjsjlyjlftzozlyzlnrpkplyplvpfgflyfldnvcvlyvltjbublyblbhrqrlyrl
jfhmhlyhlrdxixlyxlzbnenlynlhzdadlydlqyuxumzumywktkmzkmguapamzamosqlqmzqm
wqghgmzgmeowdwmzwmukcvcmzcmcisrsmzsmkginimzimseyjymzymacofomzomiaebemzem
rzvyvnavnzxlulnalnhvbqbnabnptrmrnarnxrhihnahnfpxexnaxnvldwdnadndjtstnatn
lhjojnajntfzkznaznbdpgpnapnjbfcfnafnsawzwobwoaymvmobmoiwcrcobcoqusnsobso
ysijiobiogqyfyobyowmexeobeoekutuobuomikpkobkougalaobaoceqhqobqokcgdgobgo
tbxaxpcxpbznwnpcnpjxdsdpcdprvtotpctpztjkjpcjphrzgzpczpxnfyfpcfpflvuvpcvp
njlqlpclpvhbmbpcbpdfrirpcrpldhehpchpucybyqdyqcaoxoqdoqkyeteqdeqswupuqduq
auklkqdkqisahaqdaqyogzgqdgqgmwvwqdwqokmrmqdmqwicncqdcqegsjsqdsqmeifiqdiq
vdzczrezrdbpypreprlzfufrefrtxvqvrevrbvlmlrelrjtbibrebrzphahrehrhnxwxrexr
plnsnrenrxjdodredrfhtktretrnfjgjrejrweadasfasecqzqsfqsmagvgsfgsuywrwsfws
cwmnmsfmskucjcsfcsaqibisfisioyxysfysqmotosfosykepesfesgiulusfusogkhksfks
xfbebtgbtfdrartgrtnbhwhtghtvzxsxtgxtdxnontgntlvdkdtgdtbrjcjtgjtjpzyztgzt
rnpuptgptzlfqftgfthjvmvtgvtphliltgltygcfcuhcugesbsuhsuocixiuhiuwaytyuhyu
eyopouhoumweleuheucskdkuhkukqazauhausoqvquhquamgrguhguikwnwuhwuqimjmuhmu
zhdgdvidvhftctvitvpdjyjvijvxbzuzvizvfzpqpvipvnxfmfvifvdtlelvilvlrbabvibv
tprwrvirvbnhshvihvjlxoxvixvrjnknvinvaiehewjewiguduwjuwqekzkwjkwycavawjaw
gaqrqwjqwoygngwjgweumfmwjmwmscbcwjcwuqsxswjswcoitiwjiwkmypywjywskolowjow
bjfifxkfxjhvevxkvxrflalxklxzdbwbxkbxhbrsrxkrxpzhohxkhxfvngnxknxntdcdxkdx
vrtytxktxdpjujxkjxlnzqzxkzxtlpmpxkpxckgjgylgykiwfwylwysgmbmylmyaecxcylcy
icstsylsyqaipiyliygwohoyloyouedeyleywsuzuyluyeqkvkylkymoaraylayumqnqylqy
dlhkhzmhzljxgxzmxzthncnzmnzbfdydzmdzjdtutzmtzrbjqjzmjzhxpipzmpzpvfefzmfz
xtvavzmvzfrlwlzmlznpbsbzmbzvnrorzmrzemilianiamkyhyanyauiodoanoacgezeanea
keuvuanuasckrkankaiyqjqanqaqwgfgangayuwbwanwagsmxmanmaoqctcancawospsansa

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: emiliania
Cipher: rzvyvnavn

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: emiliania
Cipher: 512342134211334211

Extended Methods:
Method #1

Plaintext: emiliania
method variations:
kroqofsofpwtvtlxtlubyayqcyqzgdfdvhdv

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
e m i l i a n i a 
5 2 4 1 4 1 3 4 1 
1 3 2 3 2 1 3 2 1 
They are then read out in rows:
524141341132321321
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: emiliania
Cipher: kddsahhlb

Read more ...
Method #3

Plaintext: emiliania
method variations:
fsbsblsbv sbsblsbvf bsblsbvfs
sblsbvfsb blsbvfsbs lsbvfsbsb
sbvfsbsbl bvfsbsbls vfsbsblsb

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: emiliania

first 5040 cipher variations(362880 total)
emiliania emilianai emiliaina emiliaian emiliaain emiliaani emilinaia emilinaai emiliniaa emiliniaa emilinaia
emilinaai emiliinaa emiliinaa emiliiana emiliiaan emiliiaan emiliiana emiliania emilianai emiliaina emiliaian
emiliaain emiliaani emilainia emilainai emilaiina emilaiian emilaiain emilaiani emilaniia emilaniai emilaniia
emilaniai emilanaii emilanaii emilainia emilainai emilaiina emilaiian emilaiain emilaiani emilaanii emilaanii
emilaaini emilaaiin emilaaiin emilaaini emilnaiia emilnaiai emilnaiia emilnaiai emilnaaii emilnaaii emilniaia
emilniaai emilniiaa emilniiaa emilniaia emilniaai emilniiaa emilniiaa emilniaia emilniaai emilniaai emilniaia
emilnaiia emilnaiai emilnaiia emilnaiai emilnaaii emilnaaii emiliania emilianai emiliaina emiliaian emiliaain
emiliaani emilinaia emilinaai emiliniaa emiliniaa emilinaia emilinaai emiliinaa emiliinaa emiliiana emiliiaan
emiliiaan emiliiana emiliania emilianai emiliaina emiliaian emiliaain emiliaani emilaanii emilaanii emilaaini
emilaaiin emilaaiin emilaaini emilanaii emilanaii emilaniai emilaniia emilaniia emilaniai emilainai emilainia
emilaiani emilaiain emilaiian emilaiina emilainia emilainai emilaiina emilaiian emilaiain emilaiani emiilania
emiilanai emiilaina emiilaian emiilaain emiilaani emiilnaia emiilnaai emiilniaa emiilniaa emiilnaia emiilnaai
emiilinaa emiilinaa emiiliana emiiliaan emiiliaan emiiliana emiilania emiilanai emiilaina emiilaian emiilaain
emiilaani emiialnia emiialnai emiialina emiialian emiialain emiialani emiianlia emiianlai emiianila emiianial
emiianail emiianali emiiainla emiiainal emiiailna emiiailan emiiaialn emiiaianl emiiaanil emiiaanli emiiaainl
emiiaailn emiiaalin emiiaalni emiinalia emiinalai emiinaila emiinaial emiinaail emiinaali emiinlaia emiinlaai
emiinliaa emiinliaa emiinlaia emiinlaai emiinilaa emiinilaa emiiniala emiiniaal emiiniaal emiiniala emiinalia
emiinalai emiinaila emiinaial emiinaail emiinaali emiiianla emiiianal emiiialna emiiialan emiiiaaln emiiiaanl
emiiinala emiiinaal emiiinlaa emiiinlaa emiiinala emiiinaal emiiilnaa emiiilnaa emiiilana emiiilaan emiiilaan
emiiilana emiiianla emiiianal emiiialna emiiialan emiiiaaln emiiiaanl emiiaanil emiiaanli emiiaainl emiiaailn
emiiaalin emiiaalni emiianail emiianali emiianial emiianila emiianlia emiianlai emiiainal emiiainla emiiaianl
emiiaialn emiiailan emiiailna emiialnia emiialnai emiialina emiialian emiialain emiialani emiailnia emiailnai
emiailina emiailian emiailain emiailani emiainlia emiainlai emiainila emiainial emiainail emiainali emiaiinla
emiaiinal emiaiilna emiaiilan emiaiialn emiaiianl emiaianil emiaianli emiaiainl emiaiailn emiaialin emiaialni
emialinia emialinai emialiina emialiian emialiain emialiani emialniia emialniai emialniia emialniai emialnaii
emialnaii emialinia emialinai emialiina emialiian emialiain emialiani emialanii emialanii emialaini emialaiin
emialaiin emialaini emianliia emianliai emianliia emianliai emianlaii emianlaii emianilia emianilai emianiila
emianiial emianiail emianiali emianiila emianiial emianilia emianilai emianiali emianiail emianaiil emianaili
emianaiil emianaili emianalii emianalii emiailnia emiailnai emiailina emiailian emiailain emiailani emiainlia
emiainlai emiainila emiainial emiainail emiainali emiaiinla emiaiinal emiaiilna emiaiilan emiaiialn emiaiianl
emiaianil emiaianli emiaiainl emiaiailn emiaialin emiaialni emiaalnii emiaalnii emiaalini emiaaliin emiaaliin
emiaalini emiaanlii emiaanlii emiaanili emiaaniil emiaaniil emiaanili emiaainli emiaainil emiaailni emiaailin
emiaaiiln emiaaiinl emiaainil emiaainli emiaaiinl emiaaiiln emiaailin emiaailni eminialia eminialai eminiaila
eminiaial eminiaail eminiaali eminilaia eminilaai eminiliaa eminiliaa eminilaia eminilaai eminiilaa eminiilaa
eminiiala eminiiaal eminiiaal eminiiala eminialia eminialai eminiaila eminiaial eminiaail eminiaali eminailia
eminailai eminaiila eminaiial eminaiail eminaiali eminaliia eminaliai eminaliia eminaliai eminalaii eminalaii
eminailia eminailai eminaiila eminaiial eminaiail eminaiali eminaalii eminaalii eminaaili eminaaiil eminaaiil
