easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

armourer

conspectuum

dedico

absume

capillation

catellatospora

harinder

inoxidize

jaimie

homopathy

generalidad

erythromyxa

miris

huntsvillekfp

incapacitate

lucumia

faradising

marcial


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: eludentemque
cipher variations:
fmvefoufnrvf gnwfgpvgoswg hoxghqwhptxh ipyhirxiquyi jqzijsyjrvzj
krajktzkswak lsbklualtxbl mtclmvbmuycm nudmnwcnvzdn ovenoxdowaeo
pwfopyepxbfp qxgpqzfqycgq ryhqragrzdhr szirsbhsaeis tajstcitbfjt
ubktudjucgku vcluvekvdhlv wdmvwflweimw xenwxgmxfjnx yfoxyhnygkoy
zgpyziozhlpz ahqzajpaimqa birabkqbjnrb cjsbclrckosc dktcdmsdlptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: eludentemque
Cipher: vofwvmgvnjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: eludentemque
Cipher: AABAA ABABA BAABB AAABB AABAA ABBAA BAABA AABAA ABABB ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: eludentemque
cipher variations:
fmvefoufnrvfnijknognlxjnvexqvosvjdxvdalwdoedhjldlwzcloqlfpzltsnitoctdvntjkpujoajzhpjrgdaromrxndr
zcrgzoyzvtrzhyfmhokhtzfhputspowprftpxqhyxoixplhxgnwfgpvgoswgojklophomykowfyrwptwkeywebmxepfeikme
mxadmprmgqamutojupduewouklqvkpbkaiqkshebspnsyoesadshapzawusaizgnipliuagiqvutqpxqsguqyrizypjyqmiy
hoxghqwhptxhpklmpqipnzlpxgzsxquxlfzxfcnyfqgfjlnfnybenqsnhrbnvupkvqevfxpvlmrwlqclbjrltifctqotzpft
betibqabxvtbjahojqmjvbhjrwvurqyrthvrzsjazqkzrnjzipyhirxiquyiqlmnqrjqoamqyhatyrvymgaygdozgrhgkmog
ozcfortoiscowvqlwrfwgyqwmnsxmrdmcksmujgdurpuaqgucfujcrbcywuckbipkrnkwciksxwvsrzsuiwsatkbarlasoka
jqzijsyjrvzjrmnorskrpbnrzibuzswznhbzhepahsihlnphpadgpsupjtdpxwrmxsgxhzrxnotynsendltnvkhevsqvbrhv
dgvkdscdzxvdlcjqlsolxdjltyxwtsatvjxtbulcbsmbtplbkrajktzkswaksnopstlsqcosajcvatxaoicaifqbitjimoqi
qbehqtvqkueqyxsnythyiasyopuzotfoemuowlifwtrwcsiwehwletdeaywemdkrmtpmyekmuzyxutbuwkyucvmdctncuqmc
lsbklualtxbltopqtumtrdptbkdwbuybpjdbjgrcjukjnprjrcfiruwrlvfrzytozuizjbtzpqvapugpfnvpxmjgxusxdtjx
fixmfuefbzxfnelsnuqnzflnvazyvucvxlzvdwneduodvrndmtclmvbmuycmupqruvnusequclexcvzcqkeckhsdkvlkoqsk
sdgjsvxsmwgsazupavjakcuaqrwbqvhqgowqynkhyvtyeukygjyngvfgcaygofmtovroagmowbazwvdwymawexofevpewsoe
nudmnwcnvzdnvqrsvwovtfrvdmfydwadrlfdlitelwmlprtltehktwytnxhtbavqbwkbldvbrsxcrwirhpxrzolizwuzfvlz
hkzohwghdbzhpgnupwspbhnpxcbaxwexznbxfypgfwqfxtpfovenoxdowaeowrstwxpwugswengzexbesmgemjufmxnmqsum
ufiluxzuoyiucbwrcxlcmewcstydsxjsiqysapmjaxvagwmailapixhiecaiqhovqxtqcioqydcbyxfyaocygzqhgxrgyuqg
pwfopyepxbfpxstuxyqxvhtxfohafycftnhfnkvgnyonrtvnvgjmvyavpzjvdcxsdymdnfxdtuzetyktjrztbqnkbywbhxnb
jmbqjyijfdbjripwryurdjprzedczygzbpdzharihyshzvrhqxgpqzfqycgqytuvyzrywiuygpibgzdguoigolwhozposuwo
whknwzbwqakwedytezneogyeuvafuzluksaucrolczxciyockncrkzjkgecksjqxszvsekqsafedazhacqeaibsjiztiawsi
ryhqragrzdhrzuvwzaszxjvzhqjchaehvpjhpmxipaqptvxpxiloxacxrblxfezufaofphzfvwbgvamvltbvdspmdaydjzpd
lodslaklhfdltkrytawtflrtbgfebaibdrfbjctkjaujbxtjszirsbhsaeisavwxabtaykwairkdibfiwqkiqnyjqbrquwyq
yjmpybdyscmygfavgbpgqiagwxchwbnwmucwetqnebzekaqempetmblmigemulszubxugmsuchgfcbjcesgckdulkbvkcyuk
tajstcitbfjtbwxybcubzlxbjslejcgjxrljrozkrcsrvxzrzknqzceztdnzhgbwhcqhrjbhxydixcoxnvdxfurofcaflbrf
nqfuncmnjhfnvmtavcyvhntvdihgdckdfthdlevmlcwldzvlubktudjucgkucxyzcdvcamycktmfkdhkysmkspalsdtswyas
aloradfaueoaihcxidriskciyzejydpyoweygvspgdbgmcsgorgvodnokigownubwdzwiouwejihedleguiemfwnmdxmeawm
vcluvekvdhlvdyzadewdbnzdlungleilztnltqbmteutxzbtbmpsbegbvfpbjidyjesjtldjzafkzeqzpxfzhwtqhechndth
pshwpeopljhpxovcxeaxjpvxfkjifemfhvjfngxoneynfbxnwdmvwflweimwezabefxecoaemvohmfjmauomurcnufvuyacu
cnqtcfhcwgqckjezkftkumekabglafraqygaixurifdioeuiqtixqfpqmkiqypwdyfbykqwyglkjgfngiwkgohypofzogcyo
xenwxgmxfjnxfabcfgyfdpbfnwpingknbvpnvsdovgwvzbdvdorudgidxhrdlkfalgulvnflbchmbgsbrzhbjyvsjgejpfvj
rujyrgqrnljrzqxezgczlrxzhmlkhgohjxlhpizqpgaphdzpyfoxyhnygkoygbcdghzgeqcgoxqjohlocwqowtepwhxwacew
epsvehjeyisemlgbmhvmwogmcdinchtcsaickzwtkhfkqgwksvkzshrsomksaryfahdamsyainmlihpikymiqjarqhbqieaq
zgpyziozhlpzhcdehiahfrdhpyrkpimpdxrpxufqxiyxbdfxfqtwfikfzjtfnmhcniwnxphndejodiudtbjdlaxuliglrhxl
twlatistpnltbszgbiebntzbjonmjiqjlznjrkbsricrjfbrahqzajpaimqaidefijbigseiqzslqjnqeysqyvgryjzycegy
gruxgjlgakugonidojxoyqioefkpejveuckembyvmjhmsiymuxmbujtuqomuctahcjfcouackponkjrkmaokslctsjdskgcs
birabkqbjnrbjefgjkcjhtfjratmrkorfztrzwhszkazdfhzhsvyhkmhblvhpojepkypzrjpfglqfkwfvdlfnczwnkintjzn
vyncvkuvrpnvdubidkgdpvbdlqpolkslnbpltmdutketlhdtcjsbclrckosckfghkldkiugksbunslpsgausaxitalbaegia
itwzilnicmwiqpkfqlzqaskqghmrglxgwemgodaxoljoukaowzodwlvwsqowevcjelheqwcemrqpmltmocqmunevulfumieu
dktcdmsdlptdlghilmeljvhltcvotmqthbvtbyjubmcbfhjbjuxajmojdnxjrqlgrmarbtlrhinshmyhxfnhpebypmkpvlbp
xapexmwxtrpxfwdkfmifrxdfnsrqnmunpdrnvofwvmgvnjfveludentemquemhijmnfmkwimudwpunruicwuczkvcndcgikc
kvybknpkeoyksrmhsnbscumsijotinziygoiqfczqnlqwmcqybqfynxyusqygxelgnjgsyegotsronvoqesowpgxwnhwokgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: eludentemque
Cipher: ryhqragrzdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: eludentemque
Cipher: 511354415133445123145451

Extended Methods:
Method #1

Plaintext: eludentemque
method variations:
kqziksykrvzkpveopxdpwaepuaktuciubfkuzfpyzhozglpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
e l u d e n t e m q u e 
5 1 5 4 5 3 4 5 2 1 5 5 
1 3 4 1 1 3 4 1 3 4 4 1 
They are then read out in rows:
515453452155134113413441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: eludentemque
Cipher: eupybzldldsd

Read more ...
Method #3

Plaintext: eludentemque
method variations:
axtvlsyfcyyv xtvlsyfcyyva tvlsyfcyyvax
vlsyfcyyvaxt lsyfcyyvaxtv syfcyyvaxtvl
yfcyyvaxtvls fcyyvaxtvlsy cyyvaxtvlsyf
yyvaxtvlsyfc yvaxtvlsyfcy vaxtvlsyfcyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: eludentemque

