easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

alienages

conventusque

underking

mothra

folkmots

nerkuu

misanswer

carnes

tortuously

dragees

upgirding

vagabatur

pelikowsky

manuf

foedamus

verilog

whichway

creamily


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: eichen
cipher variations:
fjdifo gkejgp hlfkhq imglir jnhmjs
koinkt lpjolu mqkpmv nrlqnw osmrox
ptnspy quotqz rvpura swqvsb txrwtc
uysxud vztyve wauzwf xbvaxg ycwbyh
zdxczi aeydaj bfzebk cgafcl dhbgdm

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: eichen
Cipher: vrxsvm

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: eichen
Cipher: AABAA ABAAA AAABA AABBB AABAA ABBAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: eichen
cipher variations:
fjdifonzhwnovplkvodfpydolvtmlotlxatojrfcjorhjqro
zxnezohnrshopdvgpoxtzuxogkejgpoaixopwqmlwpegqzep
mwunmpumybupksgdkpsikrspayofapiostipqewhqpyuavyp
hlfkhqpbjypqxrnmxqfhrafqnxvonqvnzcvqlthelqtjlstq
bzpgbqjptujqrfxirqzvbwzqimglirqckzqrysonyrgisbgr
oywporwoadwrmuifmrukmturcaqhcrkquvkrsgyjsrawcxar
jnhmjsrdlarsztpozshjtchspzxqpsxpbexsnvjgnsvlnuvs
dbridslrvwlsthzktsbxdybskoinktsembstauqpatikudit
qayrqtyqcfytowkhotwmovwtecsjetmswxmtuialutcyezct
lpjolutfnctubvrqbujlvejurbzsruzrdgzupxlipuxnpwxu
fdtkfuntxynuvjbmvudzfadumqkpmvugoduvcwsrcvkmwfkv
scatsvasehavqymjqvyoqxyvgeulgvouyzovwkcnwveagbev
nrlqnwvhpevwdxtsdwlnxglwtdbutwbtfibwrznkrwzpryzw
hfvmhwpvzapwxldoxwfbhcfwosmroxwiqfwxeyutexmoyhmx
uecvuxcugjcxsaolsxaqszaxigwnixqwabqxymepyxgcidgx
ptnspyxjrgxyfzvufynpzinyvfdwvydvhkdytbpmtybrtaby
jhxojyrxbcryznfqzyhdjehyquotqzykshyzgawvgzoqajoz
wgexwzewilezucqnuzcsubczkiypkzsycdszaograziekfiz
rvpurazltizahbxwhaprbkpaxhfyxafxjmfavdrovadtvcda
ljzqlatzdetabphsbajflgjaswqvsbamujabicyxibqsclqb
yigzybgykngbwespwbeuwdebmkarmbuaefubcqitcbkgmhkb
txrwtcbnvkbcjdzyjcrtdmrczjhazchzlohcxftqxcfvxefc
nlbsncvbfgvcdrjudclhnilcuysxudcowlcdkeazkdsuensd
akibadiampidygurydgwyfgdomctodwcghwdeskvedmiojmd
vztyvedpxmdelfbaletvfotebljcbejbnqjezhvszehxzghe
pndupexdhixeftlwfenjpknewauzwfeqynefmgcbmfuwgpuf
cmkdcfkcorkfaiwtafiyahifqoevqfyeijyfgumxgfokqlof
xbvaxgfrzofgnhdcngvxhqvgdnledgldpslgbjxubgjzbijg
rpfwrgzfjkzghvnyhgplrmpgycwbyhgsapghoiedohwyirwh
eomfehmeqtmhckyvchkacjkhsqgxshagklahiwozihqmsnqh
zdxczihtbqhipjfepixzjsxifpngfinfrunidlzwdilbdkli
trhytibhlmbijxpajirntoriaeydajiucrijqkgfqjyaktyj
gqohgjogsvojemaxejmcelmjusizujcimncjkyqbkjsoupsj
bfzebkjvdsjkrlhgrkzbluzkhrpihkphtwpkfnbyfkndfmnk
vtjavkdjnodklzrclktpvqtkcgafclkwetklsmihslacmval
isqjilqiuxqlgoczgloegnolwukbwlekopelmasdmluqwrul
dhbgdmlxfulmtnjitmbdnwbmjtrkjmrjvyrmhpdahmpfhopm
xvlcxmflpqfmnbtenmvrxsvmeichenmygvmnuokjunceoxcn
kuslknskwzsniqebinqgipqnywmdyngmqrgnocufonwsytwn