eminaaili eminlaiia eminlaiai eminlaiia eminlaiai eminlaaii eminlaaii eminliaia eminliaai eminliiaa eminliiaa
eminliaia eminliaai eminliiaa eminliiaa eminliaia eminliaai eminliaai eminliaia eminlaiia eminlaiai eminlaiia
eminlaiai eminlaaii eminlaaii eminialia eminialai eminiaila eminiaial eminiaail eminiaali eminilaia eminilaai
eminiliaa eminiliaa eminilaia eminilaai eminiilaa eminiilaa eminiiala eminiiaal eminiiaal eminiiala eminialia
eminialai eminiaila eminiaial eminiaail eminiaali eminaalii eminaalii eminaaili eminaaiil eminaaiil eminaaili
eminalaii eminalaii eminaliai eminaliia eminaliia eminaliai eminailai eminailia eminaiali eminaiail eminaiial
eminaiila eminailia eminailai eminaiila eminaiial eminaiail eminaiali emiiianla emiiianal emiiialna emiiialan
emiiiaaln emiiiaanl emiiinala emiiinaal emiiinlaa emiiinlaa emiiinala emiiinaal emiiilnaa emiiilnaa emiiilana
emiiilaan emiiilaan emiiilana emiiianla emiiianal emiiialna emiiialan emiiiaaln emiiiaanl emiiainla emiiainal
emiiailna emiiailan emiiaialn emiiaianl emiianila emiianial emiianlia emiianlai emiianali emiianail emiialnia
emiialnai emiialina emiialian emiialain emiialani emiiaanli emiiaanil emiiaalni emiiaalin emiiaailn emiiaainl
emiinaila emiinaial emiinalia emiinalai emiinaali emiinaail emiiniala emiiniaal emiinilaa emiinilaa emiiniala
emiiniaal emiinliaa emiinliaa emiinlaia emiinlaai emiinlaai emiinlaia emiinaila emiinaial emiinalia emiinalai
emiinaali emiinaail emiilania emiilanai emiilaina emiilaian emiilaain emiilaani emiilnaia emiilnaai emiilniaa
emiilniaa emiilnaia emiilnaai emiilinaa emiilinaa emiiliana emiiliaan emiiliaan emiiliana emiilania emiilanai
emiilaina emiilaian emiilaain emiilaani emiiaanli emiiaanil emiiaalni emiiaalin emiiaailn emiiaainl emiianali
emiianail emiianlai emiianlia emiianila emiianial emiialnai emiialnia emiialani emiialain emiialian emiialina
emiiainla emiiainal emiiailna emiiailan emiiaialn emiiaianl emiaianil emiaianli emiaiainl emiaiailn emiaialin
emiaialni emiainail emiainali emiainial emiainila emiainlia emiainlai emiaiinal emiaiinla emiaiianl emiaiialn
emiaiilan emiaiilna emiailnia emiailnai emiailina emiailian emiailain emiailani emiaainil emiaainli emiaaiinl
emiaaiiln emiaailin emiaailni emiaaniil emiaanili emiaaniil emiaanili emiaanlii emiaanlii emiaainil emiaainli
emiaaiinl emiaaiiln emiaailin emiaailni emiaalnii emiaalnii emiaalini emiaaliin emiaaliin emiaalini emianaiil
emianaili emianaiil emianaili emianalii emianalii emianiail emianiali emianiial emianiila emianilia emianilai
emianiial emianiila emianiail emianiali emianilai emianilia emianliia emianliai emianliia emianliai emianlaii
emianlaii emiaianil emiaianli emiaiainl emiaiailn emiaialin emiaialni emiainail emiainali emiainial emiainila
emiainlia emiainlai emiaiinal emiaiinla emiaiianl emiaiialn emiaiilan emiaiilna emiailnia emiailnai emiailina
emiailian emiailain emiailani emialanii emialanii emialaini emialaiin emialaiin emialaini emialnaii emialnaii
emialniai emialniia emialniia emialniai emialinai emialinia emialiani emialiain emialiian emialiina emialinia
emialinai emialiina emialiian emialiain emialiani emliiania emliianai emliiaina emliiaian emliiaain emliiaani
emliinaia emliinaai emliiniaa emliiniaa emliinaia emliinaai emliiinaa emliiinaa emliiiana emliiiaan emliiiaan
emliiiana emliiania emliianai emliiaina emliiaian emliiaain emliiaani emliainia emliainai emliaiina emliaiian
emliaiain emliaiani emlianiia emlianiai emlianiia emlianiai emlianaii emlianaii emliainia emliainai emliaiina
emliaiian emliaiain emliaiani emliaanii emliaanii emliaaini emliaaiin emliaaiin emliaaini emlinaiia emlinaiai
emlinaiia emlinaiai emlinaaii emlinaaii emliniaia emliniaai emliniiaa emliniiaa emliniaia emliniaai emliniiaa
emliniiaa emliniaia emliniaai emliniaai emliniaia emlinaiia emlinaiai emlinaiia emlinaiai emlinaaii emlinaaii
emliiania emliianai emliiaina emliiaian emliiaain emliiaani emliinaia emliinaai emliiniaa emliiniaa emliinaia
emliinaai emliiinaa emliiinaa emliiiana emliiiaan emliiiaan emliiiana emliiania emliianai emliiaina emliiaian
emliiaain emliiaani emliaanii emliaanii emliaaini emliaaiin emliaaiin emliaaini emlianaii emlianaii emlianiai
emlianiia emlianiia emlianiai emliainai emliainia emliaiani emliaiain emliaiian emliaiina emliainia emliainai
emliaiina emliaiian emliaiain emliaiani emliiania emliianai emliiaina emliiaian emliiaain emliiaani emliinaia
emliinaai emliiniaa emliiniaa emliinaia emliinaai emliiinaa emliiinaa emliiiana emliiiaan emliiiaan emliiiana
emliiania emliianai emliiaina emliiaian emliiaain emliiaani emliainia emliainai emliaiina emliaiian emliaiain
emliaiani emlianiia emlianiai emlianiia emlianiai emlianaii emlianaii emliainia emliainai emliaiina emliaiian
emliaiain emliaiani emliaanii emliaanii emliaaini emliaaiin emliaaiin emliaaini emlinaiia emlinaiai emlinaiia
emlinaiai emlinaaii emlinaaii emliniaia emliniaai emliniiaa emliniiaa emliniaia emliniaai emliniiaa emliniiaa
emliniaia emliniaai emliniaai emliniaia emlinaiia emlinaiai emlinaiia emlinaiai emlinaaii emlinaaii emliiania
emliianai emliiaina emliiaian emliiaain emliiaani emliinaia emliinaai emliiniaa emliiniaa emliinaia emliinaai
emliiinaa emliiinaa emliiiana emliiiaan emliiiaan emliiiana emliiania emliianai emliiaina emliiaian emliiaain
emliiaani emliaanii emliaanii emliaaini emliaaiin emliaaiin emliaaini emlianaii emlianaii emlianiai emlianiia
emlianiia emlianiai emliainai emliainia emliaiani emliaiain emliaiian emliaiina emliainia emliainai emliaiina
emliaiian emliaiain emliaiani emlaiinia emlaiinai emlaiiina emlaiiian emlaiiain emlaiiani emlainiia emlainiai
emlainiia emlainiai emlainaii emlainaii emlaiinia emlaiinai emlaiiina emlaiiian emlaiiain emlaiiani emlaianii
emlaianii emlaiaini emlaiaiin emlaiaiin emlaiaini emlaiinia emlaiinai emlaiiina emlaiiian emlaiiain emlaiiani
emlainiia emlainiai emlainiia emlainiai emlainaii emlainaii emlaiinia emlaiinai emlaiiina emlaiiian emlaiiain
emlaiiani emlaianii emlaianii emlaiaini emlaiaiin emlaiaiin emlaiaini emlaniiia emlaniiai emlaniiia emlaniiai
emlaniaii emlaniaii emlaniiia emlaniiai emlaniiia emlaniiai emlaniaii emlaniaii emlaniiia emlaniiai emlaniiia
emlaniiai emlaniaii emlaniaii emlanaiii emlanaiii emlanaiii emlanaiii emlanaiii emlanaiii emlaiinia emlaiinai
emlaiiina emlaiiian emlaiiain emlaiiani emlainiia emlainiai emlainiia emlainiai emlainaii emlainaii emlaiinia
emlaiinai emlaiiina emlaiiian emlaiiain emlaiiani emlaianii emlaianii emlaiaini emlaiaiin emlaiaiin emlaiaini
emlaainii emlaainii emlaaiini emlaaiiin emlaaiiin emlaaiini emlaaniii emlaaniii emlaaniii emlaaniii emlaaniii