first 5040 cipher variations(475687488 total)
eludentemque eludentemqeu eludentemuqe eludentemueq eludentemeuq eludentemequ eludenteqmue eludenteqmeu eludentequme
eludentequem eludenteqeum eludenteqemu eludenteuqme eludenteuqem eludenteumqe eludenteumeq eludenteuemq eludenteueqm
eludenteequm eludenteeqmu eludenteeuqm eludenteeumq eludenteemuq eludenteemqu eludentmeque eludentmeqeu eludentmeuqe
eludentmeueq eludentmeeuq eludentmeequ eludentmqeue eludentmqeeu eludentmquee eludentmquee eludentmqeue eludentmqeeu
eludentmuqee eludentmuqee eludentmueqe eludentmueeq eludentmueeq eludentmueqe eludentmeque eludentmeqeu eludentmeuqe
eludentmeueq eludentmeeuq eludentmeequ eludentqmeue eludentqmeeu eludentqmuee eludentqmuee eludentqmeue eludentqmeeu
eludentqemue eludentqemeu eludentqeume eludentqeuem eludentqeeum eludentqeemu eludentqueme eludentqueem eludentqumee
eludentqumee eludentqueme eludentqueem eludentqeeum eludentqeemu eludentqeuem eludentqeume eludentqemue eludentqemeu
eludentumqee eludentumqee eludentumeqe eludentumeeq eludentumeeq eludentumeqe eludentuqmee eludentuqmee eludentuqeme
eludentuqeem eludentuqeem eludentuqeme eludentueqme eludentueqem eludentuemqe eludentuemeq eludentueemq eludentueeqm
eludentueqem eludentueqme eludentueeqm eludentueemq eludentuemeq eludentuemqe eludentemque eludentemqeu eludentemuqe
eludentemueq eludentemeuq eludentemequ eludenteqmue eludenteqmeu eludentequme eludentequem eludenteqeum eludenteqemu
eludenteuqme eludenteuqem eludenteumqe eludenteumeq eludenteuemq eludenteueqm eludenteequm eludenteeqmu eludenteeuqm
eludenteeumq eludenteemuq eludenteemqu eludenetmque eludenetmqeu eludenetmuqe eludenetmueq eludenetmeuq eludenetmequ
eludenetqmue eludenetqmeu eludenetqume eludenetquem eludenetqeum eludenetqemu eludenetuqme eludenetuqem eludenetumqe
eludenetumeq eludenetuemq eludenetueqm eludenetequm eludeneteqmu eludeneteuqm eludeneteumq eludenetemuq eludenetemqu
eludenemtque eludenemtqeu eludenemtuqe eludenemtueq eludenemteuq eludenemtequ eludenemqtue eludenemqteu eludenemqute
eludenemquet eludenemqeut eludenemqetu eludenemuqte eludenemuqet eludenemutqe eludenemuteq eludenemuetq eludenemueqt
eludenemequt eludenemeqtu eludenemeuqt eludenemeutq eludenemetuq eludenemetqu eludeneqmtue eludeneqmteu eludeneqmute
eludeneqmuet eludeneqmeut eludeneqmetu eludeneqtmue eludeneqtmeu eludeneqtume eludeneqtuem eludeneqteum eludeneqtemu
eludenequtme eludenequtem eludenequmte eludenequmet eludenequemt eludenequetm eludeneqetum eludeneqetmu eludeneqeutm
eludeneqeumt eludeneqemut eludeneqemtu eludeneumqte eludeneumqet eludeneumtqe eludeneumteq eludeneumetq eludeneumeqt
eludeneuqmte eludeneuqmet eludeneuqtme eludeneuqtem eludeneuqetm eludeneuqemt eludeneutqme eludeneutqem eludeneutmqe
eludeneutmeq eludeneutemq eludeneuteqm eludeneueqtm eludeneueqmt eludeneuetqm eludeneuetmq eludeneuemtq eludeneuemqt
eludeneemqut eludeneemqtu eludeneemuqt eludeneemutq eludeneemtuq eludeneemtqu eludeneeqmut eludeneeqmtu eludeneequmt
eludeneequtm eludeneeqtum eludeneeqtmu eludeneeuqmt eludeneeuqtm eludeneeumqt eludeneeumtq eludeneeutmq eludeneeutqm
eludeneetqum eludeneetqmu eludeneetuqm eludeneetumq eludeneetmuq eludeneetmqu eludenmetque eludenmetqeu eludenmetuqe
eludenmetueq eludenmeteuq eludenmetequ eludenmeqtue eludenmeqteu eludenmequte eludenmequet eludenmeqeut eludenmeqetu
eludenmeuqte eludenmeuqet eludenmeutqe eludenmeuteq eludenmeuetq eludenmeueqt eludenmeequt eludenmeeqtu eludenmeeuqt
eludenmeeutq eludenmeetuq eludenmeetqu eludenmteque eludenmteqeu eludenmteuqe eludenmteueq eludenmteeuq eludenmteequ
eludenmtqeue eludenmtqeeu eludenmtquee eludenmtquee eludenmtqeue eludenmtqeeu eludenmtuqee eludenmtuqee eludenmtueqe
eludenmtueeq eludenmtueeq eludenmtueqe eludenmteque eludenmteqeu eludenmteuqe eludenmteueq eludenmteeuq eludenmteequ
eludenmqteue eludenmqteeu eludenmqtuee eludenmqtuee eludenmqteue eludenmqteeu eludenmqetue eludenmqeteu eludenmqeute
eludenmqeuet eludenmqeeut eludenmqeetu eludenmquete eludenmqueet eludenmqutee eludenmqutee eludenmquete eludenmqueet
eludenmqeeut eludenmqeetu eludenmqeuet eludenmqeute eludenmqetue eludenmqeteu eludenmutqee eludenmutqee eludenmuteqe
eludenmuteeq eludenmuteeq eludenmuteqe eludenmuqtee eludenmuqtee eludenmuqete eludenmuqeet eludenmuqeet eludenmuqete
eludenmueqte eludenmueqet eludenmuetqe eludenmueteq eludenmueetq eludenmueeqt eludenmueqet eludenmueqte eludenmueeqt
eludenmueetq eludenmueteq eludenmuetqe eludenmetque eludenmetqeu eludenmetuqe eludenmetueq eludenmeteuq eludenmetequ
eludenmeqtue eludenmeqteu eludenmequte eludenmequet eludenmeqeut eludenmeqetu eludenmeuqte eludenmeuqet eludenmeutqe
eludenmeuteq eludenmeuetq eludenmeueqt eludenmeequt eludenmeeqtu eludenmeeuqt eludenmeeutq eludenmeetuq eludenmeetqu
eludenqemtue eludenqemteu eludenqemute eludenqemuet eludenqemeut eludenqemetu eludenqetmue eludenqetmeu eludenqetume
eludenqetuem eludenqeteum eludenqetemu eludenqeutme eludenqeutem eludenqeumte eludenqeumet eludenqeuemt eludenqeuetm
eludenqeetum eludenqeetmu eludenqeeutm eludenqeeumt eludenqeemut eludenqeemtu eludenqmetue eludenqmeteu eludenqmeute
eludenqmeuet eludenqmeeut eludenqmeetu eludenqmteue eludenqmteeu eludenqmtuee eludenqmtuee eludenqmteue eludenqmteeu
eludenqmutee eludenqmutee eludenqmuete eludenqmueet eludenqmueet eludenqmuete eludenqmetue eludenqmeteu eludenqmeute
eludenqmeuet eludenqmeeut eludenqmeetu eludenqtmeue eludenqtmeeu eludenqtmuee eludenqtmuee eludenqtmeue eludenqtmeeu
eludenqtemue eludenqtemeu eludenqteume eludenqteuem eludenqteeum eludenqteemu eludenqtueme eludenqtueem eludenqtumee
eludenqtumee eludenqtueme eludenqtueem eludenqteeum eludenqteemu eludenqteuem eludenqteume eludenqtemue eludenqtemeu
eludenqumtee eludenqumtee eludenqumete eludenqumeet eludenqumeet eludenqumete eludenqutmee eludenqutmee eludenquteme
eludenquteem eludenquteem eludenquteme eludenquetme eludenquetem eludenquemte eludenquemet eludenqueemt eludenqueetm
eludenquetem eludenquetme eludenqueetm eludenqueemt eludenquemet eludenquemte eludenqemtue eludenqemteu eludenqemute
eludenqemuet eludenqemeut eludenqemetu eludenqetmue eludenqetmeu eludenqetume eludenqetuem eludenqeteum eludenqetemu
eludenqeutme eludenqeutem eludenqeumte eludenqeumet eludenqeuemt eludenqeuetm eludenqeetum eludenqeetmu eludenqeeutm
eludenqeeumt eludenqeemut eludenqeemtu eludenuemqte eludenuemqet eludenuemtqe eludenuemteq eludenuemetq eludenuemeqt
eludenueqmte eludenueqmet eludenueqtme eludenueqtem eludenueqetm eludenueqemt eludenuetqme eludenuetqem eludenuetmqe
eludenuetmeq eludenuetemq eludenueteqm eludenueeqtm eludenueeqmt eludenueetqm eludenueetmq eludenueemtq eludenueemqt
eludenumeqte eludenumeqet eludenumetqe eludenumeteq eludenumeetq eludenumeeqt eludenumqete eludenumqeet eludenumqtee
eludenumqtee eludenumqete eludenumqeet eludenumtqee eludenumtqee eludenumteqe eludenumteeq eludenumteeq eludenumteqe
eludenumeqte eludenumeqet eludenumetqe eludenumeteq eludenumeetq eludenumeeqt eludenuqmete eludenuqmeet eludenuqmtee
eludenuqmtee eludenuqmete eludenuqmeet eludenuqemte eludenuqemet eludenuqetme eludenuqetem eludenuqeetm eludenuqeemt
eludenuqteme eludenuqteem eludenuqtmee eludenuqtmee eludenuqteme eludenuqteem eludenuqeetm eludenuqeemt eludenuqetem
eludenuqetme eludenuqemte eludenuqemet eludenutmqee eludenutmqee eludenutmeqe eludenutmeeq eludenutmeeq eludenutmeqe
eludenutqmee eludenutqmee eludenutqeme eludenutqeem eludenutqeem eludenutqeme eludenuteqme eludenuteqem eludenutemqe
eludenutemeq eludenuteemq eludenuteeqm eludenuteqem eludenuteqme eludenuteeqm eludenuteemq eludenutemeq eludenutemqe
eludenuemqte eludenuemqet eludenuemtqe eludenuemteq eludenuemetq eludenuemeqt eludenueqmte eludenueqmet eludenueqtme
eludenueqtem eludenueqetm eludenueqemt eludenuetqme eludenuetqem eludenuetmqe eludenuetmeq eludenuetemq eludenueteqm
eludenueeqtm eludenueeqmt eludenueetqm eludenueetmq eludenueemtq eludenueemqt eludeneemqut eludeneemqtu eludeneemuqt
eludeneemutq eludeneemtuq eludeneemtqu eludeneeqmut eludeneeqmtu eludeneequmt eludeneequtm eludeneeqtum eludeneeqtmu
eludeneeuqmt eludeneeuqtm eludeneeumqt eludeneeumtq eludeneeutmq eludeneeutqm eludeneetqum eludeneetqmu eludeneetuqm
eludeneetumq eludeneetmuq eludeneetmqu eludenemequt eludenemeqtu eludenemeuqt eludenemeutq eludenemetuq eludenemetqu
eludenemqeut eludenemqetu eludenemquet eludenemqute eludenemqtue eludenemqteu eludenemuqet eludenemuqte eludenemueqt
eludenemuetq eludenemuteq eludenemutqe eludenemtque eludenemtqeu eludenemtuqe eludenemtueq eludenemteuq eludenemtequ
eludeneqmeut eludeneqmetu eludeneqmuet eludeneqmute eludeneqmtue eludeneqmteu eludeneqemut eludeneqemtu eludeneqeumt
eludeneqeutm eludeneqetum eludeneqetmu eludenequemt eludenequetm eludenequmet eludenequmte eludenequtme eludenequtem
eludeneqteum eludeneqtemu eludeneqtuem eludeneqtume eludeneqtmue eludeneqtmeu eludeneumqet eludeneumqte eludeneumeqt
eludeneumetq eludeneumteq eludeneumtqe eludeneuqmet eludeneuqmte eludeneuqemt eludeneuqetm eludeneuqtem eludeneuqtme
eludeneueqmt eludeneueqtm eludeneuemqt eludeneuemtq eludeneuetmq eludeneuetqm eludeneutqem eludeneutqme eludeneuteqm
eludeneutemq eludeneutmeq eludeneutmqe eludenetmque eludenetmqeu eludenetmuqe eludenetmueq eludenetmeuq eludenetmequ
eludenetqmue eludenetqmeu eludenetqume eludenetquem eludenetqeum eludenetqemu eludenetuqme eludenetuqem eludenetumqe
eludenetumeq eludenetuemq eludenetueqm eludenetequm eludeneteqmu eludeneteuqm eludeneteumq eludenetemuq eludenetemqu