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: eichen
Cipher: rvpura

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: eichen
Cipher: 514231325133

Extended Methods:
Method #1

Plaintext: eichen
method variations:
kohnksptnspxuysxuczdxczh

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
e i c h e n 
5 4 3 3 5 3 
1 2 1 2 1 3 
They are then read out in rows:
543353121213
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: eichen
Cipher: unpffl

Read more ...
Method #3

Plaintext: eichen
method variations:
qmlwlx mlwlxq lwlxqm
wlxqml lxqmlw xqmlwl

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: eichen

all 720 cipher variations:
eichen eichne eicehn eicenh eicneh eicnhe eihcen eihcne eihecn eihenc eihnec
eihnce eiehcn eiehnc eiechn eiecnh eiench eienhc einhec einhce einehc einech
einceh einche ecihen ecihne eciehn ecienh ecineh ecinhe echien echine echein
echeni echnei echnie ecehin ecehni eceihn eceinh ecenih ecenhi ecnhei ecnhie
ecnehi ecneih ecnieh ecnihe ehcien ehcine ehcein ehceni ehcnei ehcnie ehicen
ehicne ehiecn ehienc ehinec ehince eheicn eheinc ehecin ehecni ehenci ehenic
ehniec ehnice ehneic ehneci ehncei ehncie eechin eechni eecihn eecinh eecnih
eecnhi eehcin eehcni eehicn eehinc eehnic eehnci eeihcn eeihnc eeichn eeicnh
eeinch eeinhc eenhic eenhci eenihc eenich eencih eenchi enchei enchie encehi
enceih encieh encihe enhcei enhcie enheci enheic enhiec enhice enehci enehic
enechi enecih eneich eneihc enihec enihce eniehc eniech eniceh eniche iechen
iechne iecehn iecenh iecneh iecnhe iehcen iehcne iehecn iehenc iehnec iehnce
ieehcn ieehnc ieechn ieecnh ieench ieenhc ienhec ienhce ienehc ienech ienceh
ienche icehen icehne iceehn iceenh iceneh icenhe icheen ichene icheen ichene
ichnee ichnee icehen icehne iceehn iceenh iceneh icenhe icnhee icnhee icnehe
icneeh icneeh icnehe ihceen ihcene ihceen ihcene ihcnee ihcnee ihecen ihecne
iheecn iheenc ihenec ihence iheecn iheenc ihecen ihecne ihence ihenec ihneec
ihnece ihneec ihnece ihncee ihncee iechen iechne iecehn iecenh iecneh iecnhe
iehcen iehcne iehecn iehenc iehnec iehnce ieehcn ieehnc ieechn ieecnh ieench
ieenhc ienhec ienhce ienehc ienech ienceh ienche inchee inchee incehe inceeh
inceeh incehe inhcee inhcee inhece inheec inheec inhece inehce inehec ineche
ineceh ineech ineehc inehec inehce ineehc ineech ineceh ineche ciehen ciehne
cieehn cieenh cieneh cienhe ciheen cihene ciheen cihene cihnee cihnee ciehen
ciehne cieehn cieenh cieneh cienhe cinhee cinhee cinehe cineeh cineeh cinehe
ceihen ceihne ceiehn ceienh ceineh ceinhe cehien cehine cehein ceheni cehnei
cehnie ceehin ceehni ceeihn ceeinh ceenih ceenhi cenhei cenhie cenehi ceneih
cenieh cenihe cheien cheine cheein cheeni chenei chenie chieen chiene chieen
chiene chinee chinee cheien cheine cheein cheeni chenei chenie chniee chniee
chneie chneei chneei chneie ceehin ceehni ceeihn ceeinh ceenih ceenhi cehein
