easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

mechanoreceptive

unsureness

padus

barefootin

profuseness

credereturque

judaeophobe

gubernacloque

conferee

pyrgo

handmaids

quadded

sphaeroides

tolliebatque

unmethodical

catechetically

pontaretque

priscila


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: eggheads
cipher variations:
fhhifbet giijgcfu hjjkhdgv ikkliehw jllmjfix
kmmnkgjy lnnolhkz moopmila nppqnjmb oqqroknc
prrsplod qsstqmpe rtturnqf suuvsorg tvvwtpsh
uwwxuqti vxxyvruj wyyzwsvk xzzaxtwl yaabyuxm
zbbczvyn accdawzo bddebxap ceefcybq dffgdzcr

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: eggheads
Cipher: vttsvzwh

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: eggheads
Cipher: AABAA AABBA AABBA AABBB AABAA AAAAA AAABB BAAAB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: eggheads
cipher variations:
fhhifbetnttwnbkdvffkvbqndrrydbwxlddmlbchtppatbirjnncjbulrzzqrbav
zllezbgfhxxshbmppjjgpbszxvvuxbyjgiijgcfuouuxoclewgglwcroesszecxy
meenmcdiuqqbucjskoodkcvmsaarscbwammfachgiyyticnqqkkhqctaywwvyczk
hjjkhdgvpvvypdmfxhhmxdspfttafdyznffondejvrrcvdktlppeldwntbbstdcx
bnngbdihjzzujdorrllirdubzxxwzdalikkliehwqwwzqengyiinyetqguubgeza
oggpoefkwssdwelumqqfmexoucctuedycoohcejikaavkepssmmjsevcayyxaebm
jllmjfixrxxarfohzjjozfurhvvchfabphhqpfglxttexfmvnrrgnfypvdduvfez
dppidfkjlbbwlfqttnnktfwdbzzybfcnkmmnkgjysyybsgpiakkpagvsiwwdigbc
qiirqghmyuufygnwosshogzqweevwgfaeqqjeglkmccxmgruuoolugxecaazcgdo
lnnolhkztzzcthqjbllqbhwtjxxejhcdrjjsrhinzvvgzhoxpttipharxffwxhgb
frrkfhmlnddynhsvvppmvhyfdbbadhepmoopmilauaaduirkcmmrcixukyyfkide
skktsijoawwhaipyquujqibsyggxyihcgsslginmoeezoitwwqqnwizgeccbeifq
nppqnjmbvbbevjsldnnsdjyvlzzgljeftllutjkpbxxibjqzrvvkrjctzhhyzjid
httmhjonpffapjuxxrroxjahfddcfjgroqqrokncwccfwktmeootekzwmaahmkfg
ummvuklqcyyjckraswwlskduaiizakjeiuunikpoqggbqkvyysspykbigeedgkhs
prrsplodxddgxlunfppuflaxnbbinlghvnnwvlmrdzzkdlsbtxxmtlevbjjablkf
jvvojlqprhhcrlwzzttqzlcjhffehlitqsstqmpeyeehymvogqqvgmbyoccjomhi
wooxwmnseaalemtcuyynumfwckkbcmlgkwwpkmrqsiidsmxaauuramdkiggfimju
rtturnqfzffiznwphrrwhnczpddkpnijxppyxnotfbbmfnudvzzovngxdllcdnmh
lxxqlnsrtjjetnybbvvsbneljhhgjnkvsuuvsorgaggjaoxqissxiodaqeelqojk
yqqzyopugccngovewaapwohyemmdeonimyyrmotsukkfuozccwwtcofmkiihkolw
tvvwtpshbhhkbpyrjttyjpebrffmrpklzrrazpqvhddohpwfxbbqxpizfnnefpoj
nzzsnputvllgvpaddxxudpgnljjilpmxuwwxuqticiilcqzskuuzkqfcsggnsqlm
assbaqrwieepiqxgyccryqjagoofgqpkoaatoqvuwmmhwqbeeyyveqhomkkjmqny
vxxyvrujdjjmdratlvvalrgdthhotrmnbttcbrsxjffqjryhzddszrkbhppghrql
pbbuprwvxnnixrcffzzwfripnllknrozwyyzwsvkekknesbumwwbmsheuiipusno
cuudcstykggrksziaeetaslciqqhisrmqccvqsxwyoojysdggaaxgsjqommlospa
xzzaxtwlflloftcvnxxcntifvjjqvtopdvvedtuzlhhsltajbffubtmdjrrijtsn
rddwrtyxzppkztehhbbyhtkrpnnmptqbyaabyuxmgmmpgudwoyydoujgwkkrwupq
ewwfeuvamiitmubkcggvcunekssjkutoseexsuzyaqqlaufiiccziulsqoonqurc
zbbczvynhnnqhvexpzzepvkhxllsxvqrfxxgfvwbnjjunvcldhhwdvoflttklvup
tffytvazbrrmbvgjjddajvmtrpporvsdaccdawzoiooriwfyqaafqwliymmtywrs
gyyhgwxcokkvowdmeiixewpgmuulmwvquggzuwbacssncwhkkeebkwnusqqpswte
bddebxapjppsjxgzrbbgrxmjznnuzxsthzzihxydpllwpxenfjjyfxqhnvvmnxwr
vhhavxcbdttodxillffclxovtrrqtxufceefcybqkqqtkyhascchsynkaoovaytu
iaajiyzeqmmxqyfogkkzgyriowwnoyxswiibwydceuupeyjmmggdmypwussruyvg
dffgdzcrlrrulzibtdditzolbppwbzuvjbbkjzafrnnyrzgphllahzsjpxxopzyt
xjjcxzedfvvqfzknnhhenzqxvttsvzwheggheadsmssvmajcueejuapmcqqxcavw
kcclkabgsoozsahqimmbiatkqyypqazuykkdyafegwwrgalooiifoarywuutwaxi

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: eggheads
Cipher: rtturnqf

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: eggheads
Cipher: 5122223251114134

Extended Methods:
Method #1

Plaintext: eggheads
method variations:
kmmnkfixprrsplocuwwxuqthzbbczvyn

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
e g g h e a d s 
5 2 2 3 5 1 4 3 
1 2 2 2 1 1 1 4 
They are then read out in rows:
5223514312221114
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: eggheads
Cipher: kmeofgaq

Read more ...
Method #3

Plaintext: eggheads
method variations:
fgmwaqly gmwaqlyf mwaqlyfg
waqlyfgm aqlyfgmw qlyfgmwa
lyfgmwaq yfgmwaql