eludetnemque eludetnemqeu eludetnemuqe eludetnemueq eludetnemeuq eludetnemequ eludetneqmue eludetneqmeu eludetnequme
eludetnequem eludetneqeum eludetneqemu eludetneuqme eludetneuqem eludetneumqe eludetneumeq eludetneuemq eludetneueqm
eludetneequm eludetneeqmu eludetneeuqm eludetneeumq eludetneemuq eludetneemqu eludetnmeque eludetnmeqeu eludetnmeuqe
eludetnmeueq eludetnmeeuq eludetnmeequ eludetnmqeue eludetnmqeeu eludetnmquee eludetnmquee eludetnmqeue eludetnmqeeu
eludetnmuqee eludetnmuqee eludetnmueqe eludetnmueeq eludetnmueeq eludetnmueqe eludetnmeque eludetnmeqeu eludetnmeuqe
eludetnmeueq eludetnmeeuq eludetnmeequ eludetnqmeue eludetnqmeeu eludetnqmuee eludetnqmuee eludetnqmeue eludetnqmeeu
eludetnqemue eludetnqemeu eludetnqeume eludetnqeuem eludetnqeeum eludetnqeemu eludetnqueme eludetnqueem eludetnqumee
eludetnqumee eludetnqueme eludetnqueem eludetnqeeum eludetnqeemu eludetnqeuem eludetnqeume eludetnqemue eludetnqemeu
eludetnumqee eludetnumqee eludetnumeqe eludetnumeeq eludetnumeeq eludetnumeqe eludetnuqmee eludetnuqmee eludetnuqeme
eludetnuqeem eludetnuqeem eludetnuqeme eludetnueqme eludetnueqem eludetnuemqe eludetnuemeq eludetnueemq eludetnueeqm
eludetnueqem eludetnueqme eludetnueeqm eludetnueemq eludetnuemeq eludetnuemqe eludetnemque eludetnemqeu eludetnemuqe
eludetnemueq eludetnemeuq eludetnemequ eludetneqmue eludetneqmeu eludetnequme eludetnequem eludetneqeum eludetneqemu
eludetneuqme eludetneuqem eludetneumqe eludetneumeq eludetneuemq eludetneueqm eludetneequm eludetneeqmu eludetneeuqm
eludetneeumq eludetneemuq eludetneemqu eludetenmque eludetenmqeu eludetenmuqe eludetenmueq eludetenmeuq eludetenmequ
eludetenqmue eludetenqmeu eludetenqume eludetenquem eludetenqeum eludetenqemu eludetenuqme eludetenuqem eludetenumqe
eludetenumeq eludetenuemq eludetenueqm eludetenequm eludeteneqmu eludeteneuqm eludeteneumq eludetenemuq eludetenemqu
eludetemnque eludetemnqeu eludetemnuqe eludetemnueq eludetemneuq eludetemnequ eludetemqnue eludetemqneu eludetemqune
eludetemquen eludetemqeun eludetemqenu eludetemuqne eludetemuqen eludetemunqe eludetemuneq eludetemuenq eludetemueqn
eludetemequn eludetemeqnu eludetemeuqn eludetemeunq eludetemenuq eludetemenqu eludeteqmnue eludeteqmneu eludeteqmune
eludeteqmuen eludeteqmeun eludeteqmenu eludeteqnmue eludeteqnmeu eludeteqnume eludeteqnuem eludeteqneum eludeteqnemu
eludetequnme eludetequnem eludetequmne eludetequmen eludetequemn eludetequenm eludeteqenum eludeteqenmu eludeteqeunm
eludeteqeumn eludeteqemun eludeteqemnu eludeteumqne eludeteumqen eludeteumnqe eludeteumneq eludeteumenq eludeteumeqn
eludeteuqmne eludeteuqmen eludeteuqnme eludeteuqnem eludeteuqenm eludeteuqemn eludeteunqme eludeteunqem eludeteunmqe
eludeteunmeq eludeteunemq eludeteuneqm eludeteueqnm eludeteueqmn eludeteuenqm eludeteuenmq eludeteuemnq eludeteuemqn
eludeteemqun eludeteemqnu eludeteemuqn eludeteemunq eludeteemnuq eludeteemnqu eludeteeqmun eludeteeqmnu eludeteequmn
eludeteequnm eludeteeqnum eludeteeqnmu eludeteeuqmn eludeteeuqnm eludeteeumqn eludeteeumnq eludeteeunmq eludeteeunqm
eludeteenqum eludeteenqmu eludeteenuqm eludeteenumq eludeteenmuq eludeteenmqu eludetmenque eludetmenqeu eludetmenuqe
eludetmenueq eludetmeneuq eludetmenequ eludetmeqnue eludetmeqneu eludetmequne eludetmequen eludetmeqeun eludetmeqenu
eludetmeuqne eludetmeuqen eludetmeunqe eludetmeuneq eludetmeuenq eludetmeueqn eludetmeequn eludetmeeqnu eludetmeeuqn
eludetmeeunq eludetmeenuq eludetmeenqu eludetmneque eludetmneqeu eludetmneuqe eludetmneueq eludetmneeuq eludetmneequ
eludetmnqeue eludetmnqeeu eludetmnquee eludetmnquee eludetmnqeue eludetmnqeeu eludetmnuqee eludetmnuqee eludetmnueqe
eludetmnueeq eludetmnueeq eludetmnueqe eludetmneque eludetmneqeu eludetmneuqe eludetmneueq eludetmneeuq eludetmneequ
eludetmqneue eludetmqneeu eludetmqnuee eludetmqnuee eludetmqneue eludetmqneeu eludetmqenue eludetmqeneu eludetmqeune
eludetmqeuen eludetmqeeun eludetmqeenu eludetmquene eludetmqueen eludetmqunee eludetmqunee eludetmquene eludetmqueen
eludetmqeeun eludetmqeenu eludetmqeuen eludetmqeune eludetmqenue eludetmqeneu eludetmunqee eludetmunqee eludetmuneqe
eludetmuneeq eludetmuneeq eludetmuneqe eludetmuqnee eludetmuqnee eludetmuqene eludetmuqeen eludetmuqeen eludetmuqene
eludetmueqne eludetmueqen eludetmuenqe eludetmueneq eludetmueenq eludetmueeqn eludetmueqen eludetmueqne eludetmueeqn
eludetmueenq eludetmueneq eludetmuenqe eludetmenque eludetmenqeu eludetmenuqe eludetmenueq eludetmeneuq eludetmenequ
eludetmeqnue eludetmeqneu eludetmequne eludetmequen eludetmeqeun eludetmeqenu eludetmeuqne eludetmeuqen eludetmeunqe
eludetmeuneq eludetmeuenq eludetmeueqn eludetmeequn eludetmeeqnu eludetmeeuqn eludetmeeunq eludetmeenuq eludetmeenqu
eludetqemnue eludetqemneu eludetqemune eludetqemuen eludetqemeun eludetqemenu eludetqenmue eludetqenmeu eludetqenume
eludetqenuem eludetqeneum eludetqenemu eludetqeunme eludetqeunem eludetqeumne eludetqeumen eludetqeuemn eludetqeuenm
eludetqeenum eludetqeenmu eludetqeeunm eludetqeeumn eludetqeemun eludetqeemnu eludetqmenue eludetqmeneu eludetqmeune
eludetqmeuen eludetqmeeun eludetqmeenu eludetqmneue eludetqmneeu eludetqmnuee eludetqmnuee eludetqmneue eludetqmneeu
eludetqmunee eludetqmunee eludetqmuene eludetqmueen eludetqmueen eludetqmuene eludetqmenue eludetqmeneu eludetqmeune
eludetqmeuen eludetqmeeun eludetqmeenu eludetqnmeue eludetqnmeeu eludetqnmuee eludetqnmuee eludetqnmeue eludetqnmeeu
eludetqnemue eludetqnemeu eludetqneume eludetqneuem eludetqneeum eludetqneemu eludetqnueme eludetqnueem eludetqnumee
eludetqnumee eludetqnueme eludetqnueem eludetqneeum eludetqneemu eludetqneuem eludetqneume eludetqnemue eludetqnemeu
eludetqumnee eludetqumnee eludetqumene eludetqumeen eludetqumeen eludetqumene eludetqunmee eludetqunmee eludetquneme
eludetquneem eludetquneem eludetquneme eludetquenme eludetquenem eludetquemne eludetquemen eludetqueemn eludetqueenm
eludetquenem eludetquenme eludetqueenm eludetqueemn eludetquemen eludetquemne eludetqemnue eludetqemneu eludetqemune
eludetqemuen eludetqemeun eludetqemenu eludetqenmue eludetqenmeu eludetqenume eludetqenuem eludetqeneum eludetqenemu
eludetqeunme eludetqeunem eludetqeumne eludetqeumen eludetqeuemn eludetqeuenm eludetqeenum eludetqeenmu eludetqeeunm
eludetqeeumn eludetqeemun eludetqeemnu eludetuemqne eludetuemqen eludetuemnqe eludetuemneq eludetuemenq eludetuemeqn
eludetueqmne eludetueqmen eludetueqnme eludetueqnem eludetueqenm eludetueqemn eludetuenqme eludetuenqem eludetuenmqe
eludetuenmeq eludetuenemq eludetueneqm eludetueeqnm eludetueeqmn eludetueenqm eludetueenmq eludetueemnq eludetueemqn
eludetumeqne eludetumeqen eludetumenqe eludetumeneq eludetumeenq eludetumeeqn eludetumqene eludetumqeen eludetumqnee
eludetumqnee eludetumqene eludetumqeen eludetumnqee eludetumnqee eludetumneqe eludetumneeq eludetumneeq eludetumneqe
eludetumeqne eludetumeqen eludetumenqe eludetumeneq eludetumeenq eludetumeeqn eludetuqmene eludetuqmeen eludetuqmnee
eludetuqmnee eludetuqmene eludetuqmeen eludetuqemne eludetuqemen eludetuqenme eludetuqenem eludetuqeenm eludetuqeemn
eludetuqneme eludetuqneem eludetuqnmee eludetuqnmee eludetuqneme eludetuqneem eludetuqeenm eludetuqeemn eludetuqenem
eludetuqenme eludetuqemne eludetuqemen eludetunmqee eludetunmqee eludetunmeqe eludetunmeeq eludetunmeeq eludetunmeqe
eludetunqmee eludetunqmee eludetunqeme eludetunqeem eludetunqeem eludetunqeme eludetuneqme eludetuneqem eludetunemqe
eludetunemeq eludetuneemq eludetuneeqm eludetuneqem eludetuneqme eludetuneeqm eludetuneemq eludetunemeq eludetunemqe
eludetuemqne eludetuemqen eludetuemnqe eludetuemneq eludetuemenq eludetuemeqn eludetueqmne eludetueqmen eludetueqnme
eludetueqnem eludetueqenm eludetueqemn eludetuenqme eludetuenqem eludetuenmqe eludetuenmeq eludetuenemq eludetueneqm
eludetueeqnm eludetueeqmn eludetueenqm eludetueenmq eludetueemnq eludetueemqn eludeteemqun eludeteemqnu eludeteemuqn
eludeteemunq eludeteemnuq eludeteemnqu eludeteeqmun eludeteeqmnu eludeteequmn eludeteequnm eludeteeqnum eludeteeqnmu
eludeteeuqmn eludeteeuqnm eludeteeumqn eludeteeumnq eludeteeunmq eludeteeunqm eludeteenqum eludeteenqmu eludeteenuqm
eludeteenumq eludeteenmuq eludeteenmqu eludetemequn eludetemeqnu eludetemeuqn eludetemeunq eludetemenuq eludetemenqu
eludetemqeun eludetemqenu eludetemquen eludetemqune eludetemqnue eludetemqneu eludetemuqen eludetemuqne eludetemueqn
eludetemuenq eludetemuneq eludetemunqe eludetemnque eludetemnqeu eludetemnuqe eludetemnueq eludetemneuq eludetemnequ
eludeteqmeun eludeteqmenu eludeteqmuen eludeteqmune eludeteqmnue eludeteqmneu eludeteqemun eludeteqemnu eludeteqeumn
eludeteqeunm eludeteqenum eludeteqenmu eludetequemn eludetequenm eludetequmen eludetequmne eludetequnme eludetequnem
eludeteqneum eludeteqnemu eludeteqnuem eludeteqnume eludeteqnmue eludeteqnmeu eludeteumqen eludeteumqne eludeteumeqn
eludeteumenq eludeteumneq eludeteumnqe eludeteuqmen eludeteuqmne eludeteuqemn eludeteuqenm eludeteuqnem eludeteuqnme
eludeteueqmn eludeteueqnm eludeteuemqn eludeteuemnq eludeteuenmq eludeteuenqm eludeteunqem eludeteunqme eludeteuneqm
eludeteunemq eludeteunmeq eludeteunmqe eludetenmque eludetenmqeu eludetenmuqe eludetenmueq eludetenmeuq eludetenmequ
eludetenqmue eludetenqmeu eludetenqume eludetenquem eludetenqeum eludetenqemu eludetenuqme eludetenuqem eludetenumqe
eludetenumeq eludetenuemq eludetenueqm eludetenequm eludeteneqmu eludeteneuqm eludeteneumq eludetenemuq eludetenemqu