emlaaniii emlaainii emlaainii emlaaiini emlaaiiin emlaaiiin emlaaiini emlaainii emlaainii emlaaiini emlaaiiin
emlaaiiin emlaaiini emlniaiia emlniaiai emlniaiia emlniaiai emlniaaii emlniaaii emlniiaia emlniiaai emlniiiaa
emlniiiaa emlniiaia emlniiaai emlniiiaa emlniiiaa emlniiaia emlniiaai emlniiaai emlniiaia emlniaiia emlniaiai
emlniaiia emlniaiai emlniaaii emlniaaii emlnaiiia emlnaiiai emlnaiiia emlnaiiai emlnaiaii emlnaiaii emlnaiiia
emlnaiiai emlnaiiia emlnaiiai emlnaiaii emlnaiaii emlnaiiia emlnaiiai emlnaiiia emlnaiiai emlnaiaii emlnaiaii
emlnaaiii emlnaaiii emlnaaiii emlnaaiii emlnaaiii emlnaaiii emlniaiia emlniaiai emlniaiia emlniaiai emlniaaii
emlniaaii emlniiaia emlniiaai emlniiiaa emlniiiaa emlniiaia emlniiaai emlniiiaa emlniiiaa emlniiaia emlniiaai
emlniiaai emlniiaia emlniaiia emlniaiai emlniaiia emlniaiai emlniaaii emlniaaii emlniaiia emlniaiai emlniaiia
emlniaiai emlniaaii emlniaaii emlniiaia emlniiaai emlniiiaa emlniiiaa emlniiaia emlniiaai emlniiiaa emlniiiaa
emlniiaia emlniiaai emlniiaai emlniiaia emlniaiia emlniaiai emlniaiia emlniaiai emlniaaii emlniaaii emlnaaiii
emlnaaiii emlnaaiii emlnaaiii emlnaaiii emlnaaiii emlnaiaii emlnaiaii emlnaiiai emlnaiiia emlnaiiia emlnaiiai
emlnaiiai emlnaiiia emlnaiaii emlnaiaii emlnaiiai emlnaiiia emlnaiiia emlnaiiai emlnaiiia emlnaiiai emlnaiaii
emlnaiaii emliiania emliianai emliiaina emliiaian emliiaain emliiaani emliinaia emliinaai emliiniaa emliiniaa
emliinaia emliinaai emliiinaa emliiinaa emliiiana emliiiaan emliiiaan emliiiana emliiania emliianai emliiaina
emliiaian emliiaain emliiaani emliainia emliainai emliaiina emliaiian emliaiain emliaiani emlianiia emlianiai
emlianiia emlianiai emlianaii emlianaii emliainia emliainai emliaiina emliaiian emliaiain emliaiani emliaanii
emliaanii emliaaini emliaaiin emliaaiin emliaaini emlinaiia emlinaiai emlinaiia emlinaiai emlinaaii emlinaaii
emliniaia emliniaai emliniiaa emliniiaa emliniaia emliniaai emliniiaa emliniiaa emliniaia emliniaai emliniaai
emliniaia emlinaiia emlinaiai emlinaiia emlinaiai emlinaaii emlinaaii emliiania emliianai emliiaina emliiaian
emliiaain emliiaani emliinaia emliinaai emliiniaa emliiniaa emliinaia emliinaai emliiinaa emliiinaa emliiiana
emliiiaan emliiiaan emliiiana emliiania emliianai emliiaina emliiaian emliiaain emliiaani emliaanii emliaanii
emliaaini emliaaiin emliaaiin emliaaini emlianaii emlianaii emlianiai emlianiia emlianiia emlianiai emliainai
emliainia emliaiani emliaiain emliaiian emliaiina emliainia emliainai emliaiina emliaiian emliaiain emliaiani
emlaianii emlaianii emlaiaini emlaiaiin emlaiaiin emlaiaini emlainaii emlainaii emlainiai emlainiia emlainiia
emlainiai emlaiinai emlaiinia emlaiiani emlaiiain emlaiiian emlaiiina emlaiinia emlaiinai emlaiiina emlaiiian
emlaiiain emlaiiani emlaainii emlaainii emlaaiini emlaaiiin emlaaiiin emlaaiini emlaaniii emlaaniii emlaaniii
emlaaniii emlaaniii emlaaniii emlaainii emlaainii emlaaiini emlaaiiin emlaaiiin emlaaiini emlaainii emlaainii
emlaaiini emlaaiiin emlaaiiin emlaaiini emlanaiii emlanaiii emlanaiii emlanaiii emlanaiii emlanaiii emlaniaii
emlaniaii emlaniiai emlaniiia emlaniiia emlaniiai emlaniiai emlaniiia emlaniaii emlaniaii emlaniiai emlaniiia
emlaniiia emlaniiai emlaniiia emlaniiai emlaniaii emlaniaii emlaianii emlaianii emlaiaini emlaiaiin emlaiaiin
emlaiaini emlainaii emlainaii emlainiai emlainiia emlainiia emlainiai emlaiinai emlaiinia emlaiiani emlaiiain
emlaiiian emlaiiina emlaiinia emlaiinai emlaiiina emlaiiian emlaiiain emlaiiani emlaianii emlaianii emlaiaini
emlaiaiin emlaiaiin emlaiaini emlainaii emlainaii emlainiai emlainiia emlainiia emlainiai emlaiinai emlaiinia
emlaiiani emlaiiain emlaiiian emlaiiina emlaiinia emlaiinai emlaiiina emlaiiian emlaiiain emlaiiani emiliania
emilianai emiliaina emiliaian emiliaain emiliaani emilinaia emilinaai emiliniaa emiliniaa emilinaia emilinaai
emiliinaa emiliinaa emiliiana emiliiaan emiliiaan emiliiana emiliania emilianai emiliaina emiliaian emiliaain
emiliaani emilainia emilainai emilaiina emilaiian emilaiain emilaiani emilaniia emilaniai emilaniia emilaniai
emilanaii emilanaii emilainia emilainai emilaiina emilaiian emilaiain emilaiani emilaanii emilaanii emilaaini
emilaaiin emilaaiin emilaaini emilnaiia emilnaiai emilnaiia emilnaiai emilnaaii emilnaaii emilniaia emilniaai
emilniiaa emilniiaa emilniaia emilniaai emilniiaa emilniiaa emilniaia emilniaai emilniaai emilniaia emilnaiia
emilnaiai emilnaiia emilnaiai emilnaaii emilnaaii emiliania emilianai emiliaina emiliaian emiliaain emiliaani
emilinaia emilinaai emiliniaa emiliniaa emilinaia emilinaai emiliinaa emiliinaa emiliiana emiliiaan emiliiaan
emiliiana emiliania emilianai emiliaina emiliaian emiliaain emiliaani emilaanii emilaanii emilaaini emilaaiin
emilaaiin emilaaini emilanaii emilanaii emilaniai emilaniia emilaniia emilaniai emilainai emilainia emilaiani
emilaiain emilaiian emilaiina emilainia emilainai emilaiina emilaiian emilaiain emilaiani emiilania emiilanai
emiilaina emiilaian emiilaain emiilaani emiilnaia emiilnaai emiilniaa emiilniaa emiilnaia emiilnaai emiilinaa
emiilinaa emiiliana emiiliaan emiiliaan emiiliana emiilania emiilanai emiilaina emiilaian emiilaain emiilaani
emiialnia emiialnai emiialina emiialian emiialain emiialani emiianlia emiianlai emiianila emiianial emiianail
emiianali emiiainla emiiainal emiiailna emiiailan emiiaialn emiiaianl emiiaanil emiiaanli emiiaainl emiiaailn
emiiaalin emiiaalni emiinalia emiinalai emiinaila emiinaial emiinaail emiinaali emiinlaia emiinlaai emiinliaa
emiinliaa emiinlaia emiinlaai emiinilaa emiinilaa emiiniala emiiniaal emiiniaal emiiniala emiinalia emiinalai
emiinaila emiinaial emiinaail emiinaali emiiianla emiiianal emiiialna emiiialan emiiiaaln emiiiaanl emiiinala
emiiinaal emiiinlaa emiiinlaa emiiinala emiiinaal emiiilnaa emiiilnaa emiiilana emiiilaan emiiilaan emiiilana
emiiianla emiiianal emiiialna emiiialan emiiiaaln emiiiaanl emiiaanil emiiaanli emiiaainl emiiaailn emiiaalin
emiiaalni emiianail emiianali emiianial emiianila emiianlia emiianlai emiiainal emiiainla emiiaianl emiiaialn
emiiailan emiiailna emiialnia emiialnai emiialina emiialian emiialain emiialani emiailnia emiailnai emiailina
emiailian emiailain emiailani emiainlia emiainlai emiainila emiainial emiainail emiainali emiaiinla emiaiinal
emiaiilna emiaiilan emiaiialn emiaiianl emiaianil emiaianli emiaiainl emiaiailn emiaialin emiaialni emialinia
emialinai emialiina emialiian emialiain emialiani emialniia emialniai emialniia emialniai emialnaii emialnaii
emialinia emialinai emialiina emialiian emialiain emialiani emialanii emialanii emialaini emialaiin emialaiin
emialaini emianliia emianliai emianliia emianliai emianlaii emianlaii emianilia emianilai emianiila emianiial