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: eggheads

first 5040 cipher variations(40320 total)
eggheads eggheasd egghedas egghedsa egghesda egghesad egghaeds egghaesd egghades egghadse egghasde
egghased egghdaes egghdase egghdeas egghdesa egghdsea egghdsae egghsade egghsaed egghsdae egghsdea
egghseda egghsead eggehads eggehasd eggehdas eggehdsa eggehsda eggehsad eggeahds eggeahsd eggeadhs
eggeadsh eggeasdh eggeashd eggedahs eggedash eggedhas eggedhsa eggedsha eggedsah eggesadh eggesahd
eggesdah eggesdha eggeshda eggeshad eggaehds eggaehsd eggaedhs eggaedsh eggaesdh eggaeshd eggaheds
eggahesd eggahdes eggahdse eggahsde eggahsed eggadhes eggadhse eggadehs eggadesh eggadseh eggadshe
eggashde eggashed eggasdhe eggasdeh eggasedh eggasehd eggdeahs eggdeash eggdehas eggdehsa eggdesha
eggdesah eggdaehs eggdaesh eggdahes eggdahse eggdashe eggdaseh eggdhaes eggdhase eggdheas eggdhesa
eggdhsea eggdhsae eggdsahe eggdsaeh eggdshae eggdshea eggdseha eggdseah eggseadh eggseahd eggsedah
eggsedha eggsehda eggsehad eggsaedh eggsaehd eggsadeh eggsadhe eggsahde eggsahed eggsdaeh eggsdahe
eggsdeah eggsdeha eggsdhea eggsdhae eggshade eggshaed eggshdae eggshdea eggsheda eggshead eghgeads
eghgeasd eghgedas eghgedsa eghgesda eghgesad eghgaeds eghgaesd eghgades eghgadse eghgasde eghgased
eghgdaes eghgdase eghgdeas eghgdesa eghgdsea eghgdsae eghgsade eghgsaed eghgsdae eghgsdea eghgseda
eghgsead eghegads eghegasd eghegdas eghegdsa eghegsda eghegsad egheagds egheagsd egheadgs egheadsg
egheasdg egheasgd eghedags eghedasg eghedgas eghedgsa eghedsga eghedsag eghesadg eghesagd eghesdag
eghesdga eghesgda eghesgad eghaegds eghaegsd eghaedgs eghaedsg eghaesdg eghaesgd eghageds eghagesd
eghagdes eghagdse eghagsde eghagsed eghadges eghadgse eghadegs eghadesg eghadseg eghadsge eghasgde
eghasged eghasdge eghasdeg eghasedg eghasegd eghdeags eghdeasg eghdegas eghdegsa eghdesga eghdesag
eghdaegs eghdaesg eghdages eghdagse eghdasge eghdaseg eghdgaes eghdgase eghdgeas eghdgesa eghdgsea
eghdgsae eghdsage eghdsaeg eghdsgae eghdsgea eghdsega eghdseag eghseadg eghseagd eghsedag eghsedga
eghsegda eghsegad eghsaedg eghsaegd eghsadeg eghsadge eghsagde eghsaged eghsdaeg eghsdage eghsdeag
eghsdega eghsdgea eghsdgae eghsgade eghsgaed eghsgdae eghsgdea eghsgeda eghsgead egehgads egehgasd
egehgdas egehgdsa egehgsda egehgsad egehagds egehagsd egehadgs egehadsg egehasdg egehasgd egehdags
egehdasg egehdgas egehdgsa egehdsga egehdsag egehsadg egehsagd egehsdag egehsdga egehsgda egehsgad
egeghads egeghasd egeghdas egeghdsa egeghsda egeghsad egegahds egegahsd egegadhs egegadsh egegasdh
egegashd egegdahs egegdash egegdhas egegdhsa egegdsha egegdsah egegsadh egegsahd egegsdah egegsdha
egegshda egegshad egeaghds egeaghsd egeagdhs egeagdsh egeagsdh egeagshd egeahgds egeahgsd egeahdgs
egeahdsg egeahsdg egeahsgd egeadhgs egeadhsg egeadghs egeadgsh egeadsgh egeadshg egeashdg egeashgd
egeasdhg egeasdgh egeasgdh egeasghd egedgahs egedgash egedghas egedghsa egedgsha egedgsah egedaghs
egedagsh egedahgs egedahsg egedashg egedasgh egedhags egedhasg egedhgas egedhgsa egedhsga egedhsag
egedsahg egedsagh egedshag egedshga egedsgha egedsgah egesgadh egesgahd egesgdah egesgdha egesghda
egesghad egesagdh egesaghd egesadgh egesadhg egesahdg egesahgd egesdagh egesdahg egesdgah egesdgha
egesdhga egesdhag egeshadg egeshagd egeshdag egeshdga egeshgda egeshgad egahegds egahegsd egahedgs
egahedsg egahesdg egahesgd egahgeds egahgesd egahgdes egahgdse egahgsde egahgsed egahdges egahdgse
egahdegs egahdesg egahdseg egahdsge egahsgde egahsged egahsdge egahsdeg egahsedg egahsegd egaehgds
egaehgsd egaehdgs egaehdsg egaehsdg egaehsgd egaeghds egaeghsd egaegdhs egaegdsh egaegsdh egaegshd
egaedghs egaedgsh egaedhgs egaedhsg egaedshg egaedsgh egaesgdh egaesghd egaesdgh egaesdhg egaeshdg
egaeshgd egagehds egagehsd egagedhs egagedsh egagesdh egageshd egagheds egaghesd egaghdes egaghdse
egaghsde egaghsed egagdhes egagdhse egagdehs egagdesh egagdseh egagdshe egagshde egagshed egagsdhe
egagsdeh egagsedh egagsehd egadeghs egadegsh egadehgs egadehsg egadeshg egadesgh egadgehs egadgesh
egadghes egadghse egadgshe egadgseh egadhges egadhgse egadhegs egadhesg egadhseg egadhsge egadsghe
egadsgeh egadshge egadsheg egadsehg egadsegh egasegdh egaseghd egasedgh egasedhg egasehdg egasehgd
egasgedh egasgehd egasgdeh egasgdhe egasghde egasghed egasdgeh egasdghe egasdegh egasdehg egasdheg
egasdhge egashgde egashged egashdge egashdeg egashedg egashegd egdheags egdheasg egdhegas egdhegsa
egdhesga egdhesag egdhaegs egdhaesg egdhages egdhagse egdhasge egdhaseg egdhgaes egdhgase egdhgeas
egdhgesa egdhgsea egdhgsae egdhsage egdhsaeg egdhsgae egdhsgea egdhsega egdhseag egdehags egdehasg
egdehgas egdehgsa egdehsga egdehsag egdeahgs egdeahsg egdeaghs egdeagsh egdeasgh egdeashg egdegahs
egdegash egdeghas egdeghsa egdegsha egdegsah egdesagh egdesahg egdesgah egdesgha egdeshga egdeshag
egdaehgs egdaehsg egdaeghs egdaegsh egdaesgh egdaeshg egdahegs egdahesg egdahges egdahgse egdahsge
egdahseg egdaghes egdaghse egdagehs egdagesh egdagseh egdagshe egdashge egdasheg egdasghe egdasgeh
egdasegh egdasehg egdgeahs egdgeash egdgehas egdgehsa egdgesha egdgesah egdgaehs egdgaesh egdgahes
egdgahse egdgashe egdgaseh egdghaes egdghase egdgheas egdghesa egdghsea egdghsae egdgsahe egdgsaeh
egdgshae egdgshea egdgseha egdgseah egdseagh egdseahg egdsegah egdsegha egdsehga egdsehag egdsaegh