eludeetnmque eludeetnmqeu eludeetnmuqe eludeetnmueq eludeetnmeuq eludeetnmequ eludeetnqmue eludeetnqmeu eludeetnqume
eludeetnquem eludeetnqeum eludeetnqemu eludeetnuqme eludeetnuqem eludeetnumqe eludeetnumeq eludeetnuemq eludeetnueqm
eludeetnequm eludeetneqmu eludeetneuqm eludeetneumq eludeetnemuq eludeetnemqu eludeetmnque eludeetmnqeu eludeetmnuqe
eludeetmnueq eludeetmneuq eludeetmnequ eludeetmqnue eludeetmqneu eludeetmqune eludeetmquen eludeetmqeun eludeetmqenu
eludeetmuqne eludeetmuqen eludeetmunqe eludeetmuneq eludeetmuenq eludeetmueqn eludeetmequn eludeetmeqnu eludeetmeuqn
eludeetmeunq eludeetmenuq eludeetmenqu eludeetqmnue eludeetqmneu eludeetqmune eludeetqmuen eludeetqmeun eludeetqmenu
eludeetqnmue eludeetqnmeu eludeetqnume eludeetqnuem eludeetqneum eludeetqnemu eludeetqunme eludeetqunem eludeetqumne
eludeetqumen eludeetquemn eludeetquenm eludeetqenum eludeetqenmu eludeetqeunm eludeetqeumn eludeetqemun eludeetqemnu
eludeetumqne eludeetumqen eludeetumnqe eludeetumneq eludeetumenq eludeetumeqn eludeetuqmne eludeetuqmen eludeetuqnme
eludeetuqnem eludeetuqenm eludeetuqemn eludeetunqme eludeetunqem eludeetunmqe eludeetunmeq eludeetunemq eludeetuneqm
eludeetueqnm eludeetueqmn eludeetuenqm eludeetuenmq eludeetuemnq eludeetuemqn eludeetemqun eludeetemqnu eludeetemuqn
eludeetemunq eludeetemnuq eludeetemnqu eludeeteqmun eludeeteqmnu eludeetequmn eludeetequnm eludeeteqnum eludeeteqnmu
eludeeteuqmn eludeeteuqnm eludeeteumqn eludeeteumnq eludeeteunmq eludeeteunqm eludeetenqum eludeetenqmu eludeetenuqm
eludeetenumq eludeetenmuq eludeetenmqu eludeentmque eludeentmqeu eludeentmuqe eludeentmueq eludeentmeuq eludeentmequ
eludeentqmue eludeentqmeu eludeentqume eludeentquem eludeentqeum eludeentqemu eludeentuqme eludeentuqem eludeentumqe
eludeentumeq eludeentuemq eludeentueqm eludeentequm eludeenteqmu eludeenteuqm eludeenteumq eludeentemuq eludeentemqu
eludeenmtque eludeenmtqeu eludeenmtuqe eludeenmtueq eludeenmteuq eludeenmtequ eludeenmqtue eludeenmqteu eludeenmqute
eludeenmquet eludeenmqeut eludeenmqetu eludeenmuqte eludeenmuqet eludeenmutqe eludeenmuteq eludeenmuetq eludeenmueqt
eludeenmequt eludeenmeqtu eludeenmeuqt eludeenmeutq eludeenmetuq eludeenmetqu eludeenqmtue eludeenqmteu eludeenqmute
eludeenqmuet eludeenqmeut eludeenqmetu eludeenqtmue eludeenqtmeu eludeenqtume eludeenqtuem eludeenqteum eludeenqtemu
eludeenqutme eludeenqutem eludeenqumte eludeenqumet eludeenquemt eludeenquetm eludeenqetum eludeenqetmu eludeenqeutm
eludeenqeumt eludeenqemut eludeenqemtu eludeenumqte eludeenumqet eludeenumtqe eludeenumteq eludeenumetq eludeenumeqt
eludeenuqmte eludeenuqmet eludeenuqtme eludeenuqtem eludeenuqetm eludeenuqemt eludeenutqme eludeenutqem eludeenutmqe
eludeenutmeq eludeenutemq eludeenuteqm eludeenueqtm eludeenueqmt eludeenuetqm eludeenuetmq eludeenuemtq eludeenuemqt
eludeenemqut eludeenemqtu eludeenemuqt eludeenemutq eludeenemtuq eludeenemtqu eludeeneqmut eludeeneqmtu eludeenequmt
eludeenequtm eludeeneqtum eludeeneqtmu eludeeneuqmt eludeeneuqtm eludeeneumqt eludeeneumtq eludeeneutmq eludeeneutqm
eludeenetqum eludeenetqmu eludeenetuqm eludeenetumq eludeenetmuq eludeenetmqu eludeemntque eludeemntqeu eludeemntuqe
eludeemntueq eludeemnteuq eludeemntequ eludeemnqtue eludeemnqteu eludeemnqute eludeemnquet eludeemnqeut eludeemnqetu
eludeemnuqte eludeemnuqet eludeemnutqe eludeemnuteq eludeemnuetq eludeemnueqt eludeemnequt eludeemneqtu eludeemneuqt
eludeemneutq eludeemnetuq eludeemnetqu eludeemtnque eludeemtnqeu eludeemtnuqe eludeemtnueq eludeemtneuq eludeemtnequ
eludeemtqnue eludeemtqneu eludeemtqune eludeemtquen eludeemtqeun eludeemtqenu eludeemtuqne eludeemtuqen eludeemtunqe
eludeemtuneq eludeemtuenq eludeemtueqn eludeemtequn eludeemteqnu eludeemteuqn eludeemteunq eludeemtenuq eludeemtenqu
eludeemqtnue eludeemqtneu eludeemqtune eludeemqtuen eludeemqteun eludeemqtenu eludeemqntue eludeemqnteu eludeemqnute
eludeemqnuet eludeemqneut eludeemqnetu eludeemqunte eludeemqunet eludeemqutne eludeemquten eludeemquetn eludeemquent
eludeemqenut eludeemqentu eludeemqeunt eludeemqeutn eludeemqetun eludeemqetnu eludeemutqne eludeemutqen eludeemutnqe
eludeemutneq eludeemutenq eludeemuteqn eludeemuqtne eludeemuqten eludeemuqnte eludeemuqnet eludeemuqent eludeemuqetn
eludeemunqte eludeemunqet eludeemuntqe eludeemunteq eludeemunetq eludeemuneqt eludeemueqnt eludeemueqtn eludeemuenqt
eludeemuentq eludeemuetnq eludeemuetqn eludeemetqun eludeemetqnu eludeemetuqn eludeemetunq eludeemetnuq eludeemetnqu
eludeemeqtun eludeemeqtnu eludeemequtn eludeemequnt eludeemeqnut eludeemeqntu eludeemeuqtn eludeemeuqnt eludeemeutqn
eludeemeutnq eludeemeuntq eludeemeunqt eludeemenqut eludeemenqtu eludeemenuqt eludeemenutq eludeementuq eludeementqu
eludeeqnmtue eludeeqnmteu eludeeqnmute eludeeqnmuet eludeeqnmeut eludeeqnmetu eludeeqntmue eludeeqntmeu eludeeqntume
eludeeqntuem eludeeqnteum eludeeqntemu eludeeqnutme eludeeqnutem eludeeqnumte eludeeqnumet eludeeqnuemt eludeeqnuetm
eludeeqnetum eludeeqnetmu eludeeqneutm eludeeqneumt eludeeqnemut eludeeqnemtu eludeeqmntue eludeeqmnteu eludeeqmnute
eludeeqmnuet eludeeqmneut eludeeqmnetu eludeeqmtnue eludeeqmtneu eludeeqmtune eludeeqmtuen eludeeqmteun eludeeqmtenu
eludeeqmutne eludeeqmuten eludeeqmunte eludeeqmunet eludeeqmuent eludeeqmuetn eludeeqmetun eludeeqmetnu eludeeqmeutn
eludeeqmeunt eludeeqmenut eludeeqmentu eludeeqtmnue eludeeqtmneu eludeeqtmune eludeeqtmuen eludeeqtmeun eludeeqtmenu
eludeeqtnmue eludeeqtnmeu eludeeqtnume eludeeqtnuem eludeeqtneum eludeeqtnemu eludeeqtunme eludeeqtunem eludeeqtumne
eludeeqtumen eludeeqtuemn eludeeqtuenm eludeeqtenum eludeeqtenmu eludeeqteunm eludeeqteumn eludeeqtemun eludeeqtemnu
eludeequmtne eludeequmten eludeequmnte eludeequmnet eludeequment eludeequmetn eludeequtmne eludeequtmen eludeequtnme
eludeequtnem eludeequtenm eludeequtemn eludeequntme eludeequntem eludeequnmte eludeequnmet eludeequnemt eludeequnetm
eludeequetnm eludeequetmn eludeequentm eludeequenmt eludeequemnt eludeequemtn eludeeqemtun eludeeqemtnu eludeeqemutn
eludeeqemunt eludeeqemnut eludeeqemntu eludeeqetmun eludeeqetmnu eludeeqetumn eludeeqetunm eludeeqetnum eludeeqetnmu
eludeeqeutmn eludeeqeutnm eludeeqeumtn eludeeqeumnt eludeeqeunmt eludeeqeuntm eludeeqentum eludeeqentmu eludeeqenutm
eludeeqenumt eludeeqenmut eludeeqenmtu eludeeunmqte eludeeunmqet eludeeunmtqe eludeeunmteq eludeeunmetq eludeeunmeqt
eludeeunqmte eludeeunqmet eludeeunqtme eludeeunqtem eludeeunqetm eludeeunqemt eludeeuntqme eludeeuntqem eludeeuntmqe
eludeeuntmeq eludeeuntemq eludeeunteqm eludeeuneqtm eludeeuneqmt eludeeunetqm eludeeunetmq eludeeunemtq eludeeunemqt
eludeeumnqte eludeeumnqet eludeeumntqe eludeeumnteq eludeeumnetq eludeeumneqt eludeeumqnte eludeeumqnet eludeeumqtne
eludeeumqten eludeeumqetn eludeeumqent eludeeumtqne eludeeumtqen eludeeumtnqe eludeeumtneq eludeeumtenq eludeeumteqn
eludeeumeqtn eludeeumeqnt eludeeumetqn eludeeumetnq eludeeumentq eludeeumenqt eludeeuqmnte eludeeuqmnet eludeeuqmtne
eludeeuqmten eludeeuqmetn eludeeuqment eludeeuqnmte eludeeuqnmet eludeeuqntme eludeeuqntem eludeeuqnetm eludeeuqnemt
eludeeuqtnme eludeeuqtnem eludeeuqtmne eludeeuqtmen eludeeuqtemn eludeeuqtenm eludeeuqentm eludeeuqenmt eludeeuqetnm
eludeeuqetmn eludeeuqemtn eludeeuqemnt eludeeutmqne eludeeutmqen eludeeutmnqe eludeeutmneq eludeeutmenq eludeeutmeqn
eludeeutqmne eludeeutqmen eludeeutqnme eludeeutqnem eludeeutqenm eludeeutqemn eludeeutnqme eludeeutnqem eludeeutnmqe
eludeeutnmeq eludeeutnemq eludeeutneqm eludeeuteqnm eludeeuteqmn eludeeutenqm eludeeutenmq eludeeutemnq eludeeutemqn
eludeeuemqtn eludeeuemqnt eludeeuemtqn eludeeuemtnq eludeeuemntq eludeeuemnqt eludeeueqmtn eludeeueqmnt eludeeueqtmn
eludeeueqtnm eludeeueqntm eludeeueqnmt eludeeuetqmn eludeeuetqnm eludeeuetmqn eludeeuetmnq eludeeuetnmq eludeeuetnqm
eludeeuenqtm eludeeuenqmt eludeeuentqm eludeeuentmq eludeeuenmtq eludeeuenmqt eludeeenmqut eludeeenmqtu eludeeenmuqt
eludeeenmutq eludeeenmtuq eludeeenmtqu eludeeenqmut eludeeenqmtu eludeeenqumt eludeeenqutm eludeeenqtum eludeeenqtmu
eludeeenuqmt eludeeenuqtm eludeeenumqt eludeeenumtq eludeeenutmq eludeeenutqm eludeeentqum eludeeentqmu eludeeentuqm
eludeeentumq eludeeentmuq eludeeentmqu eludeeemnqut eludeeemnqtu eludeeemnuqt eludeeemnutq eludeeemntuq eludeeemntqu
eludeeemqnut eludeeemqntu eludeeemqunt eludeeemqutn eludeeemqtun eludeeemqtnu eludeeemuqnt eludeeemuqtn eludeeemunqt
eludeeemuntq eludeeemutnq eludeeemutqn eludeeemtqun eludeeemtqnu eludeeemtuqn eludeeemtunq eludeeemtnuq eludeeemtnqu
eludeeeqmnut eludeeeqmntu eludeeeqmunt eludeeeqmutn eludeeeqmtun eludeeeqmtnu eludeeeqnmut eludeeeqnmtu eludeeeqnumt
eludeeeqnutm eludeeeqntum eludeeeqntmu eludeeequnmt eludeeequntm eludeeequmnt eludeeequmtn eludeeequtmn eludeeequtnm
eludeeeqtnum eludeeeqtnmu eludeeeqtunm eludeeeqtumn eludeeeqtmun eludeeeqtmnu eludeeeumqnt eludeeeumqtn eludeeeumnqt
eludeeeumntq eludeeeumtnq eludeeeumtqn eludeeeuqmnt eludeeeuqmtn eludeeeuqnmt eludeeeuqntm eludeeeuqtnm eludeeeuqtmn
eludeeeunqmt eludeeeunqtm eludeeeunmqt eludeeeunmtq eludeeeuntmq eludeeeuntqm eludeeeutqnm eludeeeutqmn eludeeeutnqm
eludeeeutnmq eludeeeutmnq eludeeeutmqn eludeeetmqun eludeeetmqnu eludeeetmuqn eludeeetmunq eludeeetmnuq eludeeetmnqu
eludeeetqmun eludeeetqmnu eludeeetqumn eludeeetqunm eludeeetqnum eludeeetqnmu eludeeetuqmn eludeeetuqnm eludeeetumqn
eludeeetumnq eludeeetunmq eludeeetunqm eludeeetnqum eludeeetnqmu eludeeetnuqm eludeeetnumq eludeeetnmuq eludeeetnmqu