emianiail emianiali emianiila emianiial emianilia emianilai emianiali emianiail emianaiil emianaili emianaiil
emianaili emianalii emianalii emiailnia emiailnai emiailina emiailian emiailain emiailani emiainlia emiainlai
emiainila emiainial emiainail emiainali emiaiinla emiaiinal emiaiilna emiaiilan emiaiialn emiaiianl emiaianil
emiaianli emiaiainl emiaiailn emiaialin emiaialni emiaalnii emiaalnii emiaalini emiaaliin emiaaliin emiaalini
emiaanlii emiaanlii emiaanili emiaaniil emiaaniil emiaanili emiaainli emiaainil emiaailni emiaailin emiaaiiln
emiaaiinl emiaainil emiaainli emiaaiinl emiaaiiln emiaailin emiaailni eminialia eminialai eminiaila eminiaial
eminiaail eminiaali eminilaia eminilaai eminiliaa eminiliaa eminilaia eminilaai eminiilaa eminiilaa eminiiala
eminiiaal eminiiaal eminiiala eminialia eminialai eminiaila eminiaial eminiaail eminiaali eminailia eminailai
eminaiila eminaiial eminaiail eminaiali eminaliia eminaliai eminaliia eminaliai eminalaii eminalaii eminailia
eminailai eminaiila eminaiial eminaiail eminaiali eminaalii eminaalii eminaaili eminaaiil eminaaiil eminaaili
eminlaiia eminlaiai eminlaiia eminlaiai eminlaaii eminlaaii eminliaia eminliaai eminliiaa eminliiaa eminliaia
eminliaai eminliiaa eminliiaa eminliaia eminliaai eminliaai eminliaia eminlaiia eminlaiai eminlaiia eminlaiai
eminlaaii eminlaaii eminialia eminialai eminiaila eminiaial eminiaail eminiaali eminilaia eminilaai eminiliaa
eminiliaa eminilaia eminilaai eminiilaa eminiilaa eminiiala eminiiaal eminiiaal eminiiala eminialia eminialai
eminiaila eminiaial eminiaail eminiaali eminaalii eminaalii eminaaili eminaaiil eminaaiil eminaaili eminalaii
eminalaii eminaliai eminaliia eminaliia eminaliai eminailai eminailia eminaiali eminaiail eminaiial eminaiila
eminailia eminailai eminaiila eminaiial eminaiail eminaiali emiiianla emiiianal emiiialna emiiialan emiiiaaln
emiiiaanl emiiinala emiiinaal emiiinlaa emiiinlaa emiiinala emiiinaal emiiilnaa emiiilnaa emiiilana emiiilaan
emiiilaan emiiilana emiiianla emiiianal emiiialna emiiialan emiiiaaln emiiiaanl emiiainla emiiainal emiiailna
emiiailan emiiaialn emiiaianl emiianila emiianial emiianlia emiianlai emiianali emiianail emiialnia emiialnai
emiialina emiialian emiialain emiialani emiiaanli emiiaanil emiiaalni emiiaalin emiiaailn emiiaainl emiinaila
emiinaial emiinalia emiinalai emiinaali emiinaail emiiniala emiiniaal emiinilaa emiinilaa emiiniala emiiniaal
emiinliaa emiinliaa emiinlaia emiinlaai emiinlaai emiinlaia emiinaila emiinaial emiinalia emiinalai emiinaali
emiinaail emiilania emiilanai emiilaina emiilaian emiilaain emiilaani emiilnaia emiilnaai emiilniaa emiilniaa
emiilnaia emiilnaai emiilinaa emiilinaa emiiliana emiiliaan emiiliaan emiiliana emiilania emiilanai emiilaina
emiilaian emiilaain emiilaani emiiaanli emiiaanil emiiaalni emiiaalin emiiaailn emiiaainl emiianali emiianail
emiianlai emiianlia emiianila emiianial emiialnai emiialnia emiialani emiialain emiialian emiialina emiiainla
emiiainal emiiailna emiiailan emiiaialn emiiaianl emiaianil emiaianli emiaiainl emiaiailn emiaialin emiaialni
emiainail emiainali emiainial emiainila emiainlia emiainlai emiaiinal emiaiinla emiaiianl emiaiialn emiaiilan
emiaiilna emiailnia emiailnai emiailina emiailian emiailain emiailani emiaainil emiaainli emiaaiinl emiaaiiln
emiaailin emiaailni emiaaniil emiaanili emiaaniil emiaanili emiaanlii emiaanlii emiaainil emiaainli emiaaiinl
emiaaiiln emiaailin emiaailni emiaalnii emiaalnii emiaalini emiaaliin emiaaliin emiaalini emianaiil emianaili
emianaiil emianaili emianalii emianalii emianiail emianiali emianiial emianiila emianilia emianilai emianiial
emianiila emianiail emianiali emianilai emianilia emianliia emianliai emianliia emianliai emianlaii emianlaii
emiaianil emiaianli emiaiainl emiaiailn emiaialin emiaialni emiainail emiainali emiainial emiainila emiainlia
emiainlai emiaiinal emiaiinla emiaiianl emiaiialn emiaiilan emiaiilna emiailnia emiailnai emiailina emiailian
emiailain emiailani emialanii emialanii emialaini emialaiin emialaiin emialaini emialnaii emialnaii emialniai
emialniia emialniia emialniai emialinai emialinia emialiani emialiain emialiian emialiina emialinia emialinai
emialiina emialiian emialiain emialiani emaliinia emaliinai emaliiina emaliiian emaliiain emaliiani emaliniia
emaliniai emaliniia emaliniai emalinaii emalinaii emaliinia emaliinai emaliiina emaliiian emaliiain emaliiani
emalianii emalianii emaliaini emaliaiin emaliaiin emaliaini emaliinia emaliinai emaliiina emaliiian emaliiain
emaliiani emaliniia emaliniai emaliniia emaliniai emalinaii emalinaii emaliinia emaliinai emaliiina emaliiian
emaliiain emaliiani emalianii emalianii emaliaini emaliaiin emaliaiin emaliaini emalniiia emalniiai emalniiia
emalniiai emalniaii emalniaii emalniiia emalniiai emalniiia emalniiai emalniaii emalniaii emalniiia emalniiai
emalniiia emalniiai emalniaii emalniaii emalnaiii emalnaiii emalnaiii emalnaiii emalnaiii emalnaiii emaliinia
emaliinai emaliiina emaliiian emaliiain emaliiani emaliniia emaliniai emaliniia emaliniai emalinaii emalinaii
emaliinia emaliinai emaliiina emaliiian emaliiain emaliiani emalianii emalianii emaliaini emaliaiin emaliaiin
emaliaini emalainii emalainii emalaiini emalaiiin emalaiiin emalaiini emalaniii emalaniii emalaniii emalaniii
emalaniii emalaniii emalainii emalainii emalaiini emalaiiin emalaiiin emalaiini emalainii emalainii emalaiini
emalaiiin emalaiiin emalaiini emailinia emailinai emailiina emailiian emailiain emailiani emailniia emailniai
emailniia emailniai emailnaii emailnaii emailinia emailinai emailiina emailiian emailiain emailiani emailanii
emailanii emailaini emailaiin emailaiin emailaini emaiilnia emaiilnai emaiilina emaiilian emaiilain emaiilani
emaiinlia emaiinlai emaiinila emaiinial emaiinail emaiinali emaiiinla emaiiinal emaiiilna emaiiilan emaiiialn
emaiiianl emaiianil emaiianli emaiiainl emaiiailn emaiialin emaiialni emainilia emainilai emainiila emainiial
emainiail emainiali emainliia emainliai emainliia emainliai emainlaii emainlaii emainilia emainilai emainiila
emainiial emainiail emainiali emainalii emainalii emainaili emainaiil emainaiil emainaili emaiiinla emaiiinal
emaiiilna emaiiilan emaiiialn emaiiianl emaiinila emaiinial emaiinlia emaiinlai emaiinali emaiinail emaiilnia
emaiilnai emaiilina emaiilian emaiilain emaiilani emaiianli emaiianil emaiialni emaiialin emaiiailn emaiiainl
emaiainil emaiainli emaiaiinl emaiaiiln emaiailin emaiailni emaianiil emaianili emaianiil emaianili emaianlii
emaianlii emaiainil emaiainli emaiaiinl emaiaiiln emaiailin emaiailni emaialnii emaialnii emaialini emaialiin