egdsaehg egdsageh egdsaghe egdsahge egdsaheg egdsgaeh egdsgahe egdsgeah egdsgeha egdsghea egdsghae
egdshage egdshaeg egdshgae egdshgea egdshega egdsheag egsheadg egsheagd egshedag egshedga egshegda
egshegad egshaedg egshaegd egshadeg egshadge egshagde egshaged egshdaeg egshdage egshdeag egshdega
egshdgea egshdgae egshgade egshgaed egshgdae egshgdea egshgeda egshgead egsehadg egsehagd egsehdag
egsehdga egsehgda egsehgad egseahdg egseahgd egseadhg egseadgh egseagdh egseaghd egsedahg egsedagh
egsedhag egsedhga egsedgha egsedgah egsegadh egsegahd egsegdah egsegdha egseghda egseghad egsaehdg
egsaehgd egsaedhg egsaedgh egsaegdh egsaeghd egsahedg egsahegd egsahdeg egsahdge egsahgde egsahged
egsadheg egsadhge egsadehg egsadegh egsadgeh egsadghe egsaghde egsaghed egsagdhe egsagdeh egsagedh
egsagehd egsdeahg egsdeagh egsdehag egsdehga egsdegha egsdegah egsdaehg egsdaegh egsdaheg egsdahge
egsdaghe egsdageh egsdhaeg egsdhage egsdheag egsdhega egsdhgea egsdhgae egsdgahe egsdgaeh egsdghae
egsdghea egsdgeha egsdgeah egsgeadh egsgeahd egsgedah egsgedha egsgehda egsgehad egsgaedh egsgaehd
egsgadeh egsgadhe egsgahde egsgahed egsgdaeh egsgdahe egsgdeah egsgdeha egsgdhea egsgdhae egsghade
egsghaed egsghdae egsghdea egsgheda egsghead eggheads eggheasd egghedas egghedsa egghesda egghesad
egghaeds egghaesd egghades egghadse egghasde egghased egghdaes egghdase egghdeas egghdesa egghdsea
egghdsae egghsade egghsaed egghsdae egghsdea egghseda egghsead eggehads eggehasd eggehdas eggehdsa
eggehsda eggehsad eggeahds eggeahsd eggeadhs eggeadsh eggeasdh eggeashd eggedahs eggedash eggedhas
eggedhsa eggedsha eggedsah eggesadh eggesahd eggesdah eggesdha eggeshda eggeshad eggaehds eggaehsd
eggaedhs eggaedsh eggaesdh eggaeshd eggaheds eggahesd eggahdes eggahdse eggahsde eggahsed eggadhes
eggadhse eggadehs eggadesh eggadseh eggadshe eggashde eggashed eggasdhe eggasdeh eggasedh eggasehd
eggdeahs eggdeash eggdehas eggdehsa eggdesha eggdesah eggdaehs eggdaesh eggdahes eggdahse eggdashe
eggdaseh eggdhaes eggdhase eggdheas eggdhesa eggdhsea eggdhsae eggdsahe eggdsaeh eggdshae eggdshea
eggdseha eggdseah eggseadh eggseahd eggsedah eggsedha eggsehda eggsehad eggsaedh eggsaehd eggsadeh
eggsadhe eggsahde eggsahed eggsdaeh eggsdahe eggsdeah eggsdeha eggsdhea eggsdhae eggshade eggshaed
eggshdae eggshdea eggsheda eggshead eghgeads eghgeasd eghgedas eghgedsa eghgesda eghgesad eghgaeds
eghgaesd eghgades eghgadse eghgasde eghgased eghgdaes eghgdase eghgdeas eghgdesa eghgdsea eghgdsae
eghgsade eghgsaed eghgsdae eghgsdea eghgseda eghgsead eghegads eghegasd eghegdas eghegdsa eghegsda
eghegsad egheagds egheagsd egheadgs egheadsg egheasdg egheasgd eghedags eghedasg eghedgas eghedgsa
eghedsga eghedsag eghesadg eghesagd eghesdag eghesdga eghesgda eghesgad eghaegds eghaegsd eghaedgs
eghaedsg eghaesdg eghaesgd eghageds eghagesd eghagdes eghagdse eghagsde eghagsed eghadges eghadgse
eghadegs eghadesg eghadseg eghadsge eghasgde eghasged eghasdge eghasdeg eghasedg eghasegd eghdeags
eghdeasg eghdegas eghdegsa eghdesga eghdesag eghdaegs eghdaesg eghdages eghdagse eghdasge eghdaseg
eghdgaes eghdgase eghdgeas eghdgesa eghdgsea eghdgsae eghdsage eghdsaeg eghdsgae eghdsgea eghdsega
eghdseag eghseadg eghseagd eghsedag eghsedga eghsegda eghsegad eghsaedg eghsaegd eghsadeg eghsadge
eghsagde eghsaged eghsdaeg eghsdage eghsdeag eghsdega eghsdgea eghsdgae eghsgade eghsgaed eghsgdae
eghsgdea eghsgeda eghsgead egehgads egehgasd egehgdas egehgdsa egehgsda egehgsad egehagds egehagsd
egehadgs egehadsg egehasdg egehasgd egehdags egehdasg egehdgas egehdgsa egehdsga egehdsag egehsadg
egehsagd egehsdag egehsdga egehsgda egehsgad egeghads egeghasd egeghdas egeghdsa egeghsda egeghsad
egegahds egegahsd egegadhs egegadsh egegasdh egegashd egegdahs egegdash egegdhas egegdhsa egegdsha
egegdsah egegsadh egegsahd egegsdah egegsdha egegshda egegshad egeaghds egeaghsd egeagdhs egeagdsh
egeagsdh egeagshd egeahgds egeahgsd egeahdgs egeahdsg egeahsdg egeahsgd egeadhgs egeadhsg egeadghs
egeadgsh egeadsgh egeadshg egeashdg egeashgd egeasdhg egeasdgh egeasgdh egeasghd egedgahs egedgash
egedghas egedghsa egedgsha egedgsah egedaghs egedagsh egedahgs egedahsg egedashg egedasgh egedhags
egedhasg egedhgas egedhgsa egedhsga egedhsag egedsahg egedsagh egedshag egedshga egedsgha egedsgah
egesgadh egesgahd egesgdah egesgdha egesghda egesghad egesagdh egesaghd egesadgh egesadhg egesahdg
egesahgd egesdagh egesdahg egesdgah egesdgha egesdhga egesdhag egeshadg egeshagd egeshdag egeshdga
egeshgda egeshgad egahegds egahegsd egahedgs egahedsg egahesdg egahesgd egahgeds egahgesd egahgdes
egahgdse egahgsde egahgsed egahdges egahdgse egahdegs egahdesg egahdseg egahdsge egahsgde egahsged
egahsdge egahsdeg egahsedg egahsegd egaehgds egaehgsd egaehdgs egaehdsg egaehsdg egaehsgd egaeghds
egaeghsd egaegdhs egaegdsh egaegsdh egaegshd egaedghs egaedgsh egaedhgs egaedhsg egaedshg egaedsgh
egaesgdh egaesghd egaesdgh egaesdhg egaeshdg egaeshgd egagehds egagehsd egagedhs egagedsh egagesdh
egageshd egagheds egaghesd egaghdes egaghdse egaghsde egaghsed egagdhes egagdhse egagdehs egagdesh
egagdseh egagdshe egagshde egagshed egagsdhe egagsdeh egagsedh egagsehd egadeghs egadegsh egadehgs
egadehsg egadeshg egadesgh egadgehs egadgesh egadghes egadghse egadgshe egadgseh egadhges egadhgse