ceheni cehien cehine cehnie cehnei ceihen ceihne ceiehn ceienh ceineh ceinhe
cenhie cenhei cenihe cenieh ceneih cenehi cnehei cnehie cneehi cneeih cneieh
cneihe cnheei cnheie cnheei cnheie cnhiee cnhiee cnehei cnehie cneehi cneeih
cneieh cneihe cnihee cnihee cniehe cnieeh cnieeh cniehe hiceen hicene hiceen
hicene hicnee hicnee hiecen hiecne hieecn hieenc hienec hience hieecn hieenc
hiecen hiecne hience hienec hineec hinece hineec hinece hincee hincee hcieen
hciene hcieen hciene hcinee hcinee hceien hceine hceein hceeni hcenei hcenie
hceein hceeni hceien hceine hcenie hcenei hcneei hcneie hcneei hcneie hcniee
hcniee hecien hecine hecein heceni hecnei hecnie heicen heicne heiecn heienc
heinec heince heeicn heeinc heecin heecni heenci heenic heniec henice heneic
heneci hencei hencie hecein heceni hecien hecine hecnie hecnei heecin heecni
heeicn heeinc heenic heenci heiecn heienc heicen heicne heince heinec heneic
heneci heniec henice hencie hencei hnceei hnceie hnceei hnceie hnciee hnciee
hnecei hnecie hneeci hneeic hneiec hneice hneeci hneeic hnecei hnecie hneice
hneiec hnieec hniece hnieec hniece hnicee hnicee eichen eichne eicehn eicenh
eicneh eicnhe eihcen eihcne eihecn eihenc eihnec eihnce eiehcn eiehnc eiechn
eiecnh eiench eienhc einhec einhce einehc einech einceh einche ecihen ecihne
eciehn ecienh ecineh ecinhe echien echine echein echeni echnei echnie ecehin
ecehni eceihn eceinh ecenih ecenhi ecnhei ecnhie ecnehi ecneih ecnieh ecnihe
ehcien ehcine ehcein ehceni ehcnei ehcnie ehicen ehicne ehiecn ehienc ehinec
ehince eheicn eheinc ehecin ehecni ehenci ehenic ehniec ehnice ehneic ehneci
ehncei ehncie eechin eechni eecihn eecinh eecnih eecnhi eehcin eehcni eehicn
eehinc eehnic eehnci eeihcn eeihnc eeichn eeicnh eeinch eeinhc eenhic eenhci
eenihc eenich eencih eenchi enchei enchie encehi enceih encieh encihe enhcei
enhcie enheci enheic enhiec enhice enehci enehic enechi enecih eneich eneihc
enihec enihce eniehc eniech eniceh eniche nichee nichee nicehe niceeh niceeh
nicehe nihcee nihcee nihece niheec niheec nihece niehce niehec nieche nieceh
nieech nieehc niehec niehce nieehc nieech nieceh nieche ncihee ncihee nciehe
ncieeh ncieeh nciehe nchiee nchiee ncheie ncheei ncheei ncheie ncehie ncehei
nceihe nceieh nceeih nceehi ncehei ncehie nceehi nceeih nceieh nceihe nhciee
nhciee nhceie nhceei nhceei nhceie nhicee nhicee nhiece nhieec nhieec nhiece
nheice nheiec nhecie nhecei nheeci nheeic nheiec nheice nheeic nheeci nhecei
nhecie nechie nechei necihe necieh neceih necehi nehcie nehcei nehice nehiec
neheic neheci neihce neihec neiche neiceh neiech neiehc neehic neehci neeihc
neeich neecih neechi nechei nechie necehi neceih necieh necihe nehcei nehcie
neheci neheic nehiec nehice neehci neehic neechi neecih neeich neeihc neihec
neihce neiehc neiech neiceh neiche

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us