emaialiin emaialini emaiilnia emaiilnai emaiilina emaiilian emaiilain emaiilani emaiinlia emaiinlai emaiinila
emaiinial emaiinail emaiinali emaiiinla emaiiinal emaiiilna emaiiilan emaiiialn emaiiianl emaiianil emaiianli
emaiiainl emaiiailn emaiialin emaiialni emailinia emailinai emailiina emailiian emailiain emailiani emailniia
emailniai emailniia emailniai emailnaii emailnaii emailinia emailinai emailiina emailiian emailiain emailiani
emailanii emailanii emailaini emailaiin emailaiin emailaini emainliia emainliai emainliia emainliai emainlaii
emainlaii emainilia emainilai emainiila emainiial emainiail emainiali emainiila emainiial emainilia emainilai
emainiali emainiail emainaiil emainaili emainaiil emainaili emainalii emainalii emaiilnia emaiilnai emaiilina
emaiilian emaiilain emaiilani emaiinlia emaiinlai emaiinila emaiinial emaiinail emaiinali emaiiinla emaiiinal
emaiiilna emaiiilan emaiiialn emaiiianl emaiianil emaiianli emaiiainl emaiiailn emaiialin emaiialni emaialnii
emaialnii emaialini emaialiin emaialiin emaialini emaianlii emaianlii emaianili emaianiil emaianiil emaianili
emaiainli emaiainil emaiailni emaiailin emaiaiiln emaiaiinl emaiainil emaiainli emaiaiinl emaiaiiln emaiailin
emaiailni emaniilia emaniilai emaniiila emaniiial emaniiail emaniiali emaniliia emaniliai emaniliia emaniliai
emanilaii emanilaii emaniilia emaniilai emaniiila emaniiial emaniiail emaniiali emanialii emanialii emaniaili
emaniaiil emaniaiil emaniaili emaniilia emaniilai emaniiila emaniiial emaniiail emaniiali emaniliia emaniliai
emaniliia emaniliai emanilaii emanilaii emaniilia emaniilai emaniiila emaniiial emaniiail emaniiali emanialii
emanialii emaniaili emaniaiil emaniaiil emaniaili emanliiia emanliiai emanliiia emanliiai emanliaii emanliaii
emanliiia emanliiai emanliiia emanliiai emanliaii emanliaii emanliiia emanliiai emanliiia emanliiai emanliaii
emanliaii emanlaiii emanlaiii emanlaiii emanlaiii emanlaiii emanlaiii emaniilia emaniilai emaniiila emaniiial
emaniiail emaniiali emaniliia emaniliai emaniliia emaniliai emanilaii emanilaii emaniilia emaniilai emaniiila
emaniiial emaniiail emaniiali emanialii emanialii emaniaili emaniaiil emaniaiil emaniaili emanailii emanailii
emanaiili emanaiiil emanaiiil emanaiili emanaliii emanaliii emanaliii emanaliii emanaliii emanaliii emanailii
emanailii emanaiili emanaiiil emanaiiil emanaiili emanailii emanailii emanaiili emanaiiil emanaiiil emanaiili
emaiiinla emaiiinal emaiiilna emaiiilan emaiiialn emaiiianl emaiinila emaiinial emaiinlia emaiinlai emaiinali
emaiinail emaiilnia emaiilnai emaiilina emaiilian emaiilain emaiilani emaiianli emaiianil emaiialni emaiialin
emaiiailn emaiiainl emaiiinla emaiiinal emaiiilna emaiiilan emaiiialn emaiiianl emaiinila emaiinial emaiinlia
emaiinlai emaiinali emaiinail emaiilnia emaiilnai emaiilina emaiilian emaiilain emaiilani emaiianli emaiianil
emaiialni emaiialin emaiiailn emaiiainl emainiila emainiial emainilia emainilai emainiali emainiail emainiila
emainiial emainilia emainilai emainiali emainiail emainliia emainliai emainliia emainliai emainlaii emainlaii
emainaili emainaiil emainalii emainalii emainaili emainaiil emailinia emailinai emailiina emailiian emailiain
emailiani emailniia emailniai emailniia emailniai emailnaii emailnaii emailinia emailinai emailiina emailiian
emailiain emailiani emailanii emailanii emailaini emailaiin emailaiin emailaini emaiainli emaiainil emaiailni
emaiailin emaiaiiln emaiaiinl emaianili emaianiil emaianlii emaianlii emaianili emaianiil emaialnii emaialnii
emaialini emaialiin emaialiin emaialini emaiainli emaiainil emaiailni emaiailin emaiaiiln emaiaiinl emaaiinil
emaaiinli emaaiiinl emaaiiiln emaaiilin emaaiilni emaainiil emaainili emaainiil emaainili emaainlii emaainlii
emaaiinil emaaiinli emaaiiinl emaaiiiln emaaiilin emaaiilni emaailnii emaailnii emaailini emaailiin emaailiin
emaailini emaaiinil emaaiinli emaaiiinl emaaiiiln emaaiilin emaaiilni emaainiil emaainili emaainiil emaainili
emaainlii emaainlii emaaiinil emaaiinli emaaiiinl emaaiiiln emaaiilin emaaiilni emaailnii emaailnii emaailini
emaailiin emaailiin emaailini emaaniiil emaaniili emaaniiil emaaniili emaanilii emaanilii emaaniiil emaaniili
emaaniiil emaaniili emaanilii emaanilii emaaniiil emaaniili emaaniiil emaaniili emaanilii emaanilii emaanliii
emaanliii emaanliii emaanliii emaanliii emaanliii emaaiinil emaaiinli emaaiiinl emaaiiiln emaaiilin emaaiilni
emaainiil emaainili emaainiil emaainili emaainlii emaainlii emaaiinil emaaiinli emaaiiinl emaaiiiln emaaiilin
emaaiilni emaailnii emaailnii emaailini emaailiin emaailiin emaailini emaalinii emaalinii emaaliini emaaliiin
emaaliiin emaaliini emaalniii emaalniii emaalniii emaalniii emaalniii emaalniii emaalinii emaalinii emaaliini
emaaliiin emaaliiin emaaliini emaalinii emaalinii emaaliini emaaliiin emaaliiin emaaliini emnliaiia emnliaiai
emnliaiia emnliaiai emnliaaii emnliaaii emnliiaia emnliiaai emnliiiaa emnliiiaa emnliiaia emnliiaai emnliiiaa
emnliiiaa emnliiaia emnliiaai emnliiaai emnliiaia emnliaiia emnliaiai emnliaiia emnliaiai emnliaaii emnliaaii
emnlaiiia emnlaiiai emnlaiiia emnlaiiai emnlaiaii emnlaiaii emnlaiiia emnlaiiai emnlaiiia emnlaiiai emnlaiaii
emnlaiaii emnlaiiia emnlaiiai emnlaiiia emnlaiiai emnlaiaii emnlaiaii emnlaaiii emnlaaiii emnlaaiii emnlaaiii
emnlaaiii emnlaaiii emnliaiia emnliaiai emnliaiia emnliaiai emnliaaii emnliaaii emnliiaia emnliiaai emnliiiaa
emnliiiaa emnliiaia emnliiaai emnliiiaa emnliiiaa emnliiaia emnliiaai emnliiaai emnliiaia emnliaiia emnliaiai
emnliaiia emnliaiai emnliaaii emnliaaii emnliaiia emnliaiai emnliaiia emnliaiai emnliaaii emnliaaii emnliiaia
emnliiaai emnliiiaa emnliiiaa emnliiaia emnliiaai emnliiiaa emnliiiaa emnliiaia emnliiaai emnliiaai emnliiaia
emnliaiia emnliaiai emnliaiia emnliaiai emnliaaii emnliaaii emnlaaiii emnlaaiii emnlaaiii emnlaaiii emnlaaiii
emnlaaiii emnlaiaii emnlaiaii emnlaiiai emnlaiiia emnlaiiia emnlaiiai emnlaiiai emnlaiiia emnlaiaii emnlaiaii
emnlaiiai emnlaiiia emnlaiiia emnlaiiai emnlaiiia emnlaiiai emnlaiaii emnlaiaii emnilaiia emnilaiai emnilaiia
emnilaiai emnilaaii emnilaaii emniliaia emniliaai emniliiaa emniliiaa emniliaia emniliaai emniliiaa emniliiaa
emniliaia emniliaai emniliaai emniliaia emnilaiia emnilaiai emnilaiia emnilaiai emnilaaii emnilaaii emnialiia
emnialiai emnialiia emnialiai emnialaii emnialaii emniailia emniailai emniaiila emniaiial emniaiail emniaiali
emniaiila emniaiial emniailia emniailai emniaiali emniaiail emniaaiil emniaaili emniaaiil emniaaili emniaalii
emniaalii emniialia emniialai emniiaila emniiaial emniiaail emniiaali emniilaia emniilaai emniiliaa emniiliaa