egadhegs egadhesg egadhseg egadhsge egadsghe egadsgeh egadshge egadsheg egadsehg egadsegh egasegdh
egaseghd egasedgh egasedhg egasehdg egasehgd egasgedh egasgehd egasgdeh egasgdhe egasghde egasghed
egasdgeh egasdghe egasdegh egasdehg egasdheg egasdhge egashgde egashged egashdge egashdeg egashedg
egashegd egdheags egdheasg egdhegas egdhegsa egdhesga egdhesag egdhaegs egdhaesg egdhages egdhagse
egdhasge egdhaseg egdhgaes egdhgase egdhgeas egdhgesa egdhgsea egdhgsae egdhsage egdhsaeg egdhsgae
egdhsgea egdhsega egdhseag egdehags egdehasg egdehgas egdehgsa egdehsga egdehsag egdeahgs egdeahsg
egdeaghs egdeagsh egdeasgh egdeashg egdegahs egdegash egdeghas egdeghsa egdegsha egdegsah egdesagh
egdesahg egdesgah egdesgha egdeshga egdeshag egdaehgs egdaehsg egdaeghs egdaegsh egdaesgh egdaeshg
egdahegs egdahesg egdahges egdahgse egdahsge egdahseg egdaghes egdaghse egdagehs egdagesh egdagseh
egdagshe egdashge egdasheg egdasghe egdasgeh egdasegh egdasehg egdgeahs egdgeash egdgehas egdgehsa
egdgesha egdgesah egdgaehs egdgaesh egdgahes egdgahse egdgashe egdgaseh egdghaes egdghase egdgheas
egdghesa egdghsea egdghsae egdgsahe egdgsaeh egdgshae egdgshea egdgseha egdgseah egdseagh egdseahg
egdsegah egdsegha egdsehga egdsehag egdsaegh egdsaehg egdsageh egdsaghe egdsahge egdsaheg egdsgaeh
egdsgahe egdsgeah egdsgeha egdsghea egdsghae egdshage egdshaeg egdshgae egdshgea egdshega egdsheag
egsheadg egsheagd egshedag egshedga egshegda egshegad egshaedg egshaegd egshadeg egshadge egshagde
egshaged egshdaeg egshdage egshdeag egshdega egshdgea egshdgae egshgade egshgaed egshgdae egshgdea
egshgeda egshgead egsehadg egsehagd egsehdag egsehdga egsehgda egsehgad egseahdg egseahgd egseadhg
egseadgh egseagdh egseaghd egsedahg egsedagh egsedhag egsedhga egsedgha egsedgah egsegadh egsegahd
egsegdah egsegdha egseghda egseghad egsaehdg egsaehgd egsaedhg egsaedgh egsaegdh egsaeghd egsahedg
egsahegd egsahdeg egsahdge egsahgde egsahged egsadheg egsadhge egsadehg egsadegh egsadgeh egsadghe
egsaghde egsaghed egsagdhe egsagdeh egsagedh egsagehd egsdeahg egsdeagh egsdehag egsdehga egsdegha
egsdegah egsdaehg egsdaegh egsdaheg egsdahge egsdaghe egsdageh egsdhaeg egsdhage egsdheag egsdhega
egsdhgea egsdhgae egsdgahe egsdgaeh egsdghae egsdghea egsdgeha egsdgeah egsgeadh egsgeahd egsgedah
egsgedha egsgehda egsgehad egsgaedh egsgaehd egsgadeh egsgadhe egsgahde egsgahed egsgdaeh egsgdahe
egsgdeah egsgdeha egsgdhea egsgdhae egsghade egsghaed egsghdae egsghdea egsgheda egsghead ehggeads
ehggeasd ehggedas ehggedsa ehggesda ehggesad ehggaeds ehggaesd ehggades ehggadse ehggasde ehggased
ehggdaes ehggdase ehggdeas ehggdesa ehggdsea ehggdsae ehggsade ehggsaed ehggsdae ehggsdea ehggseda
ehggsead ehgegads ehgegasd ehgegdas ehgegdsa ehgegsda ehgegsad ehgeagds ehgeagsd ehgeadgs ehgeadsg
ehgeasdg ehgeasgd ehgedags ehgedasg ehgedgas ehgedgsa ehgedsga ehgedsag ehgesadg ehgesagd ehgesdag
ehgesdga ehgesgda ehgesgad ehgaegds ehgaegsd ehgaedgs ehgaedsg ehgaesdg ehgaesgd ehgageds ehgagesd
ehgagdes ehgagdse ehgagsde ehgagsed ehgadges ehgadgse ehgadegs ehgadesg ehgadseg ehgadsge ehgasgde
ehgasged ehgasdge ehgasdeg ehgasedg ehgasegd ehgdeags ehgdeasg ehgdegas ehgdegsa ehgdesga ehgdesag
ehgdaegs ehgdaesg ehgdages ehgdagse ehgdasge ehgdaseg ehgdgaes ehgdgase ehgdgeas ehgdgesa ehgdgsea
ehgdgsae ehgdsage ehgdsaeg ehgdsgae ehgdsgea ehgdsega ehgdseag ehgseadg ehgseagd ehgsedag ehgsedga
ehgsegda ehgsegad ehgsaedg ehgsaegd ehgsadeg ehgsadge ehgsagde ehgsaged ehgsdaeg ehgsdage ehgsdeag
ehgsdega ehgsdgea ehgsdgae ehgsgade ehgsgaed ehgsgdae ehgsgdea ehgsgeda ehgsgead ehggeads ehggeasd
ehggedas ehggedsa ehggesda ehggesad ehggaeds ehggaesd ehggades ehggadse ehggasde ehggased ehggdaes
ehggdase ehggdeas ehggdesa ehggdsea ehggdsae ehggsade ehggsaed ehggsdae ehggsdea ehggseda ehggsead
ehgegads ehgegasd ehgegdas ehgegdsa ehgegsda ehgegsad ehgeagds ehgeagsd ehgeadgs ehgeadsg ehgeasdg
ehgeasgd ehgedags ehgedasg ehgedgas ehgedgsa ehgedsga ehgedsag ehgesadg ehgesagd ehgesdag ehgesdga
ehgesgda ehgesgad ehgaegds ehgaegsd ehgaedgs ehgaedsg ehgaesdg ehgaesgd ehgageds ehgagesd ehgagdes
ehgagdse ehgagsde ehgagsed ehgadges ehgadgse ehgadegs ehgadesg ehgadseg ehgadsge ehgasgde ehgasged
ehgasdge ehgasdeg ehgasedg ehgasegd ehgdeags ehgdeasg ehgdegas ehgdegsa ehgdesga ehgdesag ehgdaegs
ehgdaesg ehgdages ehgdagse ehgdasge ehgdaseg ehgdgaes ehgdgase ehgdgeas ehgdgesa ehgdgsea ehgdgsae
ehgdsage ehgdsaeg ehgdsgae ehgdsgea ehgdsega ehgdseag ehgseadg ehgseagd ehgsedag ehgsedga ehgsegda
ehgsegad ehgsaedg ehgsaegd ehgsadeg ehgsadge ehgsagde ehgsaged ehgsdaeg ehgsdage ehgsdeag ehgsdega
ehgsdgea ehgsdgae ehgsgade ehgsgaed ehgsgdae ehgsgdea ehgsgeda ehgsgead eheggads eheggasd eheggdas
eheggdsa eheggsda eheggsad ehegagds ehegagsd ehegadgs ehegadsg ehegasdg ehegasgd ehegdags ehegdasg
ehegdgas ehegdgsa ehegdsga ehegdsag ehegsadg ehegsagd ehegsdag ehegsdga ehegsgda ehegsgad eheggads
eheggasd eheggdas eheggdsa eheggsda eheggsad ehegagds ehegagsd ehegadgs ehegadsg ehegasdg ehegasgd
ehegdags ehegdasg ehegdgas ehegdgsa ehegdsga ehegdsag ehegsadg ehegsagd ehegsdag ehegsdga ehegsgda
ehegsgad eheaggds eheaggsd eheagdgs eheagdsg eheagsdg eheagsgd eheaggds eheaggsd eheagdgs eheagdsg
eheagsdg eheagsgd eheadggs eheadgsg eheadggs eheadgsg eheadsgg eheadsgg eheasgdg eheasggd eheasdgg
eheasdgg eheasgdg eheasggd ehedgags ehedgasg ehedggas ehedggsa ehedgsga ehedgsag ehedaggs ehedagsg