eludemtenque eludemtenqeu eludemtenuqe eludemtenueq eludemteneuq eludemtenequ eludemteqnue eludemteqneu eludemtequne
eludemtequen eludemteqeun eludemteqenu eludemteuqne eludemteuqen eludemteunqe eludemteuneq eludemteuenq eludemteueqn
eludemteequn eludemteeqnu eludemteeuqn eludemteeunq eludemteenuq eludemteenqu eludemtneque eludemtneqeu eludemtneuqe
eludemtneueq eludemtneeuq eludemtneequ eludemtnqeue eludemtnqeeu eludemtnquee eludemtnquee eludemtnqeue eludemtnqeeu
eludemtnuqee eludemtnuqee eludemtnueqe eludemtnueeq eludemtnueeq eludemtnueqe eludemtneque eludemtneqeu eludemtneuqe
eludemtneueq eludemtneeuq eludemtneequ eludemtqneue eludemtqneeu eludemtqnuee eludemtqnuee eludemtqneue eludemtqneeu
eludemtqenue eludemtqeneu eludemtqeune eludemtqeuen eludemtqeeun eludemtqeenu eludemtquene eludemtqueen eludemtqunee
eludemtqunee eludemtquene eludemtqueen eludemtqeeun eludemtqeenu eludemtqeuen eludemtqeune eludemtqenue eludemtqeneu
eludemtunqee eludemtunqee eludemtuneqe eludemtuneeq eludemtuneeq eludemtuneqe eludemtuqnee eludemtuqnee eludemtuqene
eludemtuqeen eludemtuqeen eludemtuqene eludemtueqne eludemtueqen eludemtuenqe eludemtueneq eludemtueenq eludemtueeqn
eludemtueqen eludemtueqne eludemtueeqn eludemtueenq eludemtueneq eludemtuenqe eludemtenque eludemtenqeu eludemtenuqe
eludemtenueq eludemteneuq eludemtenequ eludemteqnue eludemteqneu eludemtequne eludemtequen eludemteqeun eludemteqenu
eludemteuqne eludemteuqen eludemteunqe eludemteuneq eludemteuenq eludemteueqn eludemteequn eludemteeqnu eludemteeuqn
eludemteeunq eludemteenuq eludemteenqu eludemetnque eludemetnqeu eludemetnuqe eludemetnueq eludemetneuq eludemetnequ
eludemetqnue eludemetqneu eludemetqune eludemetquen eludemetqeun eludemetqenu eludemetuqne eludemetuqen eludemetunqe
eludemetuneq eludemetuenq eludemetueqn eludemetequn eludemeteqnu eludemeteuqn eludemeteunq eludemetenuq eludemetenqu
eludementque eludementqeu eludementuqe eludementueq eludementeuq eludementequ eludemenqtue eludemenqteu eludemenqute
eludemenquet eludemenqeut eludemenqetu eludemenuqte eludemenuqet eludemenutqe eludemenuteq eludemenuetq eludemenueqt
eludemenequt eludemeneqtu eludemeneuqt eludemeneutq eludemenetuq eludemenetqu eludemeqntue eludemeqnteu eludemeqnute
eludemeqnuet eludemeqneut eludemeqnetu eludemeqtnue eludemeqtneu eludemeqtune eludemeqtuen eludemeqteun eludemeqtenu
eludemequtne eludemequten eludemequnte eludemequnet eludemequent eludemequetn eludemeqetun eludemeqetnu eludemeqeutn
eludemeqeunt eludemeqenut eludemeqentu eludemeunqte eludemeunqet eludemeuntqe eludemeunteq eludemeunetq eludemeuneqt
eludemeuqnte eludemeuqnet eludemeuqtne eludemeuqten eludemeuqetn eludemeuqent eludemeutqne eludemeutqen eludemeutnqe
eludemeutneq eludemeutenq eludemeuteqn eludemeueqtn eludemeueqnt eludemeuetqn eludemeuetnq eludemeuentq eludemeuenqt
eludemeenqut eludemeenqtu eludemeenuqt eludemeenutq eludemeentuq eludemeentqu eludemeeqnut eludemeeqntu eludemeequnt
eludemeequtn eludemeeqtun eludemeeqtnu eludemeeuqnt eludemeeuqtn eludemeeunqt eludemeeuntq eludemeeutnq eludemeeutqn
eludemeetqun eludemeetqnu eludemeetuqn eludemeetunq eludemeetnuq eludemeetnqu eludemnetque eludemnetqeu eludemnetuqe
eludemnetueq eludemneteuq eludemnetequ eludemneqtue eludemneqteu eludemnequte eludemnequet eludemneqeut eludemneqetu
eludemneuqte eludemneuqet eludemneutqe eludemneuteq eludemneuetq eludemneueqt eludemneequt eludemneeqtu eludemneeuqt
eludemneeutq eludemneetuq eludemneetqu eludemnteque eludemnteqeu eludemnteuqe eludemnteueq eludemnteeuq eludemnteequ
eludemntqeue eludemntqeeu eludemntquee eludemntquee eludemntqeue eludemntqeeu eludemntuqee eludemntuqee eludemntueqe
eludemntueeq eludemntueeq eludemntueqe eludemnteque eludemnteqeu eludemnteuqe eludemnteueq eludemnteeuq eludemnteequ
eludemnqteue eludemnqteeu eludemnqtuee eludemnqtuee eludemnqteue eludemnqteeu eludemnqetue eludemnqeteu eludemnqeute
eludemnqeuet eludemnqeeut eludemnqeetu eludemnquete eludemnqueet eludemnqutee eludemnqutee eludemnquete eludemnqueet
eludemnqeeut eludemnqeetu eludemnqeuet eludemnqeute eludemnqetue eludemnqeteu eludemnutqee eludemnutqee eludemnuteqe
eludemnuteeq eludemnuteeq eludemnuteqe eludemnuqtee eludemnuqtee eludemnuqete eludemnuqeet eludemnuqeet eludemnuqete
eludemnueqte eludemnueqet eludemnuetqe eludemnueteq eludemnueetq eludemnueeqt eludemnueqet eludemnueqte eludemnueeqt
eludemnueetq eludemnueteq eludemnuetqe eludemnetque eludemnetqeu eludemnetuqe eludemnetueq eludemneteuq eludemnetequ
eludemneqtue eludemneqteu eludemnequte eludemnequet eludemneqeut eludemneqetu eludemneuqte eludemneuqet eludemneutqe
eludemneuteq eludemneuetq eludemneueqt eludemneequt eludemneeqtu eludemneeuqt eludemneeutq eludemneetuq eludemneetqu
eludemqentue eludemqenteu eludemqenute eludemqenuet eludemqeneut eludemqenetu eludemqetnue eludemqetneu eludemqetune
eludemqetuen eludemqeteun eludemqetenu eludemqeutne eludemqeuten eludemqeunte eludemqeunet eludemqeuent eludemqeuetn
eludemqeetun eludemqeetnu eludemqeeutn eludemqeeunt eludemqeenut eludemqeentu eludemqnetue eludemqneteu eludemqneute
eludemqneuet eludemqneeut eludemqneetu eludemqnteue eludemqnteeu eludemqntuee eludemqntuee eludemqnteue eludemqnteeu
eludemqnutee eludemqnutee eludemqnuete eludemqnueet eludemqnueet eludemqnuete eludemqnetue eludemqneteu eludemqneute
eludemqneuet eludemqneeut eludemqneetu eludemqtneue eludemqtneeu eludemqtnuee eludemqtnuee eludemqtneue eludemqtneeu
eludemqtenue eludemqteneu eludemqteune eludemqteuen eludemqteeun eludemqteenu eludemqtuene eludemqtueen eludemqtunee
eludemqtunee eludemqtuene eludemqtueen eludemqteeun eludemqteenu eludemqteuen eludemqteune eludemqtenue eludemqteneu
eludemquntee eludemquntee eludemqunete eludemquneet eludemquneet eludemqunete eludemqutnee eludemqutnee eludemqutene
eludemquteen eludemquteen eludemqutene eludemquetne eludemqueten eludemquente eludemquenet eludemqueent eludemqueetn
eludemqueten eludemquetne eludemqueetn eludemqueent eludemquenet eludemquente eludemqentue eludemqenteu eludemqenute
eludemqenuet eludemqeneut eludemqenetu eludemqetnue eludemqetneu eludemqetune eludemqetuen eludemqeteun eludemqetenu
eludemqeutne eludemqeuten eludemqeunte eludemqeunet eludemqeuent eludemqeuetn eludemqeetun eludemqeetnu eludemqeeutn
eludemqeeunt eludemqeenut eludemqeentu eludemuenqte eludemuenqet eludemuentqe eludemuenteq eludemuenetq eludemueneqt
eludemueqnte eludemueqnet eludemueqtne eludemueqten eludemueqetn eludemueqent eludemuetqne eludemuetqen eludemuetnqe
eludemuetneq eludemuetenq eludemueteqn eludemueeqtn eludemueeqnt eludemueetqn eludemueetnq eludemueentq eludemueenqt
eludemuneqte eludemuneqet eludemunetqe eludemuneteq eludemuneetq eludemuneeqt eludemunqete eludemunqeet eludemunqtee
eludemunqtee eludemunqete eludemunqeet eludemuntqee eludemuntqee eludemunteqe eludemunteeq eludemunteeq eludemunteqe
eludemuneqte eludemuneqet eludemunetqe eludemuneteq eludemuneetq eludemuneeqt eludemuqnete eludemuqneet eludemuqntee
eludemuqntee eludemuqnete eludemuqneet eludemuqente eludemuqenet eludemuqetne eludemuqeten eludemuqeetn eludemuqeent
eludemuqtene eludemuqteen eludemuqtnee eludemuqtnee eludemuqtene eludemuqteen eludemuqeetn eludemuqeent eludemuqeten
eludemuqetne eludemuqente eludemuqenet eludemutnqee eludemutnqee eludemutneqe eludemutneeq eludemutneeq eludemutneqe
eludemutqnee eludemutqnee eludemutqene eludemutqeen eludemutqeen eludemutqene eludemuteqne eludemuteqen eludemutenqe
eludemuteneq eludemuteenq eludemuteeqn eludemuteqen eludemuteqne eludemuteeqn eludemuteenq eludemuteneq eludemutenqe
eludemuenqte eludemuenqet eludemuentqe eludemuenteq eludemuenetq eludemueneqt eludemueqnte eludemueqnet eludemueqtne
eludemueqten eludemueqetn eludemueqent eludemuetqne eludemuetqen eludemuetnqe eludemuetneq eludemuetenq eludemueteqn
eludemueeqtn eludemueeqnt eludemueetqn eludemueetnq eludemueentq eludemueenqt eludemeenqut eludemeenqtu eludemeenuqt
eludemeenutq eludemeentuq eludemeentqu eludemeeqnut eludemeeqntu eludemeequnt eludemeequtn eludemeeqtun eludemeeqtnu
eludemeeuqnt eludemeeuqtn eludemeeunqt eludemeeuntq eludemeeutnq eludemeeutqn eludemeetqun eludemeetqnu eludemeetuqn
eludemeetunq eludemeetnuq eludemeetnqu eludemenequt eludemeneqtu eludemeneuqt eludemeneutq eludemenetuq eludemenetqu
eludemenqeut eludemenqetu eludemenquet eludemenqute eludemenqtue eludemenqteu eludemenuqet eludemenuqte eludemenueqt
eludemenuetq eludemenuteq eludemenutqe eludementque eludementqeu eludementuqe eludementueq eludementeuq eludementequ
eludemeqneut eludemeqnetu eludemeqnuet eludemeqnute eludemeqntue eludemeqnteu eludemeqenut eludemeqentu eludemeqeunt
eludemeqeutn eludemeqetun eludemeqetnu eludemequent eludemequetn eludemequnet eludemequnte eludemequtne eludemequten
eludemeqteun eludemeqtenu eludemeqtuen eludemeqtune eludemeqtnue eludemeqtneu eludemeunqet eludemeunqte eludemeuneqt
eludemeunetq eludemeunteq eludemeuntqe eludemeuqnet eludemeuqnte eludemeuqent eludemeuqetn eludemeuqten eludemeuqtne
eludemeueqnt eludemeueqtn eludemeuenqt eludemeuentq eludemeuetnq eludemeuetqn eludemeutqen eludemeutqne eludemeuteqn
eludemeutenq eludemeutneq eludemeutnqe eludemetnque eludemetnqeu eludemetnuqe eludemetnueq eludemetneuq eludemetnequ
eludemetqnue eludemetqneu eludemetqune eludemetquen eludemetqeun eludemetqenu eludemetuqne eludemetuqen eludemetunqe
eludemetuneq eludemetuenq eludemetueqn eludemetequn eludemeteqnu eludemeteuqn eludemeteunq eludemetenuq eludemetenqu