emniilaia emniilaai emniiilaa emniiilaa emniiiala emniiiaal emniiiaal emniiiala emniialia emniialai emniiaila
emniiaial emniiaail emniiaali emniiaila emniiaial emniialia emniialai emniiaali emniiaail emniiiala emniiiaal
emniiilaa emniiilaa emniiiala emniiiaal emniiliaa emniiliaa emniilaia emniilaai emniilaai emniilaia emniiaila
emniiaial emniialia emniialai emniiaali emniiaail emniaaiil emniaaili emniaaiil emniaaili emniaalii emniaalii
emniaiail emniaiali emniaiial emniaiila emniailia emniailai emniaiial emniaiila emniaiail emniaiali emniailai
emniailia emnialiia emnialiai emnialiia emnialiai emnialaii emnialaii emnailiia emnailiai emnailiia emnailiai
emnailaii emnailaii emnaiilia emnaiilai emnaiiila emnaiiial emnaiiail emnaiiali emnaiiila emnaiiial emnaiilia
emnaiilai emnaiiali emnaiiail emnaiaiil emnaiaili emnaiaiil emnaiaili emnaialii emnaialii emnaliiia emnaliiai
emnaliiia emnaliiai emnaliaii emnaliaii emnaliiia emnaliiai emnaliiia emnaliiai emnaliaii emnaliaii emnaliiia
emnaliiai emnaliiia emnaliiai emnaliaii emnaliaii emnalaiii emnalaiii emnalaiii emnalaiii emnalaiii emnalaiii
emnailiia emnailiai emnailiia emnailiai emnailaii emnailaii emnaiilia emnaiilai emnaiiila emnaiiial emnaiiail
emnaiiali emnaiiila emnaiiial emnaiilia emnaiilai emnaiiali emnaiiail emnaiaiil emnaiaili emnaiaiil emnaiaili
emnaialii emnaialii emnailiia emnailiai emnailiia emnailiai emnailaii emnailaii emnaiilia emnaiilai emnaiiila
emnaiiial emnaiiail emnaiiali emnaiiila emnaiiial emnaiilia emnaiilai emnaiiali emnaiiail emnaiaiil emnaiaili
emnaiaiil emnaiaili emnaialii emnaialii emnaaliii emnaaliii emnaaliii emnaaliii emnaaliii emnaaliii emnaailii
emnaailii emnaaiili emnaaiiil emnaaiiil emnaaiili emnaaiili emnaaiiil emnaailii emnaailii emnaaiili emnaaiiil
emnaaiiil emnaaiili emnaaiiil emnaaiili emnaailii emnaailii emniialia emniialai emniiaila emniiaial emniiaail
emniiaali emniilaia emniilaai emniiliaa emniiliaa emniilaia emniilaai emniiilaa emniiilaa emniiiala emniiiaal
emniiiaal emniiiala emniialia emniialai emniiaila emniiaial emniiaail emniiaali emniailia emniailai emniaiila
emniaiial emniaiail emniaiali emnialiia emnialiai emnialiia emnialiai emnialaii emnialaii emniailia emniailai
emniaiila emniaiial emniaiail emniaiali emniaalii emniaalii emniaaili emniaaiil emniaaiil emniaaili emnilaiia
emnilaiai emnilaiia emnilaiai emnilaaii emnilaaii emniliaia emniliaai emniliiaa emniliiaa emniliaia emniliaai
emniliiaa emniliiaa emniliaia emniliaai emniliaai emniliaia emnilaiia emnilaiai emnilaiia emnilaiai emnilaaii
emnilaaii emniialia emniialai emniiaila emniiaial emniiaail emniiaali emniilaia emniilaai emniiliaa emniiliaa
emniilaia emniilaai emniiilaa emniiilaa emniiiala emniiiaal emniiiaal emniiiala emniialia emniialai emniiaila
emniiaial emniiaail emniiaali emniaalii emniaalii emniaaili emniaaiil emniaaiil emniaaili emnialaii emnialaii
emnialiai emnialiia emnialiia emnialiai emniailai emniailia emniaiali emniaiail emniaiial emniaiila emniailia
emniailai emniaiila emniaiial emniaiail emniaiali emniiaila emniiaial emniialia emniialai emniiaali emniiaail
emniiiala emniiiaal emniiilaa emniiilaa emniiiala emniiiaal emniiliaa emniiliaa emniilaia emniilaai emniilaai
emniilaia emniiaila emniiaial emniialia emniialai emniiaali emniiaail emniaiila emniaiial emniailia emniailai
emniaiali emniaiail emniaiila emniaiial emniailia emniailai emniaiali emniaiail emnialiia emnialiai emnialiia
emnialiai emnialaii emnialaii emniaaili emniaaiil emniaalii emniaalii emniaaili emniaaiil emniiaila emniiaial
emniialia emniialai emniiaali emniiaail emniiiala emniiiaal emniiilaa emniiilaa emniiiala emniiiaal emniiliaa
emniiliaa emniilaia emniilaai emniilaai emniilaia emniiaila emniiaial emniialia emniialai emniiaali emniiaail
emnilaiia emnilaiai emnilaiia emnilaiai emnilaaii emnilaaii emniliaia emniliaai emniliiaa emniliiaa emniliaia
emniliaai emniliiaa emniliiaa emniliaia emniliaai emniliaai emniliaia emnilaiia emnilaiai emnilaiia emnilaiai
emnilaaii emnilaaii emniaaili emniaaiil emniaalii emniaalii emniaaili emniaaiil emniaiali emniaiail emniailai
emniailia emniaiila emniaiial emnialiai emnialiia emnialaii emnialaii emnialiai emnialiia emniaiila emniaiial
emniailia emniailai emniaiali emniaiail emnaiaiil emnaiaili emnaiaiil emnaiaili emnaialii emnaialii emnaiiail
emnaiiali emnaiiial emnaiiila emnaiilia emnaiilai emnaiiial emnaiiila emnaiiail emnaiiali emnaiilai emnaiilia
emnailiia emnailiai emnailiia emnailiai emnailaii emnailaii emnaaiiil emnaaiili emnaaiiil emnaaiili emnaailii
emnaailii emnaaiiil emnaaiili emnaaiiil emnaaiili emnaailii emnaailii emnaaiiil emnaaiili emnaaiiil emnaaiili
emnaailii emnaailii emnaaliii emnaaliii emnaaliii emnaaliii emnaaliii emnaaliii emnaiaiil emnaiaili emnaiaiil
emnaiaili emnaialii emnaialii emnaiiail emnaiiali emnaiiial emnaiiila emnaiilia emnaiilai emnaiiial emnaiiila
emnaiiail emnaiiali emnaiilai emnaiilia emnailiia emnailiai emnailiia emnailiai emnailaii emnailaii emnaiaiil
emnaiaili emnaiaiil emnaiaili emnaialii emnaialii emnaiiail emnaiiali emnaiiial emnaiiila emnaiilia emnaiilai
emnaiiial emnaiiila emnaiiail emnaiiali emnaiilai emnaiilia emnailiia emnailiai emnailiia emnailiai emnailaii
emnailaii emnalaiii emnalaiii emnalaiii emnalaiii emnalaiii emnalaiii emnaliaii emnaliaii emnaliiai emnaliiia
emnaliiia emnaliiai emnaliiai emnaliiia emnaliaii emnaliaii emnaliiai emnaliiia emnaliiia emnaliiai emnaliiia
emnaliiai emnaliaii emnaliaii emiliania emilianai emiliaina emiliaian emiliaain emiliaani emilinaia emilinaai
emiliniaa emiliniaa emilinaia emilinaai emiliinaa emiliinaa emiliiana emiliiaan emiliiaan emiliiana emiliania
emilianai emiliaina emiliaian emiliaain emiliaani emilainia emilainai emilaiina emilaiian emilaiain emilaiani
emilaniia emilaniai emilaniia emilaniai emilanaii emilanaii emilainia emilainai emilaiina emilaiian emilaiain
emilaiani emilaanii emilaanii emilaaini emilaaiin emilaaiin emilaaini emilnaiia emilnaiai emilnaiia emilnaiai
emilnaaii emilnaaii emilniaia emilniaai emilniiaa emilniiaa emilniaia emilniaai emilniiaa emilniiaa emilniaia
emilniaai emilniaai emilniaia emilnaiia emilnaiai emilnaiia emilnaiai emilnaaii emilnaaii emiliania emilianai
emiliaina emiliaian emiliaain emiliaani emilinaia emilinaai emiliniaa emiliniaa emilinaia emilinaai emiliinaa
emiliinaa emiliiana emiliiaan emiliiaan emiliiana emiliania emilianai emiliaina emiliaian emiliaain emiliaani
emilaanii emilaanii emilaaini emilaaiin emilaaiin emilaaini emilanaii emilanaii emilaniai emilaniia emilaniia
emilaniai emilainai emilainia emilaiani emilaiain emilaiian emilaiina emilainia emilainai emilaiina emilaiian