ehedaggs ehedagsg ehedasgg ehedasgg ehedgags ehedgasg ehedggas ehedggsa ehedgsga ehedgsag ehedsagg
ehedsagg ehedsgag ehedsgga ehedsgga ehedsgag ehesgadg ehesgagd ehesgdag ehesgdga ehesggda ehesggad
ehesagdg ehesaggd ehesadgg ehesadgg ehesagdg ehesaggd ehesdagg ehesdagg ehesdgag ehesdgga ehesdgga
ehesdgag ehesgadg ehesgagd ehesgdag ehesgdga ehesggda ehesggad ehagegds ehagegsd ehagedgs ehagedsg
ehagesdg ehagesgd ehaggeds ehaggesd ehaggdes ehaggdse ehaggsde ehaggsed ehagdges ehagdgse ehagdegs
ehagdesg ehagdseg ehagdsge ehagsgde ehagsged ehagsdge ehagsdeg ehagsedg ehagsegd ehaeggds ehaeggsd
ehaegdgs ehaegdsg ehaegsdg ehaegsgd ehaeggds ehaeggsd ehaegdgs ehaegdsg ehaegsdg ehaegsgd ehaedggs
ehaedgsg ehaedggs ehaedgsg ehaedsgg ehaedsgg ehaesgdg ehaesggd ehaesdgg ehaesdgg ehaesgdg ehaesggd
ehagegds ehagegsd ehagedgs ehagedsg ehagesdg ehagesgd ehaggeds ehaggesd ehaggdes ehaggdse ehaggsde
ehaggsed ehagdges ehagdgse ehagdegs ehagdesg ehagdseg ehagdsge ehagsgde ehagsged ehagsdge ehagsdeg
ehagsedg ehagsegd ehadeggs ehadegsg ehadeggs ehadegsg ehadesgg ehadesgg ehadgegs ehadgesg ehadgges
ehadggse ehadgsge ehadgseg ehadgges ehadggse ehadgegs ehadgesg ehadgseg ehadgsge ehadsgge ehadsgeg
ehadsgge ehadsgeg ehadsegg ehadsegg ehasegdg ehaseggd ehasedgg ehasedgg ehasegdg ehaseggd ehasgedg
ehasgegd ehasgdeg ehasgdge ehasggde ehasgged ehasdgeg ehasdgge ehasdegg ehasdegg ehasdgeg ehasdgge
ehasggde ehasgged ehasgdge ehasgdeg ehasgedg ehasgegd ehdgeags ehdgeasg ehdgegas ehdgegsa ehdgesga
ehdgesag ehdgaegs ehdgaesg ehdgages ehdgagse ehdgasge ehdgaseg ehdggaes ehdggase ehdggeas ehdggesa
ehdggsea ehdggsae ehdgsage ehdgsaeg ehdgsgae ehdgsgea ehdgsega ehdgseag ehdegags ehdegasg ehdeggas
ehdeggsa ehdegsga ehdegsag ehdeaggs ehdeagsg ehdeaggs ehdeagsg ehdeasgg ehdeasgg ehdegags ehdegasg
ehdeggas ehdeggsa ehdegsga ehdegsag ehdesagg ehdesagg ehdesgag ehdesgga ehdesgga ehdesgag ehdaeggs
ehdaegsg ehdaeggs ehdaegsg ehdaesgg ehdaesgg ehdagegs ehdagesg ehdagges ehdaggse ehdagsge ehdagseg
ehdagges ehdaggse ehdagegs ehdagesg ehdagseg ehdagsge ehdasgge ehdasgeg ehdasgge ehdasgeg ehdasegg
ehdasegg ehdgeags ehdgeasg ehdgegas ehdgegsa ehdgesga ehdgesag ehdgaegs ehdgaesg ehdgages ehdgagse
ehdgasge ehdgaseg ehdggaes ehdggase ehdggeas ehdggesa ehdggsea ehdggsae ehdgsage ehdgsaeg ehdgsgae
ehdgsgea ehdgsega ehdgseag ehdseagg ehdseagg ehdsegag ehdsegga ehdsegga ehdsegag ehdsaegg ehdsaegg
ehdsageg ehdsagge ehdsagge ehdsageg ehdsgaeg ehdsgage ehdsgeag ehdsgega ehdsggea ehdsggae ehdsgage
ehdsgaeg ehdsggae ehdsggea ehdsgega ehdsgeag ehsgeadg ehsgeagd ehsgedag ehsgedga ehsgegda ehsgegad
ehsgaedg ehsgaegd ehsgadeg ehsgadge ehsgagde ehsgaged ehsgdaeg ehsgdage ehsgdeag ehsgdega ehsgdgea
ehsgdgae ehsggade ehsggaed ehsggdae ehsggdea ehsggeda ehsggead ehsegadg ehsegagd ehsegdag ehsegdga
ehseggda ehseggad ehseagdg ehseaggd ehseadgg ehseadgg ehseagdg ehseaggd ehsedagg ehsedagg ehsedgag
ehsedgga ehsedgga ehsedgag ehsegadg ehsegagd ehsegdag ehsegdga ehseggda ehseggad ehsaegdg ehsaeggd
ehsaedgg ehsaedgg ehsaegdg ehsaeggd ehsagedg ehsagegd ehsagdeg ehsagdge ehsaggde ehsagged ehsadgeg
ehsadgge ehsadegg ehsadegg ehsadgeg ehsadgge ehsaggde ehsagged ehsagdge ehsagdeg ehsagedg ehsagegd
ehsdeagg ehsdeagg ehsdegag ehsdegga ehsdegga ehsdegag ehsdaegg ehsdaegg ehsdageg ehsdagge ehsdagge
ehsdageg ehsdgaeg ehsdgage ehsdgeag ehsdgega ehsdggea ehsdggae ehsdgage ehsdgaeg ehsdggae ehsdggea
ehsdgega ehsdgeag ehsgeadg ehsgeagd ehsgedag ehsgedga ehsgegda ehsgegad ehsgaedg ehsgaegd ehsgadeg
ehsgadge ehsgagde ehsgaged ehsgdaeg ehsgdage ehsgdeag ehsgdega ehsgdgea ehsgdgae ehsggade ehsggaed
ehsggdae ehsggdea ehsggeda ehsggead eeghgads eeghgasd eeghgdas eeghgdsa eeghgsda eeghgsad eeghagds
eeghagsd eeghadgs eeghadsg eeghasdg eeghasgd eeghdags eeghdasg eeghdgas eeghdgsa eeghdsga eeghdsag
eeghsadg eeghsagd eeghsdag eeghsdga eeghsgda eeghsgad eegghads eegghasd eegghdas eegghdsa eegghsda
eegghsad eeggahds eeggahsd eeggadhs eeggadsh eeggasdh eeggashd eeggdahs eeggdash eeggdhas eeggdhsa
eeggdsha eeggdsah eeggsadh eeggsahd eeggsdah eeggsdha eeggshda eeggshad eegaghds eegaghsd eegagdhs
eegagdsh eegagsdh eegagshd eegahgds eegahgsd eegahdgs eegahdsg eegahsdg eegahsgd eegadhgs eegadhsg
eegadghs eegadgsh eegadsgh eegadshg eegashdg eegashgd eegasdhg eegasdgh eegasgdh eegasghd eegdgahs
eegdgash eegdghas eegdghsa eegdgsha eegdgsah eegdaghs eegdagsh eegdahgs eegdahsg eegdashg eegdasgh
eegdhags eegdhasg eegdhgas eegdhgsa eegdhsga eegdhsag eegdsahg eegdsagh eegdshag eegdshga eegdsgha
eegdsgah eegsgadh eegsgahd eegsgdah eegsgdha eegsghda eegsghad eegsagdh eegsaghd eegsadgh eegsadhg
eegsahdg eegsahgd eegsdagh eegsdahg eegsdgah eegsdgha eegsdhga eegsdhag eegshadg eegshagd eegshdag
eegshdga eegshgda eegshgad eehggads eehggasd eehggdas eehggdsa eehggsda eehggsad eehgagds eehgagsd
eehgadgs eehgadsg eehgasdg eehgasgd eehgdags eehgdasg eehgdgas eehgdgsa eehgdsga eehgdsag eehgsadg
eehgsagd eehgsdag eehgsdga eehgsgda eehgsgad eehggads eehggasd eehggdas eehggdsa eehggsda eehggsad
eehgagds eehgagsd eehgadgs eehgadsg eehgasdg eehgasgd eehgdags eehgdasg eehgdgas eehgdgsa eehgdsga
eehgdsag eehgsadg eehgsagd eehgsdag eehgsdga eehgsgda eehgsgad eehaggds eehaggsd eehagdgs eehagdsg
eehagsdg eehagsgd eehaggds eehaggsd eehagdgs eehagdsg eehagsdg eehagsgd eehadggs eehadgsg eehadggs
eehadgsg eehadsgg eehadsgg eehasgdg eehasggd eehasdgg eehasdgg eehasgdg eehasggd eehdgags eehdgasg