eludeqtemnue eludeqtemneu eludeqtemune eludeqtemuen eludeqtemeun eludeqtemenu eludeqtenmue eludeqtenmeu eludeqtenume
eludeqtenuem eludeqteneum eludeqtenemu eludeqteunme eludeqteunem eludeqteumne eludeqteumen eludeqteuemn eludeqteuenm
eludeqteenum eludeqteenmu eludeqteeunm eludeqteeumn eludeqteemun eludeqteemnu eludeqtmenue eludeqtmeneu eludeqtmeune
eludeqtmeuen eludeqtmeeun eludeqtmeenu eludeqtmneue eludeqtmneeu eludeqtmnuee eludeqtmnuee eludeqtmneue eludeqtmneeu
eludeqtmunee eludeqtmunee eludeqtmuene eludeqtmueen eludeqtmueen eludeqtmuene eludeqtmenue eludeqtmeneu eludeqtmeune
eludeqtmeuen eludeqtmeeun eludeqtmeenu eludeqtnmeue eludeqtnmeeu eludeqtnmuee eludeqtnmuee eludeqtnmeue eludeqtnmeeu
eludeqtnemue eludeqtnemeu eludeqtneume eludeqtneuem eludeqtneeum eludeqtneemu eludeqtnueme eludeqtnueem eludeqtnumee
eludeqtnumee eludeqtnueme eludeqtnueem eludeqtneeum eludeqtneemu eludeqtneuem eludeqtneume eludeqtnemue eludeqtnemeu
eludeqtumnee eludeqtumnee eludeqtumene eludeqtumeen eludeqtumeen eludeqtumene eludeqtunmee eludeqtunmee eludeqtuneme
eludeqtuneem eludeqtuneem eludeqtuneme eludeqtuenme eludeqtuenem eludeqtuemne eludeqtuemen eludeqtueemn eludeqtueenm
eludeqtuenem eludeqtuenme eludeqtueenm eludeqtueemn eludeqtuemen eludeqtuemne eludeqtemnue eludeqtemneu eludeqtemune
eludeqtemuen eludeqtemeun eludeqtemenu eludeqtenmue eludeqtenmeu eludeqtenume eludeqtenuem eludeqteneum eludeqtenemu
eludeqteunme eludeqteunem eludeqteumne eludeqteumen eludeqteuemn eludeqteuenm eludeqteenum eludeqteenmu eludeqteeunm
eludeqteeumn eludeqteemun eludeqteemnu eludeqetmnue eludeqetmneu eludeqetmune eludeqetmuen eludeqetmeun eludeqetmenu
eludeqetnmue eludeqetnmeu eludeqetnume eludeqetnuem eludeqetneum eludeqetnemu eludeqetunme eludeqetunem eludeqetumne
eludeqetumen eludeqetuemn eludeqetuenm eludeqetenum eludeqetenmu eludeqeteunm eludeqeteumn eludeqetemun eludeqetemnu
eludeqemtnue eludeqemtneu eludeqemtune eludeqemtuen eludeqemteun eludeqemtenu eludeqemntue eludeqemnteu eludeqemnute
eludeqemnuet eludeqemneut eludeqemnetu eludeqemunte eludeqemunet eludeqemutne eludeqemuten eludeqemuetn eludeqemuent
eludeqemenut eludeqementu eludeqemeunt eludeqemeutn eludeqemetun eludeqemetnu eludeqenmtue eludeqenmteu eludeqenmute
eludeqenmuet eludeqenmeut eludeqenmetu eludeqentmue eludeqentmeu eludeqentume eludeqentuem eludeqenteum eludeqentemu
eludeqenutme eludeqenutem eludeqenumte eludeqenumet eludeqenuemt eludeqenuetm eludeqenetum eludeqenetmu eludeqeneutm
eludeqeneumt eludeqenemut eludeqenemtu eludeqeumnte eludeqeumnet eludeqeumtne eludeqeumten eludeqeumetn eludeqeument
eludeqeunmte eludeqeunmet eludeqeuntme eludeqeuntem eludeqeunetm eludeqeunemt eludeqeutnme eludeqeutnem eludeqeutmne
eludeqeutmen eludeqeutemn eludeqeutenm eludeqeuentm eludeqeuenmt eludeqeuetnm eludeqeuetmn eludeqeuemtn eludeqeuemnt
eludeqeemnut eludeqeemntu eludeqeemunt eludeqeemutn eludeqeemtun eludeqeemtnu eludeqeenmut eludeqeenmtu eludeqeenumt
eludeqeenutm eludeqeentum eludeqeentmu eludeqeeunmt eludeqeeuntm eludeqeeumnt eludeqeeumtn eludeqeeutmn eludeqeeutnm
eludeqeetnum eludeqeetnmu eludeqeetunm eludeqeetumn eludeqeetmun eludeqeetmnu eludeqmetnue eludeqmetneu eludeqmetune
eludeqmetuen eludeqmeteun eludeqmetenu eludeqmentue eludeqmenteu eludeqmenute eludeqmenuet eludeqmeneut eludeqmenetu
eludeqmeunte eludeqmeunet eludeqmeutne eludeqmeuten eludeqmeuetn eludeqmeuent eludeqmeenut eludeqmeentu eludeqmeeunt
eludeqmeeutn eludeqmeetun eludeqmeetnu eludeqmtenue eludeqmteneu eludeqmteune eludeqmteuen eludeqmteeun eludeqmteenu
eludeqmtneue eludeqmtneeu eludeqmtnuee eludeqmtnuee eludeqmtneue eludeqmtneeu eludeqmtunee eludeqmtunee eludeqmtuene
eludeqmtueen eludeqmtueen eludeqmtuene eludeqmtenue eludeqmteneu eludeqmteune eludeqmteuen eludeqmteeun eludeqmteenu
eludeqmnteue eludeqmnteeu eludeqmntuee eludeqmntuee eludeqmnteue eludeqmnteeu eludeqmnetue eludeqmneteu eludeqmneute
eludeqmneuet eludeqmneeut eludeqmneetu eludeqmnuete eludeqmnueet eludeqmnutee eludeqmnutee eludeqmnuete eludeqmnueet
eludeqmneeut eludeqmneetu eludeqmneuet eludeqmneute eludeqmnetue eludeqmneteu eludeqmutnee eludeqmutnee eludeqmutene
eludeqmuteen eludeqmuteen eludeqmutene eludeqmuntee eludeqmuntee eludeqmunete eludeqmuneet eludeqmuneet eludeqmunete
eludeqmuente eludeqmuenet eludeqmuetne eludeqmueten eludeqmueetn eludeqmueent eludeqmuenet eludeqmuente eludeqmueent
eludeqmueetn eludeqmueten eludeqmuetne eludeqmetnue eludeqmetneu eludeqmetune eludeqmetuen eludeqmeteun eludeqmetenu
eludeqmentue eludeqmenteu eludeqmenute eludeqmenuet eludeqmeneut eludeqmenetu eludeqmeunte eludeqmeunet eludeqmeutne
eludeqmeuten eludeqmeuetn eludeqmeuent eludeqmeenut eludeqmeentu eludeqmeeunt eludeqmeeutn eludeqmeetun eludeqmeetnu
eludeqnemtue eludeqnemteu eludeqnemute eludeqnemuet eludeqnemeut eludeqnemetu eludeqnetmue eludeqnetmeu eludeqnetume
eludeqnetuem eludeqneteum eludeqnetemu eludeqneutme eludeqneutem eludeqneumte eludeqneumet eludeqneuemt eludeqneuetm
eludeqneetum eludeqneetmu eludeqneeutm eludeqneeumt eludeqneemut eludeqneemtu eludeqnmetue eludeqnmeteu eludeqnmeute
eludeqnmeuet eludeqnmeeut eludeqnmeetu eludeqnmteue eludeqnmteeu eludeqnmtuee eludeqnmtuee eludeqnmteue eludeqnmteeu
eludeqnmutee eludeqnmutee eludeqnmuete eludeqnmueet eludeqnmueet eludeqnmuete eludeqnmetue eludeqnmeteu eludeqnmeute
eludeqnmeuet eludeqnmeeut eludeqnmeetu eludeqntmeue eludeqntmeeu eludeqntmuee eludeqntmuee eludeqntmeue eludeqntmeeu
eludeqntemue eludeqntemeu eludeqnteume eludeqnteuem eludeqnteeum eludeqnteemu eludeqntueme eludeqntueem eludeqntumee
eludeqntumee eludeqntueme eludeqntueem eludeqnteeum eludeqnteemu eludeqnteuem eludeqnteume eludeqntemue eludeqntemeu
eludeqnumtee eludeqnumtee eludeqnumete eludeqnumeet eludeqnumeet eludeqnumete eludeqnutmee eludeqnutmee eludeqnuteme
eludeqnuteem eludeqnuteem eludeqnuteme eludeqnuetme eludeqnuetem eludeqnuemte eludeqnuemet eludeqnueemt eludeqnueetm
eludeqnuetem eludeqnuetme eludeqnueetm eludeqnueemt eludeqnuemet eludeqnuemte eludeqnemtue eludeqnemteu eludeqnemute
eludeqnemuet eludeqnemeut eludeqnemetu eludeqnetmue eludeqnetmeu eludeqnetume eludeqnetuem eludeqneteum eludeqnetemu
eludeqneutme eludeqneutem eludeqneumte eludeqneumet eludeqneuemt eludeqneuetm eludeqneetum eludeqneetmu eludeqneeutm
eludeqneeumt eludeqneemut eludeqneemtu eludequemnte eludequemnet eludequemtne eludequemten eludequemetn eludequement
eludequenmte eludequenmet eludequentme eludequentem eludequenetm eludequenemt eludequetnme eludequetnem eludequetmne
eludequetmen eludequetemn eludequetenm eludequeentm eludequeenmt eludequeetnm eludequeetmn eludequeemtn eludequeemnt
eludequmente eludequmenet eludequmetne eludequmeten eludequmeetn eludequmeent eludequmnete eludequmneet eludequmntee
eludequmntee eludequmnete eludequmneet eludequmtnee eludequmtnee eludequmtene eludequmteen eludequmteen eludequmtene
eludequmente eludequmenet eludequmetne eludequmeten eludequmeetn eludequmeent eludequnmete eludequnmeet eludequnmtee
eludequnmtee eludequnmete eludequnmeet eludequnemte eludequnemet eludequnetme eludequnetem eludequneetm eludequneemt
eludequnteme eludequnteem eludequntmee eludequntmee eludequnteme eludequnteem eludequneetm eludequneemt eludequnetem
eludequnetme eludequnemte eludequnemet eludequtmnee eludequtmnee eludequtmene eludequtmeen eludequtmeen eludequtmene
eludequtnmee eludequtnmee eludequtneme eludequtneem eludequtneem eludequtneme eludequtenme eludequtenem eludequtemne
eludequtemen eludequteemn eludequteenm eludequtenem eludequtenme eludequteenm eludequteemn eludequtemen eludequtemne
eludequemnte eludequemnet eludequemtne eludequemten eludequemetn eludequement eludequenmte eludequenmet eludequentme
eludequentem eludequenetm eludequenemt eludequetnme eludequetnem eludequetmne eludequetmen eludequetemn eludequetenm
eludequeentm eludequeenmt eludequeetnm eludequeetmn eludequeemtn eludequeemnt eludeqeemnut eludeqeemntu eludeqeemunt
eludeqeemutn eludeqeemtun eludeqeemtnu eludeqeenmut eludeqeenmtu eludeqeenumt eludeqeenutm eludeqeentum eludeqeentmu
eludeqeeunmt eludeqeeuntm eludeqeeumnt eludeqeeumtn eludeqeeutmn eludeqeeutnm eludeqeetnum eludeqeetnmu eludeqeetunm
eludeqeetumn eludeqeetmun eludeqeetmnu eludeqemenut eludeqementu eludeqemeunt eludeqemeutn eludeqemetun eludeqemetnu
eludeqemneut eludeqemnetu eludeqemnuet eludeqemnute eludeqemntue eludeqemnteu eludeqemunet eludeqemunte eludeqemuent
eludeqemuetn eludeqemuten eludeqemutne eludeqemtnue eludeqemtneu eludeqemtune eludeqemtuen eludeqemteun eludeqemtenu
eludeqenmeut eludeqenmetu eludeqenmuet eludeqenmute eludeqenmtue eludeqenmteu eludeqenemut eludeqenemtu eludeqeneumt
eludeqeneutm eludeqenetum eludeqenetmu eludeqenuemt eludeqenuetm eludeqenumet eludeqenumte eludeqenutme eludeqenutem
eludeqenteum eludeqentemu eludeqentuem eludeqentume eludeqentmue eludeqentmeu eludeqeumnet eludeqeumnte eludeqeument
eludeqeumetn eludeqeumten eludeqeumtne eludeqeunmet eludeqeunmte eludeqeunemt eludeqeunetm eludeqeuntem eludeqeuntme
eludeqeuenmt eludeqeuentm eludeqeuemnt eludeqeuemtn eludeqeuetmn eludeqeuetnm eludeqeutnem eludeqeutnme eludeqeutenm
eludeqeutemn eludeqeutmen eludeqeutmne eludeqetmnue eludeqetmneu eludeqetmune eludeqetmuen eludeqetmeun eludeqetmenu
eludeqetnmue eludeqetnmeu eludeqetnume eludeqetnuem eludeqetneum eludeqetnemu eludeqetunme eludeqetunem eludeqetumne
eludeqetumen eludeqetuemn eludeqetuenm eludeqetenum eludeqetenmu eludeqeteunm eludeqeteumn eludeqetemun eludeqetemnu