emilaiain emilaiani emiilania emiilanai emiilaina emiilaian emiilaain emiilaani emiilnaia emiilnaai emiilniaa
emiilniaa emiilnaia emiilnaai emiilinaa emiilinaa emiiliana emiiliaan emiiliaan emiiliana emiilania emiilanai
emiilaina emiilaian emiilaain emiilaani emiialnia emiialnai emiialina emiialian emiialain emiialani emiianlia
emiianlai emiianila emiianial emiianail emiianali emiiainla emiiainal emiiailna emiiailan emiiaialn emiiaianl
emiiaanil emiiaanli emiiaainl emiiaailn emiiaalin emiiaalni emiinalia emiinalai emiinaila emiinaial emiinaail
emiinaali emiinlaia emiinlaai emiinliaa emiinliaa emiinlaia emiinlaai emiinilaa emiinilaa emiiniala emiiniaal
emiiniaal emiiniala emiinalia emiinalai emiinaila emiinaial emiinaail emiinaali emiiianla emiiianal emiiialna
emiiialan emiiiaaln emiiiaanl emiiinala emiiinaal emiiinlaa emiiinlaa emiiinala emiiinaal emiiilnaa emiiilnaa
emiiilana emiiilaan emiiilaan emiiilana emiiianla emiiianal emiiialna emiiialan emiiiaaln emiiiaanl emiiaanil
emiiaanli emiiaainl emiiaailn emiiaalin emiiaalni emiianail emiianali emiianial emiianila emiianlia emiianlai
emiiainal emiiainla emiiaianl emiiaialn emiiailan emiiailna emiialnia emiialnai emiialina emiialian emiialain
emiialani emiailnia emiailnai emiailina emiailian emiailain emiailani emiainlia emiainlai emiainila emiainial
emiainail emiainali emiaiinla emiaiinal emiaiilna emiaiilan emiaiialn emiaiianl emiaianil emiaianli emiaiainl
emiaiailn emiaialin emiaialni emialinia emialinai emialiina emialiian emialiain emialiani emialniia emialniai
emialniia emialniai emialnaii emialnaii emialinia emialinai emialiina emialiian emialiain emialiani emialanii
emialanii emialaini emialaiin emialaiin emialaini emianliia emianliai emianliia emianliai emianlaii emianlaii
emianilia emianilai emianiila emianiial emianiail emianiali emianiila emianiial emianilia emianilai emianiali
emianiail emianaiil emianaili emianaiil emianaili emianalii emianalii emiailnia emiailnai emiailina emiailian
emiailain emiailani emiainlia emiainlai emiainila emiainial emiainail emiainali emiaiinla emiaiinal emiaiilna
emiaiilan emiaiialn emiaiianl emiaianil emiaianli emiaiainl emiaiailn emiaialin emiaialni emiaalnii emiaalnii
emiaalini emiaaliin emiaaliin emiaalini emiaanlii emiaanlii emiaanili emiaaniil emiaaniil emiaanili emiaainli
emiaainil emiaailni emiaailin emiaaiiln emiaaiinl emiaainil emiaainli emiaaiinl emiaaiiln emiaailin emiaailni
eminialia eminialai eminiaila eminiaial eminiaail eminiaali eminilaia eminilaai eminiliaa eminiliaa eminilaia
eminilaai eminiilaa eminiilaa eminiiala eminiiaal eminiiaal eminiiala eminialia eminialai eminiaila eminiaial
eminiaail eminiaali eminailia eminailai eminaiila eminaiial eminaiail eminaiali eminaliia eminaliai eminaliia
eminaliai eminalaii eminalaii eminailia eminailai eminaiila eminaiial eminaiail eminaiali eminaalii eminaalii
eminaaili eminaaiil eminaaiil eminaaili eminlaiia eminlaiai eminlaiia eminlaiai eminlaaii eminlaaii eminliaia
eminliaai eminliiaa eminliiaa eminliaia eminliaai eminliiaa eminliiaa eminliaia eminliaai eminliaai eminliaia
eminlaiia eminlaiai eminlaiia eminlaiai eminlaaii eminlaaii eminialia eminialai eminiaila eminiaial eminiaail
eminiaali eminilaia eminilaai eminiliaa eminiliaa eminilaia eminilaai eminiilaa eminiilaa eminiiala eminiiaal
eminiiaal eminiiala eminialia eminialai eminiaila eminiaial eminiaail eminiaali eminaalii eminaalii eminaaili
eminaaiil eminaaiil eminaaili eminalaii eminalaii eminaliai eminaliia eminaliia eminaliai eminailai eminailia
eminaiali eminaiail eminaiial eminaiila eminailia eminailai eminaiila eminaiial eminaiail eminaiali emiiianla
emiiianal emiiialna emiiialan emiiiaaln emiiiaanl emiiinala emiiinaal emiiinlaa emiiinlaa emiiinala emiiinaal
emiiilnaa emiiilnaa emiiilana emiiilaan emiiilaan emiiilana emiiianla emiiianal emiiialna emiiialan emiiiaaln
emiiiaanl emiiainla emiiainal emiiailna emiiailan emiiaialn emiiaianl emiianila emiianial emiianlia emiianlai
emiianali emiianail emiialnia emiialnai emiialina emiialian emiialain emiialani emiiaanli emiiaanil emiiaalni
emiiaalin emiiaailn emiiaainl emiinaila emiinaial emiinalia emiinalai emiinaali emiinaail emiiniala emiiniaal
emiinilaa emiinilaa emiiniala emiiniaal emiinliaa emiinliaa emiinlaia emiinlaai emiinlaai emiinlaia emiinaila
emiinaial emiinalia emiinalai emiinaali emiinaail emiilania emiilanai emiilaina emiilaian emiilaain emiilaani
emiilnaia emiilnaai emiilniaa emiilniaa emiilnaia emiilnaai emiilinaa emiilinaa emiiliana emiiliaan emiiliaan
emiiliana emiilania emiilanai emiilaina emiilaian emiilaain emiilaani emiiaanli emiiaanil emiiaalni emiiaalin
emiiaailn emiiaainl emiianali emiianail emiianlai emiianlia emiianila emiianial emiialnai emiialnia emiialani
emiialain emiialian emiialina emiiainla emiiainal emiiailna emiiailan emiiaialn emiiaianl emiaianil emiaianli
emiaiainl emiaiailn emiaialin emiaialni emiainail emiainali emiainial emiainila emiainlia emiainlai emiaiinal
emiaiinla emiaiianl emiaiialn emiaiilan emiaiilna emiailnia emiailnai emiailina emiailian emiailain emiailani
emiaainil emiaainli emiaaiinl emiaaiiln emiaailin emiaailni emiaaniil emiaanili emiaaniil emiaanili emiaanlii
emiaanlii emiaainil emiaainli emiaaiinl emiaaiiln emiaailin emiaailni emiaalnii emiaalnii emiaalini emiaaliin
emiaaliin emiaalini emianaiil emianaili emianaiil emianaili emianalii emianalii emianiail emianiali emianiial
emianiila emianilia emianilai emianiial emianiila emianiail emianiali emianilai emianilia emianliia emianliai
emianliia emianliai emianlaii emianlaii emiaianil emiaianli emiaiainl emiaiailn emiaialin emiaialni emiainail
emiainali emiainial emiainila emiainlia emiainlai emiaiinal emiaiinla emiaiianl emiaiialn emiaiilan emiaiilna
emiailnia emiailnai emiailina emiailian emiailain emiailani emialanii emialanii emialaini emialaiin emialaiin
emialaini emialnaii emialnaii emialniai emialniia emialniia emialniai emialinai emialinia emialiani emialiain
emialiian emialiina emialinia emialinai emialiina emialiian emialiain emialiani emalianii emalianii emaliaini
emaliaiin emaliaiin emaliaini emalinaii emalinaii emaliniai emaliniia emaliniia emaliniai emaliinai emaliinia
emaliiani emaliiain emaliiian emaliiina emaliinia emaliinai emaliiina emaliiian emaliiain emaliiani emalainii
emalainii emalaiini emalaiiin emalaiiin emalaiini emalaniii emalaniii emalaniii emalaniii emalaniii emalaniii
emalainii emalainii emalaiini emalaiiin emalaiiin emalaiini emalainii emalainii emalaiini emalaiiin emalaiiin
emalaiini emalnaiii emalnaiii emalnaiii emalnaiii emalnaiii emalnaiii emalniaii emalniaii emalniiai emalniiia