eehdggas eehdggsa eehdgsga eehdgsag eehdaggs eehdagsg eehdaggs eehdagsg eehdasgg eehdasgg eehdgags
eehdgasg eehdggas eehdggsa eehdgsga eehdgsag eehdsagg eehdsagg eehdsgag eehdsgga eehdsgga eehdsgag
eehsgadg eehsgagd eehsgdag eehsgdga eehsggda eehsggad eehsagdg eehsaggd eehsadgg eehsadgg eehsagdg
eehsaggd eehsdagg eehsdagg eehsdgag eehsdgga eehsdgga eehsdgag eehsgadg eehsgagd eehsgdag eehsgdga
eehsggda eehsggad eeghgads eeghgasd eeghgdas eeghgdsa eeghgsda eeghgsad eeghagds eeghagsd eeghadgs
eeghadsg eeghasdg eeghasgd eeghdags eeghdasg eeghdgas eeghdgsa eeghdsga eeghdsag eeghsadg eeghsagd
eeghsdag eeghsdga eeghsgda eeghsgad eegghads eegghasd eegghdas eegghdsa eegghsda eegghsad eeggahds
eeggahsd eeggadhs eeggadsh eeggasdh eeggashd eeggdahs eeggdash eeggdhas eeggdhsa eeggdsha eeggdsah
eeggsadh eeggsahd eeggsdah eeggsdha eeggshda eeggshad eegaghds eegaghsd eegagdhs eegagdsh eegagsdh
eegagshd eegahgds eegahgsd eegahdgs eegahdsg eegahsdg eegahsgd eegadhgs eegadhsg eegadghs eegadgsh
eegadsgh eegadshg eegashdg eegashgd eegasdhg eegasdgh eegasgdh eegasghd eegdgahs eegdgash eegdghas
eegdghsa eegdgsha eegdgsah eegdaghs eegdagsh eegdahgs eegdahsg eegdashg eegdasgh eegdhags eegdhasg
eegdhgas eegdhgsa eegdhsga eegdhsag eegdsahg eegdsagh eegdshag eegdshga eegdsgha eegdsgah eegsgadh
eegsgahd eegsgdah eegsgdha eegsghda eegsghad eegsagdh eegsaghd eegsadgh eegsadhg eegsahdg eegsahgd
eegsdagh eegsdahg eegsdgah eegsdgha eegsdhga eegsdhag eegshadg eegshagd eegshdag eegshdga eegshgda
eegshgad eeahggds eeahggsd eeahgdgs eeahgdsg eeahgsdg eeahgsgd eeahggds eeahggsd eeahgdgs eeahgdsg
eeahgsdg eeahgsgd eeahdggs eeahdgsg eeahdggs eeahdgsg eeahdsgg eeahdsgg eeahsgdg eeahsggd eeahsdgg
eeahsdgg eeahsgdg eeahsggd eeaghgds eeaghgsd eeaghdgs eeaghdsg eeaghsdg eeaghsgd eeagghds eeagghsd
eeaggdhs eeaggdsh eeaggsdh eeaggshd eeagdghs eeagdgsh eeagdhgs eeagdhsg eeagdshg eeagdsgh eeagsgdh
eeagsghd eeagsdgh eeagsdhg eeagshdg eeagshgd eeagghds eeagghsd eeaggdhs eeaggdsh eeaggsdh eeaggshd
eeaghgds eeaghgsd eeaghdgs eeaghdsg eeaghsdg eeaghsgd eeagdhgs eeagdhsg eeagdghs eeagdgsh eeagdsgh
eeagdshg eeagshdg eeagshgd eeagsdhg eeagsdgh eeagsgdh eeagsghd eeadgghs eeadggsh eeadghgs eeadghsg
eeadgshg eeadgsgh eeadgghs eeadggsh eeadghgs eeadghsg eeadgshg eeadgsgh eeadhggs eeadhgsg eeadhggs
eeadhgsg eeadhsgg eeadhsgg eeadsghg eeadsggh eeadshgg eeadshgg eeadsghg eeadsggh eeasggdh eeasgghd
eeasgdgh eeasgdhg eeasghdg eeasghgd eeasggdh eeasgghd eeasgdgh eeasgdhg eeasghdg eeasghgd eeasdggh
eeasdghg eeasdggh eeasdghg eeasdhgg eeasdhgg eeashgdg eeashggd eeashdgg eeashdgg eeashgdg eeashggd
eedhgags eedhgasg eedhggas eedhggsa eedhgsga eedhgsag eedhaggs eedhagsg eedhaggs eedhagsg eedhasgg
eedhasgg eedhgags eedhgasg eedhggas eedhggsa eedhgsga eedhgsag eedhsagg eedhsagg eedhsgag eedhsgga
eedhsgga eedhsgag eedghags eedghasg eedghgas eedghgsa eedghsga eedghsag eedgahgs eedgahsg eedgaghs
eedgagsh eedgasgh eedgashg eedggahs eedggash eedgghas eedgghsa eedggsha eedggsah eedgsagh eedgsahg
eedgsgah eedgsgha eedgshga eedgshag eedaghgs eedaghsg eedagghs eedaggsh eedagsgh eedagshg eedahggs
eedahgsg eedahggs eedahgsg eedahsgg eedahsgg eedaghgs eedaghsg eedagghs eedaggsh eedagsgh eedagshg
eedashgg eedashgg eedasghg eedasggh eedasggh eedasghg eedggahs eedggash eedgghas eedgghsa eedggsha
eedggsah eedgaghs eedgagsh eedgahgs eedgahsg eedgashg eedgasgh eedghags eedghasg eedghgas eedghgsa
eedghsga eedghsag eedgsahg eedgsagh eedgshag eedgshga eedgsgha eedgsgah eedsgagh eedsgahg eedsggah
eedsggha eedsghga eedsghag eedsaggh eedsaghg eedsaggh eedsaghg eedsahgg eedsahgg eedsgagh eedsgahg
eedsggah eedsggha eedsghga eedsghag eedshagg eedshagg eedshgag eedshgga eedshgga eedshgag eeshgadg
eeshgagd eeshgdag eeshgdga eeshggda eeshggad eeshagdg eeshaggd eeshadgg eeshadgg eeshagdg eeshaggd
eeshdagg eeshdagg eeshdgag eeshdgga eeshdgga eeshdgag eeshgadg eeshgagd eeshgdag eeshgdga eeshggda
eeshggad eesghadg eesghagd eesghdag eesghdga eesghgda eesghgad eesgahdg eesgahgd eesgadhg eesgadgh
eesgagdh eesgaghd eesgdahg eesgdagh eesgdhag eesgdhga eesgdgha eesgdgah eesggadh eesggahd eesggdah
eesggdha eesgghda eesgghad eesaghdg eesaghgd eesagdhg eesagdgh eesaggdh eesagghd eesahgdg eesahggd
eesahdgg eesahdgg eesahgdg eesahggd eesadhgg eesadhgg eesadghg eesadggh eesadggh eesadghg eesaghdg
eesaghgd eesagdhg eesagdgh eesaggdh eesagghd eesdgahg eesdgagh eesdghag eesdghga eesdggha eesdggah
eesdaghg eesdaggh eesdahgg eesdahgg eesdaghg eesdaggh eesdhagg eesdhagg eesdhgag eesdhgga eesdhgga
eesdhgag eesdgahg eesdgagh eesdghag eesdghga eesdggha eesdggah eesggadh eesggahd eesggdah eesggdha
eesgghda eesgghad eesgagdh eesgaghd eesgadgh eesgadhg eesgahdg eesgahgd eesgdagh eesgdahg eesgdgah
eesgdgha eesgdhga eesgdhag eesghadg eesghagd eesghdag eesghdga eesghgda eesghgad eaghegds eaghegsd
eaghedgs eaghedsg eaghesdg eaghesgd eaghgeds eaghgesd eaghgdes eaghgdse eaghgsde eaghgsed eaghdges
eaghdgse eaghdegs eaghdesg eaghdseg eaghdsge eaghsgde eaghsged eaghsdge eaghsdeg eaghsedg eaghsegd
eagehgds eagehgsd eagehdgs eagehdsg eagehsdg eagehsgd eageghds eageghsd eagegdhs eagegdsh eagegsdh
eagegshd eagedghs eagedgsh eagedhgs eagedhsg eagedshg eagedsgh eagesgdh eagesghd eagesdgh eagesdhg
eageshdg eageshgd eaggehds eaggehsd eaggedhs eaggedsh eaggesdh eaggeshd eaggheds eagghesd eagghdes