eludeutemqne eludeutemqen eludeutemnqe eludeutemneq eludeutemenq eludeutemeqn eludeuteqmne eludeuteqmen eludeuteqnme
eludeuteqnem eludeuteqenm eludeuteqemn eludeutenqme eludeutenqem eludeutenmqe eludeutenmeq eludeutenemq eludeuteneqm
eludeuteeqnm eludeuteeqmn eludeuteenqm eludeuteenmq eludeuteemnq eludeuteemqn eludeutmeqne eludeutmeqen eludeutmenqe
eludeutmeneq eludeutmeenq eludeutmeeqn eludeutmqene eludeutmqeen eludeutmqnee eludeutmqnee eludeutmqene eludeutmqeen
eludeutmnqee eludeutmnqee eludeutmneqe eludeutmneeq eludeutmneeq eludeutmneqe eludeutmeqne eludeutmeqen eludeutmenqe
eludeutmeneq eludeutmeenq eludeutmeeqn eludeutqmene eludeutqmeen eludeutqmnee eludeutqmnee eludeutqmene eludeutqmeen
eludeutqemne eludeutqemen eludeutqenme eludeutqenem eludeutqeenm eludeutqeemn eludeutqneme eludeutqneem eludeutqnmee
eludeutqnmee eludeutqneme eludeutqneem eludeutqeenm eludeutqeemn eludeutqenem eludeutqenme eludeutqemne eludeutqemen
eludeutnmqee eludeutnmqee eludeutnmeqe eludeutnmeeq eludeutnmeeq eludeutnmeqe eludeutnqmee eludeutnqmee eludeutnqeme
eludeutnqeem eludeutnqeem eludeutnqeme eludeutneqme eludeutneqem eludeutnemqe eludeutnemeq eludeutneemq eludeutneeqm
eludeutneqem eludeutneqme eludeutneeqm eludeutneemq eludeutnemeq eludeutnemqe eludeutemqne eludeutemqen eludeutemnqe
eludeutemneq eludeutemenq eludeutemeqn eludeuteqmne eludeuteqmen eludeuteqnme eludeuteqnem eludeuteqenm eludeuteqemn
eludeutenqme eludeutenqem eludeutenmqe eludeutenmeq eludeutenemq eludeuteneqm eludeuteeqnm eludeuteeqmn eludeuteenqm
eludeuteenmq eludeuteemnq eludeuteemqn eludeuetmqne eludeuetmqen eludeuetmnqe eludeuetmneq eludeuetmenq eludeuetmeqn
eludeuetqmne eludeuetqmen eludeuetqnme eludeuetqnem eludeuetqenm eludeuetqemn eludeuetnqme eludeuetnqem eludeuetnmqe
eludeuetnmeq eludeuetnemq eludeuetneqm eludeueteqnm eludeueteqmn eludeuetenqm eludeuetenmq eludeuetemnq eludeuetemqn
eludeuemtqne eludeuemtqen eludeuemtnqe eludeuemtneq eludeuemtenq eludeuemteqn eludeuemqtne eludeuemqten eludeuemqnte
eludeuemqnet eludeuemqent eludeuemqetn eludeuemnqte eludeuemnqet eludeuemntqe eludeuemnteq eludeuemnetq eludeuemneqt
eludeuemeqnt eludeuemeqtn eludeuemenqt eludeuementq eludeuemetnq eludeuemetqn eludeueqmtne eludeueqmten eludeueqmnte
eludeueqmnet eludeueqment eludeueqmetn eludeueqtmne eludeueqtmen eludeueqtnme eludeueqtnem eludeueqtenm eludeueqtemn
eludeueqntme eludeueqntem eludeueqnmte eludeueqnmet eludeueqnemt eludeueqnetm eludeueqetnm eludeueqetmn eludeueqentm
eludeueqenmt eludeueqemnt eludeueqemtn eludeuenmqte eludeuenmqet eludeuenmtqe eludeuenmteq eludeuenmetq eludeuenmeqt
eludeuenqmte eludeuenqmet eludeuenqtme eludeuenqtem eludeuenqetm eludeuenqemt eludeuentqme eludeuentqem eludeuentmqe
eludeuentmeq eludeuentemq eludeuenteqm eludeueneqtm eludeueneqmt eludeuenetqm eludeuenetmq eludeuenemtq eludeuenemqt
eludeueemqnt eludeueemqtn eludeueemnqt eludeueemntq eludeueemtnq eludeueemtqn eludeueeqmnt eludeueeqmtn eludeueeqnmt
eludeueeqntm eludeueeqtnm eludeueeqtmn eludeueenqmt eludeueenqtm eludeueenmqt eludeueenmtq eludeueentmq eludeueentqm
eludeueetqnm eludeueetqmn eludeueetnqm eludeueetnmq eludeueetmnq eludeueetmqn eludeumetqne eludeumetqen eludeumetnqe
eludeumetneq eludeumetenq eludeumeteqn eludeumeqtne eludeumeqten eludeumeqnte eludeumeqnet eludeumeqent eludeumeqetn
eludeumenqte eludeumenqet eludeumentqe eludeumenteq eludeumenetq eludeumeneqt eludeumeeqnt eludeumeeqtn eludeumeenqt
eludeumeentq eludeumeetnq eludeumeetqn eludeumteqne eludeumteqen eludeumtenqe eludeumteneq eludeumteenq eludeumteeqn
eludeumtqene eludeumtqeen eludeumtqnee eludeumtqnee eludeumtqene eludeumtqeen eludeumtnqee eludeumtnqee eludeumtneqe
eludeumtneeq eludeumtneeq eludeumtneqe eludeumteqne eludeumteqen eludeumtenqe eludeumteneq eludeumteenq eludeumteeqn
eludeumqtene eludeumqteen eludeumqtnee eludeumqtnee eludeumqtene eludeumqteen eludeumqetne eludeumqeten eludeumqente
eludeumqenet eludeumqeent eludeumqeetn eludeumqnete eludeumqneet eludeumqntee eludeumqntee eludeumqnete eludeumqneet
eludeumqeent eludeumqeetn eludeumqenet eludeumqente eludeumqetne eludeumqeten eludeumntqee eludeumntqee eludeumnteqe
eludeumnteeq eludeumnteeq eludeumnteqe eludeumnqtee eludeumnqtee eludeumnqete eludeumnqeet eludeumnqeet eludeumnqete
eludeumneqte eludeumneqet eludeumnetqe eludeumneteq eludeumneetq eludeumneeqt eludeumneqet eludeumneqte eludeumneeqt
eludeumneetq eludeumneteq eludeumnetqe eludeumetqne eludeumetqen eludeumetnqe eludeumetneq eludeumetenq eludeumeteqn
eludeumeqtne eludeumeqten eludeumeqnte eludeumeqnet eludeumeqent eludeumeqetn eludeumenqte eludeumenqet eludeumentqe
eludeumenteq eludeumenetq eludeumeneqt eludeumeeqnt eludeumeeqtn eludeumeenqt eludeumeentq eludeumeetnq eludeumeetqn
eludeuqemtne eludeuqemten eludeuqemnte eludeuqemnet eludeuqement eludeuqemetn eludeuqetmne eludeuqetmen eludeuqetnme
eludeuqetnem eludeuqetenm eludeuqetemn eludeuqentme eludeuqentem eludeuqenmte eludeuqenmet eludeuqenemt eludeuqenetm
eludeuqeetnm eludeuqeetmn eludeuqeentm eludeuqeenmt eludeuqeemnt eludeuqeemtn eludeuqmetne eludeuqmeten eludeuqmente
eludeuqmenet eludeuqmeent eludeuqmeetn eludeuqmtene eludeuqmteen eludeuqmtnee eludeuqmtnee eludeuqmtene eludeuqmteen
eludeuqmntee eludeuqmntee eludeuqmnete eludeuqmneet eludeuqmneet eludeuqmnete eludeuqmetne eludeuqmeten eludeuqmente
eludeuqmenet eludeuqmeent eludeuqmeetn eludeuqtmene eludeuqtmeen eludeuqtmnee eludeuqtmnee eludeuqtmene eludeuqtmeen
eludeuqtemne eludeuqtemen eludeuqtenme eludeuqtenem eludeuqteenm eludeuqteemn eludeuqtneme eludeuqtneem eludeuqtnmee
eludeuqtnmee eludeuqtneme eludeuqtneem eludeuqteenm eludeuqteemn eludeuqtenem eludeuqtenme eludeuqtemne eludeuqtemen
eludeuqnmtee eludeuqnmtee eludeuqnmete eludeuqnmeet eludeuqnmeet eludeuqnmete eludeuqntmee eludeuqntmee eludeuqnteme
eludeuqnteem eludeuqnteem eludeuqnteme eludeuqnetme eludeuqnetem eludeuqnemte eludeuqnemet eludeuqneemt eludeuqneetm
eludeuqnetem eludeuqnetme eludeuqneetm eludeuqneemt eludeuqnemet eludeuqnemte eludeuqemtne eludeuqemten eludeuqemnte
eludeuqemnet eludeuqement eludeuqemetn eludeuqetmne eludeuqetmen eludeuqetnme eludeuqetnem eludeuqetenm eludeuqetemn
eludeuqentme eludeuqentem eludeuqenmte eludeuqenmet eludeuqenemt eludeuqenetm eludeuqeetnm eludeuqeetmn eludeuqeentm
eludeuqeenmt eludeuqeemnt eludeuqeemtn eludeunemqte eludeunemqet eludeunemtqe eludeunemteq eludeunemetq eludeunemeqt
eludeuneqmte eludeuneqmet eludeuneqtme eludeuneqtem eludeuneqetm eludeuneqemt eludeunetqme eludeunetqem eludeunetmqe
eludeunetmeq eludeunetemq eludeuneteqm eludeuneeqtm eludeuneeqmt eludeuneetqm eludeuneetmq eludeuneemtq eludeuneemqt
eludeunmeqte eludeunmeqet eludeunmetqe eludeunmeteq eludeunmeetq eludeunmeeqt eludeunmqete eludeunmqeet eludeunmqtee
eludeunmqtee eludeunmqete eludeunmqeet eludeunmtqee eludeunmtqee eludeunmteqe eludeunmteeq eludeunmteeq eludeunmteqe
eludeunmeqte eludeunmeqet eludeunmetqe eludeunmeteq eludeunmeetq eludeunmeeqt eludeunqmete eludeunqmeet eludeunqmtee
eludeunqmtee eludeunqmete eludeunqmeet eludeunqemte eludeunqemet eludeunqetme eludeunqetem eludeunqeetm eludeunqeemt
eludeunqteme eludeunqteem eludeunqtmee eludeunqtmee eludeunqteme eludeunqteem eludeunqeetm eludeunqeemt eludeunqetem
eludeunqetme eludeunqemte eludeunqemet eludeuntmqee eludeuntmqee eludeuntmeqe eludeuntmeeq eludeuntmeeq eludeuntmeqe
eludeuntqmee eludeuntqmee eludeuntqeme eludeuntqeem eludeuntqeem eludeuntqeme eludeunteqme eludeunteqem eludeuntemqe
eludeuntemeq eludeunteemq eludeunteeqm eludeunteqem eludeunteqme eludeunteeqm eludeunteemq eludeuntemeq eludeuntemqe
eludeunemqte eludeunemqet eludeunemtqe eludeunemteq eludeunemetq eludeunemeqt eludeuneqmte eludeuneqmet eludeuneqtme
eludeuneqtem eludeuneqetm eludeuneqemt eludeunetqme eludeunetqem eludeunetmqe eludeunetmeq eludeunetemq eludeuneteqm
eludeuneeqtm eludeuneeqmt eludeuneetqm eludeuneetmq eludeuneemtq eludeuneemqt eludeueemqnt eludeueemqtn eludeueemnqt
eludeueemntq eludeueemtnq eludeueemtqn eludeueeqmnt eludeueeqmtn eludeueeqnmt eludeueeqntm eludeueeqtnm eludeueeqtmn
eludeueenqmt eludeueenqtm eludeueenmqt eludeueenmtq eludeueentmq eludeueentqm eludeueetqnm eludeueetqmn eludeueetnqm
eludeueetnmq eludeueetmnq eludeueetmqn eludeuemeqnt eludeuemeqtn eludeuemenqt eludeuementq eludeuemetnq eludeuemetqn
eludeuemqent eludeuemqetn eludeuemqnet eludeuemqnte eludeuemqtne eludeuemqten eludeuemnqet eludeuemnqte eludeuemneqt
eludeuemnetq eludeuemnteq eludeuemntqe eludeuemtqne eludeuemtqen eludeuemtnqe eludeuemtneq eludeuemtenq eludeuemteqn
eludeueqment eludeueqmetn eludeueqmnet eludeueqmnte eludeueqmtne eludeueqmten eludeueqemnt eludeueqemtn eludeueqenmt
eludeueqentm eludeueqetnm eludeueqetmn eludeueqnemt eludeueqnetm eludeueqnmet eludeueqnmte eludeueqntme eludeueqntem
eludeueqtenm eludeueqtemn eludeueqtnem eludeueqtnme eludeueqtmne eludeueqtmen eludeuenmqet eludeuenmqte eludeuenmeqt
eludeuenmetq eludeuenmteq eludeuenmtqe eludeuenqmet eludeuenqmte eludeuenqemt eludeuenqetm eludeuenqtem eludeuenqtme
eludeueneqmt eludeueneqtm eludeuenemqt eludeuenemtq eludeuenetmq eludeuenetqm eludeuentqem eludeuentqme eludeuenteqm
eludeuentemq eludeuentmeq eludeuentmqe eludeuetmqne eludeuetmqen eludeuetmnqe eludeuetmneq eludeuetmenq eludeuetmeqn
eludeuetqmne eludeuetqmen eludeuetqnme eludeuetqnem eludeuetqenm eludeuetqemn eludeuetnqme eludeuetnqem eludeuetnmqe
eludeuetnmeq eludeuetnemq eludeuetneqm eludeueteqnm eludeueteqmn eludeuetenqm eludeuetenmq eludeuetemnq eludeuetemqn