emalniiia emalniiai emalniiai emalniiia emalniaii emalniaii emalniiai emalniiia emalniiia emalniiai emalniiia
emalniiai emalniaii emalniaii emalianii emalianii emaliaini emaliaiin emaliaiin emaliaini emalinaii emalinaii
emaliniai emaliniia emaliniia emaliniai emaliinai emaliinia emaliiani emaliiain emaliiian emaliiina emaliinia
emaliinai emaliiina emaliiian emaliiain emaliiani emalianii emalianii emaliaini emaliaiin emaliaiin emaliaini
emalinaii emalinaii emaliniai emaliniia emaliniia emaliniai emaliinai emaliinia emaliiani emaliiain emaliiian
emaliiina emaliinia emaliinai emaliiina emaliiian emaliiain emaliiani emailanii emailanii emailaini emailaiin
emailaiin emailaini emailnaii emailnaii emailniai emailniia emailniia emailniai emailinai emailinia emailiani
emailiain emailiian emailiina emailinia emailinai emailiina emailiian emailiain emailiani emaialnii emaialnii
emaialini emaialiin emaialiin emaialini emaianlii emaianlii emaianili emaianiil emaianiil emaianili emaiainli
emaiainil emaiailni emaiailin emaiaiiln emaiaiinl emaiainil emaiainli emaiaiinl emaiaiiln emaiailin emaiailni
emainalii emainalii emainaili emainaiil emainaiil emainaili emainlaii emainlaii emainliai emainliia emainliia
emainliai emainilai emainilia emainiali emainiail emainiial emainiila emainilia emainilai emainiila emainiial
emainiail emainiali emaiianli emaiianil emaiialni emaiialin emaiiailn emaiiainl emaiinali emaiinail emaiinlai
emaiinlia emaiinila emaiinial emaiilnai emaiilnia emaiilani emaiilain emaiilian emaiilina emaiiinla emaiiinal
emaiiilna emaiiilan emaiiialn emaiiianl emaiianil emaiianli emaiiainl emaiiailn emaiialin emaiialni emaiinail
emaiinali emaiinial emaiinila emaiinlia emaiinlai emaiiinal emaiiinla emaiiianl emaiiialn emaiiilan emaiiilna
emaiilnia emaiilnai emaiilina emaiilian emaiilain emaiilani emaailnii emaailnii emaailini emaailiin emaailiin
emaailini emaainlii emaainlii emaainili emaainiil emaainiil emaainili emaaiinli emaaiinil emaaiilni emaaiilin
emaaiiiln emaaiiinl emaaiinil emaaiinli emaaiiinl emaaiiiln emaaiilin emaaiilni emaalinii emaalinii emaaliini
emaaliiin emaaliiin emaaliini emaalniii emaalniii emaalniii emaalniii emaalniii emaalniii emaalinii emaalinii
emaaliini emaaliiin emaaliiin emaaliini emaalinii emaalinii emaaliini emaaliiin emaaliiin emaaliini emaanliii
emaanliii emaanliii emaanliii emaanliii emaanliii emaanilii emaanilii emaaniili emaaniiil emaaniiil emaaniili
emaaniili emaaniiil emaanilii emaanilii emaaniili emaaniiil emaaniiil emaaniili emaaniiil emaaniili emaanilii
emaanilii emaailnii emaailnii emaailini emaailiin emaailiin emaailini emaainlii emaainlii emaainili emaainiil
emaainiil emaainili emaaiinli emaaiinil emaaiilni emaaiilin emaaiiiln emaaiiinl emaaiinil emaaiinli emaaiiinl
emaaiiiln emaaiilin emaaiilni emaailnii emaailnii emaailini emaailiin emaailiin emaailini emaainlii emaainlii
emaainili emaainiil emaainiil emaainili emaaiinli emaaiinil emaaiilni emaaiilin emaaiiiln emaaiiinl emaaiinil
emaaiinli emaaiiinl emaaiiiln emaaiilin emaaiilni emanialii emanialii emaniaili emaniaiil emaniaiil emaniaili
emanilaii emanilaii emaniliai emaniliia emaniliia emaniliai emaniilai emaniilia emaniiali emaniiail emaniiial
emaniiila emaniilia emaniilai emaniiila emaniiial emaniiail emaniiali emanailii emanailii emanaiili emanaiiil
emanaiiil emanaiili emanaliii emanaliii emanaliii emanaliii emanaliii emanaliii emanailii emanailii emanaiili
emanaiiil emanaiiil emanaiili emanailii emanailii emanaiili emanaiiil emanaiiil emanaiili emanlaiii emanlaiii
emanlaiii emanlaiii emanlaiii emanlaiii emanliaii emanliaii emanliiai emanliiia emanliiia emanliiai emanliiai
emanliiia emanliaii emanliaii emanliiai emanliiia emanliiia emanliiai emanliiia emanliiai emanliaii emanliaii
emanialii emanialii emaniaili emaniaiil emaniaiil emaniaili emanilaii emanilaii emaniliai emaniliia emaniliia
emaniliai emaniilai emaniilia emaniiali emaniiail emaniiial emaniiila emaniilia emaniilai emaniiila emaniiial
emaniiail emaniiali emanialii emanialii emaniaili emaniaiil emaniaiil emaniaili emanilaii emanilaii emaniliai
emaniliia emaniliia emaniliai emaniilai emaniilia emaniiali emaniiail emaniiial emaniiila emaniilia emaniilai
emaniiila emaniiial emaniiail emaniiali emaiianli emaiianil emaiialni emaiialin emaiiailn emaiiainl emaiinali
emaiinail emaiinlai emaiinlia emaiinila emaiinial emaiilnai emaiilnia emaiilani emaiilain emaiilian emaiilina
emaiiinla emaiiinal emaiiilna emaiiilan emaiiialn emaiiianl emaiainli emaiainil emaiailni emaiailin emaiaiiln
emaiaiinl emaianili emaianiil emaianlii emaianlii emaianili emaianiil emaialnii emaialnii emaialini emaialiin
emaialiin emaialini emaiainli emaiainil emaiailni emaiailin emaiaiiln emaiaiinl emainaili emainaiil emainalii
emainalii emainaili emainaiil emainiali emainiail emainilai emainilia emainiila emainiial emainliai emainliia
emainlaii emainlaii emainliai emainliia emainiila emainiial emainilia emainilai emainiali emainiail emailanii
emailanii emailaini emailaiin emailaiin emailaini emailnaii emailnaii emailniai emailniia emailniia emailniai
emailinai emailinia emailiani emailiain emailiian emailiina emailinia emailinai emailiina emailiian emailiain
emailiani emaiianli emaiianil emaiialni emaiialin emaiiailn emaiiainl emaiinali emaiinail emaiinlai emaiinlia
emaiinila emaiinial emaiilnai emaiilnia emaiilani emaiilain emaiilian emaiilina emaiiinla emaiiinal emaiiilna
emaiiilan emaiiialn emaiiianl emaiianil emaiianli emaiiainl emaiiailn emaiialin emaiialni emaiinail emaiinali
emaiinial emaiinila emaiinlia emaiinlai emaiiinal emaiiinla emaiiianl emaiiialn emaiiilan emaiiilna emaiilnia
emaiilnai emaiilina emaiilian emaiilain emaiilani emaiainil emaiainli emaiaiinl emaiaiiln emaiailin emaiailni
emaianiil emaianili emaianiil emaianili emaianlii emaianlii emaiainil emaiainli emaiaiinl emaiaiiln emaiailin
emaiailni emaialnii emaialnii emaialini emaialiin emaialiin emaialini emainaiil emainaili emainaiil emainaili
emainalii emainalii emainiail emainiali emainiial emainiila emainilia emainilai emainiial emainiila emainiail
emainiali emainilai emainilia emainliia emainliai emainliia emainliai emainlaii emainlaii emaiianil emaiianli
emaiiainl emaiiailn emaiialin emaiialni emaiinail emaiinali emaiinial emaiinila emaiinlia emaiinlai emaiiinal
emaiiinla emaiiianl emaiiialn emaiiilan emaiiilna emaiilnia emaiilnai emaiilina emaiilian emaiilain emaiilani
emailanii emailanii emailaini emailaiin emailaiin emailaini emailnaii emailnaii emailniai emailniia emailniia
emailniai emailinai emailinia emailiani emailiain emailiian emailiina emailinia emailinai emailiina emailiian
emailiain emailiani

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us