eagghdse eagghsde eagghsed eaggdhes eaggdhse eaggdehs eaggdesh eaggdseh eaggdshe eaggshde eaggshed
eaggsdhe eaggsdeh eaggsedh eaggsehd eagdeghs eagdegsh eagdehgs eagdehsg eagdeshg eagdesgh eagdgehs
eagdgesh eagdghes eagdghse eagdgshe eagdgseh eagdhges eagdhgse eagdhegs eagdhesg eagdhseg eagdhsge
eagdsghe eagdsgeh eagdshge eagdsheg eagdsehg eagdsegh eagsegdh eagseghd eagsedgh eagsedhg eagsehdg
eagsehgd eagsgedh eagsgehd eagsgdeh eagsgdhe eagsghde eagsghed eagsdgeh eagsdghe eagsdegh eagsdehg
eagsdheg eagsdhge eagshgde eagshged eagshdge eagshdeg eagshedg eagshegd eahgegds eahgegsd eahgedgs
eahgedsg eahgesdg eahgesgd eahggeds eahggesd eahggdes eahggdse eahggsde eahggsed eahgdges eahgdgse
eahgdegs eahgdesg eahgdseg eahgdsge eahgsgde eahgsged eahgsdge eahgsdeg eahgsedg eahgsegd eaheggds
eaheggsd eahegdgs eahegdsg eahegsdg eahegsgd eaheggds eaheggsd eahegdgs eahegdsg eahegsdg eahegsgd
eahedggs eahedgsg eahedggs eahedgsg eahedsgg eahedsgg eahesgdg eahesggd eahesdgg eahesdgg eahesgdg
eahesggd eahgegds eahgegsd eahgedgs eahgedsg eahgesdg eahgesgd eahggeds eahggesd eahggdes eahggdse
eahggsde eahggsed eahgdges eahgdgse eahgdegs eahgdesg eahgdseg eahgdsge eahgsgde eahgsged eahgsdge
eahgsdeg eahgsedg eahgsegd eahdeggs eahdegsg eahdeggs eahdegsg eahdesgg eahdesgg eahdgegs eahdgesg
eahdgges eahdggse eahdgsge eahdgseg eahdgges eahdggse eahdgegs eahdgesg eahdgseg eahdgsge eahdsgge
eahdsgeg eahdsgge eahdsgeg eahdsegg eahdsegg eahsegdg eahseggd eahsedgg eahsedgg eahsegdg eahseggd
eahsgedg eahsgegd eahsgdeg eahsgdge eahsggde eahsgged eahsdgeg eahsdgge eahsdegg eahsdegg eahsdgeg
eahsdgge eahsggde eahsgged eahsgdge eahsgdeg eahsgedg eahsgegd eaehggds eaehggsd eaehgdgs eaehgdsg
eaehgsdg eaehgsgd eaehggds eaehggsd eaehgdgs eaehgdsg eaehgsdg eaehgsgd eaehdggs eaehdgsg eaehdggs
eaehdgsg eaehdsgg eaehdsgg eaehsgdg eaehsggd eaehsdgg eaehsdgg eaehsgdg eaehsggd eaeghgds eaeghgsd
eaeghdgs eaeghdsg eaeghsdg eaeghsgd eaegghds eaegghsd eaeggdhs eaeggdsh eaeggsdh eaeggshd eaegdghs
eaegdgsh eaegdhgs eaegdhsg eaegdshg eaegdsgh eaegsgdh eaegsghd eaegsdgh eaegsdhg eaegshdg eaegshgd
eaegghds eaegghsd eaeggdhs eaeggdsh eaeggsdh eaeggshd eaeghgds eaeghgsd eaeghdgs eaeghdsg eaeghsdg
eaeghsgd eaegdhgs eaegdhsg eaegdghs eaegdgsh eaegdsgh eaegdshg eaegshdg eaegshgd eaegsdhg eaegsdgh
eaegsgdh eaegsghd eaedgghs eaedggsh eaedghgs eaedghsg eaedgshg eaedgsgh eaedgghs eaedggsh eaedghgs
eaedghsg eaedgshg eaedgsgh eaedhggs eaedhgsg eaedhggs eaedhgsg eaedhsgg eaedhsgg eaedsghg eaedsggh
eaedshgg eaedshgg eaedsghg eaedsggh eaesggdh eaesgghd eaesgdgh eaesgdhg eaesghdg eaesghgd eaesggdh
eaesgghd eaesgdgh eaesgdhg eaesghdg eaesghgd eaesdggh eaesdghg eaesdggh eaesdghg eaesdhgg eaesdhgg
eaeshgdg eaeshggd eaeshdgg eaeshdgg eaeshgdg eaeshggd eaghegds eaghegsd eaghedgs eaghedsg eaghesdg
eaghesgd eaghgeds eaghgesd eaghgdes eaghgdse eaghgsde eaghgsed eaghdges eaghdgse eaghdegs eaghdesg
eaghdseg eaghdsge eaghsgde eaghsged eaghsdge eaghsdeg eaghsedg eaghsegd eagehgds eagehgsd eagehdgs
eagehdsg eagehsdg eagehsgd eageghds eageghsd eagegdhs eagegdsh eagegsdh eagegshd eagedghs eagedgsh
eagedhgs eagedhsg eagedshg eagedsgh eagesgdh eagesghd eagesdgh eagesdhg eageshdg eageshgd eaggehds
eaggehsd eaggedhs eaggedsh eaggesdh eaggeshd eaggheds eagghesd eagghdes eagghdse eagghsde eagghsed
eaggdhes eaggdhse eaggdehs eaggdesh eaggdseh eaggdshe eaggshde eaggshed eaggsdhe eaggsdeh eaggsedh
eaggsehd eagdeghs eagdegsh eagdehgs eagdehsg eagdeshg eagdesgh eagdgehs eagdgesh eagdghes eagdghse
eagdgshe eagdgseh eagdhges eagdhgse eagdhegs eagdhesg eagdhseg eagdhsge eagdsghe eagdsgeh eagdshge
eagdsheg eagdsehg eagdsegh eagsegdh eagseghd eagsedgh eagsedhg eagsehdg eagsehgd eagsgedh eagsgehd
eagsgdeh eagsgdhe eagsghde eagsghed eagsdgeh eagsdghe eagsdegh eagsdehg eagsdheg eagsdhge eagshgde
eagshged eagshdge eagshdeg eagshedg eagshegd eadheggs eadhegsg eadheggs eadhegsg eadhesgg eadhesgg
eadhgegs eadhgesg eadhgges eadhggse eadhgsge eadhgseg eadhgges eadhggse eadhgegs eadhgesg eadhgseg
eadhgsge eadhsgge eadhsgeg eadhsgge eadhsgeg eadhsegg eadhsegg eadehggs eadehgsg eadehggs eadehgsg
eadehsgg eadehsgg eadeghgs eadeghsg eadegghs eadeggsh eadegsgh eadegshg eadegghs eadeggsh eadeghgs
eadeghsg eadegshg eadegsgh eadesggh eadesghg eadesggh eadesghg eadeshgg eadeshgg eadgehgs eadgehsg
eadgeghs eadgegsh eadgesgh eadgeshg eadghegs eadghesg eadghges eadghgse eadghsge eadghseg eadgghes
eadgghse eadggehs eadggesh eadggseh eadggshe eadgshge eadgsheg eadgsghe eadgsgeh eadgsegh eadgsehg
eadgeghs eadgegsh eadgehgs eadgehsg eadgeshg eadgesgh eadggehs eadggesh eadgghes eadgghse eadggshe
eadggseh eadghges eadghgse eadghegs eadghesg eadghseg eadghsge eadgsghe eadgsgeh eadgshge eadgsheg
eadgsehg eadgsegh eadseggh eadseghg eadseggh eadseghg eadsehgg eadsehgg eadsgegh eadsgehg eadsggeh
eadsgghe eadsghge eadsgheg eadsggeh eadsgghe eadsgegh eadsgehg eadsgheg eadsghge eadshgge eadshgeg
eadshgge eadshgeg eadshegg eadshegg eashegdg easheggd eashedgg eashedgg eashegdg easheggd eashgedg
eashgegd eashgdeg eashgdge eashggde eashgged eashdgeg eashdgge eashdegg eashdegg eashdgeg eashdgge
eashggde eashgged eashgdge eashgdeg eashgedg eashgegd easehgdg easehggd easehdgg easehdgg easehgdg
easehggd easeghdg easeghgd easegdhg easegdgh easeggdh easegghd easedghg easedggh easedhgg easedhgg
easedghg easedggh easeggdh easegghd easegdgh easegdhg easeghdg easeghgd easgehdg easgehgd easgedhg