eludeetemqun eludeetemqnu eludeetemuqn eludeetemunq eludeetemnuq eludeetemnqu eludeeteqmun eludeeteqmnu eludeetequmn
eludeetequnm eludeeteqnum eludeeteqnmu eludeeteuqmn eludeeteuqnm eludeeteumqn eludeeteumnq eludeeteunmq eludeeteunqm
eludeetenqum eludeetenqmu eludeetenuqm eludeetenumq eludeetenmuq eludeetenmqu eludeetmequn eludeetmeqnu eludeetmeuqn
eludeetmeunq eludeetmenuq eludeetmenqu eludeetmqeun eludeetmqenu eludeetmquen eludeetmqune eludeetmqnue eludeetmqneu
eludeetmuqen eludeetmuqne eludeetmueqn eludeetmuenq eludeetmuneq eludeetmunqe eludeetmnque eludeetmnqeu eludeetmnuqe
eludeetmnueq eludeetmneuq eludeetmnequ eludeetqmeun eludeetqmenu eludeetqmuen eludeetqmune eludeetqmnue eludeetqmneu
eludeetqemun eludeetqemnu eludeetqeumn eludeetqeunm eludeetqenum eludeetqenmu eludeetquemn eludeetquenm eludeetqumen
eludeetqumne eludeetqunme eludeetqunem eludeetqneum eludeetqnemu eludeetqnuem eludeetqnume eludeetqnmue eludeetqnmeu
eludeetumqen eludeetumqne eludeetumeqn eludeetumenq eludeetumneq eludeetumnqe eludeetuqmen eludeetuqmne eludeetuqemn
eludeetuqenm eludeetuqnem eludeetuqnme eludeetueqmn eludeetueqnm eludeetuemqn eludeetuemnq eludeetuenmq eludeetuenqm
eludeetunqem eludeetunqme eludeetuneqm eludeetunemq eludeetunmeq eludeetunmqe eludeetnmque eludeetnmqeu eludeetnmuqe
eludeetnmueq eludeetnmeuq eludeetnmequ eludeetnqmue eludeetnqmeu eludeetnqume eludeetnquem eludeetnqeum eludeetnqemu
eludeetnuqme eludeetnuqem eludeetnumqe eludeetnumeq eludeetnuemq eludeetnueqm eludeetnequm eludeetneqmu eludeetneuqm
eludeetneumq eludeetnemuq eludeetnemqu eludeeetmqun eludeeetmqnu eludeeetmuqn eludeeetmunq eludeeetmnuq eludeeetmnqu
eludeeetqmun eludeeetqmnu eludeeetqumn eludeeetqunm eludeeetqnum eludeeetqnmu eludeeetuqmn eludeeetuqnm eludeeetumqn
eludeeetumnq eludeeetunmq eludeeetunqm eludeeetnqum eludeeetnqmu eludeeetnuqm eludeeetnumq eludeeetnmuq eludeeetnmqu
eludeeemtqun eludeeemtqnu eludeeemtuqn eludeeemtunq eludeeemtnuq eludeeemtnqu eludeeemqtun eludeeemqtnu eludeeemqutn
eludeeemqunt eludeeemqnut eludeeemqntu eludeeemuqtn eludeeemuqnt eludeeemutqn eludeeemutnq eludeeemuntq eludeeemunqt
eludeeemnqut eludeeemnqtu eludeeemnuqt eludeeemnutq eludeeemntuq eludeeemntqu eludeeeqmtun eludeeeqmtnu eludeeeqmutn
eludeeeqmunt eludeeeqmnut eludeeeqmntu eludeeeqtmun eludeeeqtmnu eludeeeqtumn eludeeeqtunm eludeeeqtnum eludeeeqtnmu
eludeeequtmn eludeeequtnm eludeeequmtn eludeeequmnt eludeeequnmt eludeeequntm eludeeeqntum eludeeeqntmu eludeeeqnutm
eludeeeqnumt eludeeeqnmut eludeeeqnmtu eludeeeumqtn eludeeeumqnt eludeeeumtqn eludeeeumtnq eludeeeumntq eludeeeumnqt
eludeeeuqmtn eludeeeuqmnt eludeeeuqtmn eludeeeuqtnm eludeeeuqntm eludeeeuqnmt eludeeeutqmn eludeeeutqnm eludeeeutmqn
eludeeeutmnq eludeeeutnmq eludeeeutnqm eludeeeunqtm eludeeeunqmt eludeeeuntqm eludeeeuntmq eludeeeunmtq eludeeeunmqt
eludeeenmqut eludeeenmqtu eludeeenmuqt eludeeenmutq eludeeenmtuq eludeeenmtqu eludeeenqmut eludeeenqmtu eludeeenqumt
eludeeenqutm eludeeenqtum eludeeenqtmu eludeeenuqmt eludeeenuqtm eludeeenumqt eludeeenumtq eludeeenutmq eludeeenutqm
eludeeentqum eludeeentqmu eludeeentuqm eludeeentumq eludeeentmuq eludeeentmqu eludeemetqun eludeemetqnu eludeemetuqn
eludeemetunq eludeemetnuq eludeemetnqu eludeemeqtun eludeemeqtnu eludeemequtn eludeemequnt eludeemeqnut eludeemeqntu
eludeemeuqtn eludeemeuqnt eludeemeutqn eludeemeutnq eludeemeuntq eludeemeunqt eludeemenqut eludeemenqtu eludeemenuqt
eludeemenutq eludeementuq eludeementqu eludeemtequn eludeemteqnu eludeemteuqn eludeemteunq eludeemtenuq eludeemtenqu
eludeemtqeun eludeemtqenu eludeemtquen eludeemtqune eludeemtqnue eludeemtqneu eludeemtuqen eludeemtuqne eludeemtueqn
eludeemtuenq eludeemtuneq eludeemtunqe eludeemtnque eludeemtnqeu eludeemtnuqe eludeemtnueq eludeemtneuq eludeemtnequ
eludeemqteun eludeemqtenu eludeemqtuen eludeemqtune eludeemqtnue eludeemqtneu eludeemqetun eludeemqetnu eludeemqeutn
eludeemqeunt eludeemqenut eludeemqentu eludeemquetn eludeemquent eludeemquten eludeemqutne eludeemqunte eludeemqunet
eludeemqneut eludeemqnetu eludeemqnuet eludeemqnute eludeemqntue eludeemqnteu eludeemutqen eludeemutqne eludeemuteqn
eludeemutenq eludeemutneq eludeemutnqe eludeemuqten eludeemuqtne eludeemuqetn eludeemuqent eludeemuqnet eludeemuqnte
eludeemueqtn eludeemueqnt eludeemuetqn eludeemuetnq eludeemuentq eludeemuenqt eludeemunqet eludeemunqte eludeemuneqt
eludeemunetq eludeemunteq eludeemuntqe eludeemntque eludeemntqeu eludeemntuqe eludeemntueq eludeemnteuq eludeemntequ
eludeemnqtue eludeemnqteu eludeemnqute eludeemnquet eludeemnqeut eludeemnqetu eludeemnuqte eludeemnuqet eludeemnutqe
eludeemnuteq eludeemnuetq eludeemnueqt eludeemnequt eludeemneqtu eludeemneuqt eludeemneutq eludeemnetuq eludeemnetqu
eludeeqemtun eludeeqemtnu eludeeqemutn eludeeqemunt eludeeqemnut eludeeqemntu eludeeqetmun eludeeqetmnu eludeeqetumn
eludeeqetunm eludeeqetnum eludeeqetnmu eludeeqeutmn eludeeqeutnm eludeeqeumtn eludeeqeumnt eludeeqeunmt eludeeqeuntm
eludeeqentum eludeeqentmu eludeeqenutm eludeeqenumt eludeeqenmut eludeeqenmtu eludeeqmetun eludeeqmetnu eludeeqmeutn
eludeeqmeunt eludeeqmenut eludeeqmentu eludeeqmteun eludeeqmtenu eludeeqmtuen eludeeqmtune eludeeqmtnue eludeeqmtneu
eludeeqmuten eludeeqmutne eludeeqmuetn eludeeqmuent eludeeqmunet eludeeqmunte eludeeqmntue eludeeqmnteu eludeeqmnute
eludeeqmnuet eludeeqmneut eludeeqmnetu eludeeqtmeun eludeeqtmenu eludeeqtmuen eludeeqtmune eludeeqtmnue eludeeqtmneu
eludeeqtemun eludeeqtemnu eludeeqteumn eludeeqteunm eludeeqtenum eludeeqtenmu eludeeqtuemn eludeeqtuenm eludeeqtumen
eludeeqtumne eludeeqtunme eludeeqtunem eludeeqtneum eludeeqtnemu eludeeqtnuem eludeeqtnume eludeeqtnmue eludeeqtnmeu
eludeequmten eludeequmtne eludeequmetn eludeequment eludeequmnet eludeequmnte eludeequtmen eludeequtmne eludeequtemn
eludeequtenm eludeequtnem eludeequtnme eludeequetmn eludeequetnm eludeequemtn eludeequemnt eludeequenmt eludeequentm
eludeequntem eludeequntme eludeequnetm eludeequnemt eludeequnmet eludeequnmte eludeeqnmtue eludeeqnmteu eludeeqnmute
eludeeqnmuet eludeeqnmeut eludeeqnmetu eludeeqntmue eludeeqntmeu eludeeqntume eludeeqntuem eludeeqnteum eludeeqntemu
eludeeqnutme eludeeqnutem eludeeqnumte eludeeqnumet eludeeqnuemt eludeeqnuetm eludeeqnetum eludeeqnetmu eludeeqneutm
eludeeqneumt eludeeqnemut eludeeqnemtu eludeeuemqtn eludeeuemqnt eludeeuemtqn eludeeuemtnq eludeeuemntq eludeeuemnqt
eludeeueqmtn eludeeueqmnt eludeeueqtmn eludeeueqtnm eludeeueqntm eludeeueqnmt eludeeuetqmn eludeeuetqnm eludeeuetmqn
eludeeuetmnq eludeeuetnmq eludeeuetnqm eludeeuenqtm eludeeuenqmt eludeeuentqm eludeeuentmq eludeeuenmtq eludeeuenmqt
eludeeumeqtn eludeeumeqnt eludeeumetqn eludeeumetnq eludeeumentq eludeeumenqt eludeeumqetn eludeeumqent eludeeumqten
eludeeumqtne eludeeumqnte eludeeumqnet eludeeumtqen eludeeumtqne eludeeumteqn eludeeumtenq eludeeumtneq eludeeumtnqe
eludeeumnqte eludeeumnqet eludeeumntqe eludeeumnteq eludeeumnetq eludeeumneqt eludeeuqmetn eludeeuqment eludeeuqmten
eludeeuqmtne eludeeuqmnte eludeeuqmnet eludeeuqemtn eludeeuqemnt eludeeuqetmn eludeeuqetnm eludeeuqentm eludeeuqenmt
eludeeuqtemn eludeeuqtenm eludeeuqtmen eludeeuqtmne eludeeuqtnme eludeeuqtnem eludeeuqnetm eludeeuqnemt eludeeuqntem
eludeeuqntme eludeeuqnmte eludeeuqnmet eludeeutmqen eludeeutmqne eludeeutmeqn eludeeutmenq eludeeutmneq eludeeutmnqe
eludeeutqmen eludeeutqmne eludeeutqemn eludeeutqenm eludeeutqnem eludeeutqnme eludeeuteqmn eludeeuteqnm eludeeutemqn
eludeeutemnq eludeeutenmq eludeeutenqm eludeeutnqem eludeeutnqme eludeeutneqm eludeeutnemq eludeeutnmeq eludeeutnmqe
eludeeunmqte eludeeunmqet eludeeunmtqe eludeeunmteq eludeeunmetq eludeeunmeqt eludeeunqmte eludeeunqmet eludeeunqtme
eludeeunqtem eludeeunqetm eludeeunqemt eludeeuntqme eludeeuntqem eludeeuntmqe eludeeuntmeq eludeeuntemq eludeeunteqm
eludeeuneqtm eludeeuneqmt eludeeunetqm eludeeunetmq eludeeunemtq eludeeunemqt eludeenemqut eludeenemqtu eludeenemuqt
eludeenemutq eludeenemtuq eludeenemtqu eludeeneqmut eludeeneqmtu eludeenequmt eludeenequtm eludeeneqtum eludeeneqtmu
eludeeneuqmt eludeeneuqtm eludeeneumqt eludeeneumtq eludeeneutmq eludeeneutqm eludeenetqum eludeenetqmu eludeenetuqm
eludeenetumq eludeenetmuq eludeenetmqu eludeenmequt eludeenmeqtu eludeenmeuqt eludeenmeutq eludeenmetuq eludeenmetqu
eludeenmqeut eludeenmqetu eludeenmquet eludeenmqute eludeenmqtue eludeenmqteu eludeenmuqet eludeenmuqte eludeenmueqt
eludeenmuetq eludeenmuteq eludeenmutqe eludeenmtque eludeenmtqeu eludeenmtuqe eludeenmtueq eludeenmteuq eludeenmtequ
eludeenqmeut eludeenqmetu eludeenqmuet eludeenqmute eludeenqmtue eludeenqmteu eludeenqemut eludeenqemtu eludeenqeumt
eludeenqeutm eludeenqetum eludeenqetmu eludeenquemt eludeenquetm eludeenqumet eludeenqumte eludeenqutme eludeenqutem
eludeenqteum eludeenqtemu eludeenqtuem eludeenqtume eludeenqtmue eludeenqtmeu eludeenumqet eludeenumqte eludeenumeqt
eludeenumetq eludeenumteq eludeenumtqe eludeenuqmet eludeenuqmte eludeenuqemt eludeenuqetm eludeenuqtem eludeenuqtme
eludeenueqmt eludeenueqtm eludeenuemqt eludeenuemtq eludeenuetmq eludeenuetqm eludeenutqem eludeenutqme eludeenuteqm
eludeenutemq eludeenutmeq eludeenutmqe eludeentmque eludeentmqeu eludeentmuqe eludeentmueq eludeentmeuq eludeentmequ
eludeentqmue eludeentqmeu eludeentqume eludeentquem eludeentqeum eludeentqemu eludeentuqme eludeentuqem eludeentumqe
eludeentumeq eludeentuemq eludeentueqm eludeentequm eludeenteqmu eludeenteuqm eludeenteumq eludeentemuq eludeentemqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us