easgedgh easgegdh easgeghd easghedg easghegd easghdeg easghdge easghgde easghged easgdheg easgdhge
easgdehg easgdegh easgdgeh easgdghe easgghde easgghed easggdhe easggdeh easggedh easggehd easdeghg
easdeggh easdehgg easdehgg easdeghg easdeggh easdgehg easdgegh easdgheg easdghge easdgghe easdggeh
easdhgeg easdhgge easdhegg easdhegg easdhgeg easdhgge easdgghe easdggeh easdghge easdgheg easdgehg
easdgegh easgegdh easgeghd easgedgh easgedhg easgehdg easgehgd easggedh easggehd easggdeh easggdhe
easgghde easgghed easgdgeh easgdghe easgdegh easgdehg easgdheg easgdhge easghgde easghged easghdge
easghdeg easghedg easghegd edgheags edgheasg edghegas edghegsa edghesga edghesag edghaegs edghaesg
edghages edghagse edghasge edghaseg edghgaes edghgase edghgeas edghgesa edghgsea edghgsae edghsage
edghsaeg edghsgae edghsgea edghsega edghseag edgehags edgehasg edgehgas edgehgsa edgehsga edgehsag
edgeahgs edgeahsg edgeaghs edgeagsh edgeasgh edgeashg edgegahs edgegash edgeghas edgeghsa edgegsha
edgegsah edgesagh edgesahg edgesgah edgesgha edgeshga edgeshag edgaehgs edgaehsg edgaeghs edgaegsh
edgaesgh edgaeshg edgahegs edgahesg edgahges edgahgse edgahsge edgahseg edgaghes edgaghse edgagehs
edgagesh edgagseh edgagshe edgashge edgasheg edgasghe edgasgeh edgasegh edgasehg edggeahs edggeash
edggehas edggehsa edggesha edggesah edggaehs edggaesh edggahes edggahse edggashe edggaseh edgghaes
edgghase edggheas edgghesa edgghsea edgghsae edggsahe edggsaeh edggshae edggshea edggseha edggseah
edgseagh edgseahg edgsegah edgsegha edgsehga edgsehag edgsaegh edgsaehg edgsageh edgsaghe edgsahge
edgsaheg edgsgaeh edgsgahe edgsgeah edgsgeha edgsghea edgsghae edgshage edgshaeg edgshgae edgshgea
edgshega edgsheag edhgeags edhgeasg edhgegas edhgegsa edhgesga edhgesag edhgaegs edhgaesg edhgages
edhgagse edhgasge edhgaseg edhggaes edhggase edhggeas edhggesa edhggsea edhggsae edhgsage edhgsaeg
edhgsgae edhgsgea edhgsega edhgseag edhegags edhegasg edheggas edheggsa edhegsga edhegsag edheaggs
edheagsg edheaggs edheagsg edheasgg edheasgg edhegags edhegasg edheggas edheggsa edhegsga edhegsag
edhesagg edhesagg edhesgag edhesgga edhesgga edhesgag edhaeggs edhaegsg edhaeggs edhaegsg edhaesgg
edhaesgg edhagegs edhagesg edhagges edhaggse edhagsge edhagseg edhagges edhaggse edhagegs edhagesg
edhagseg edhagsge edhasgge edhasgeg edhasgge edhasgeg edhasegg edhasegg edhgeags edhgeasg edhgegas
edhgegsa edhgesga edhgesag edhgaegs edhgaesg edhgages edhgagse edhgasge edhgaseg edhggaes edhggase
edhggeas edhggesa edhggsea edhggsae edhgsage edhgsaeg edhgsgae edhgsgea edhgsega edhgseag edhseagg
edhseagg edhsegag edhsegga edhsegga edhsegag edhsaegg edhsaegg edhsageg edhsagge edhsagge edhsageg
edhsgaeg edhsgage edhsgeag edhsgega edhsggea edhsggae edhsgage edhsgaeg edhsggae edhsggea edhsgega
edhsgeag edehgags edehgasg edehggas edehggsa edehgsga edehgsag edehaggs edehagsg edehaggs edehagsg
edehasgg edehasgg edehgags edehgasg edehggas edehggsa edehgsga edehgsag edehsagg edehsagg edehsgag
edehsgga edehsgga edehsgag edeghags edeghasg edeghgas edeghgsa edeghsga edeghsag edegahgs edegahsg
edegaghs edegagsh edegasgh edegashg edeggahs edeggash edegghas edegghsa edeggsha edeggsah edegsagh
edegsahg edegsgah edegsgha edegshga edegshag edeaghgs edeaghsg edeagghs edeaggsh edeagsgh edeagshg
edeahggs edeahgsg edeahggs edeahgsg edeahsgg edeahsgg edeaghgs edeaghsg edeagghs edeaggsh edeagsgh
edeagshg edeashgg edeashgg edeasghg edeasggh edeasggh edeasghg edeggahs edeggash edegghas edegghsa
edeggsha edeggsah edegaghs edegagsh edegahgs edegahsg edegashg edegasgh edeghags edeghasg edeghgas
edeghgsa edeghsga edeghsag edegsahg edegsagh edegshag edegshga edegsgha edegsgah edesgagh edesgahg
edesggah edesggha edesghga edesghag edesaggh edesaghg edesaggh edesaghg edesahgg edesahgg edesgagh
edesgahg edesggah edesggha edesghga edesghag edeshagg edeshagg edeshgag edeshgga edeshgga edeshgag
edaheggs edahegsg edaheggs edahegsg edahesgg edahesgg edahgegs edahgesg edahgges edahggse edahgsge
edahgseg edahgges edahggse edahgegs edahgesg edahgseg edahgsge edahsgge edahsgeg edahsgge edahsgeg
edahsegg edahsegg edaehggs edaehgsg edaehggs edaehgsg edaehsgg edaehsgg edaeghgs edaeghsg edaegghs
edaeggsh edaegsgh edaegshg edaegghs edaeggsh edaeghgs edaeghsg edaegshg edaegsgh edaesggh edaesghg
edaesggh edaesghg edaeshgg edaeshgg edagehgs edagehsg edageghs edagegsh edagesgh edageshg edaghegs
edaghesg edaghges edaghgse edaghsge edaghseg edagghes edagghse edaggehs edaggesh edaggseh edaggshe
edagshge edagsheg edagsghe edagsgeh edagsegh edagsehg edageghs edagegsh edagehgs edagehsg edageshg
edagesgh edaggehs edaggesh edagghes edagghse edaggshe edaggseh edaghges edaghgse edaghegs edaghesg
edaghseg edaghsge edagsghe edagsgeh edagshge edagsheg edagsehg edagsegh edaseggh edaseghg edaseggh
edaseghg edasehgg edasehgg edasgegh edasgehg edasggeh edasgghe edasghge edasgheg edasggeh edasgghe
edasgegh edasgehg edasgheg edasghge edashgge edashgeg edashgge edashgeg edashegg edashegg edgheags
edgheasg edghegas edghegsa edghesga edghesag edghaegs edghaesg edghages edghagse edghasge edghaseg
edghgaes edghgase edghgeas edghgesa edghgsea edghgsae edghsage edghsaeg edghsgae edghsgea edghsega
edghseag edgehags edgehasg edgehgas edgehgsa edgehsga edgehsag edgeahgs edgeahsg edgeaghs edgeagsh
edgeasgh edgeashg edgegahs edgegash edgeghas edgeghsa edgegsha edgegsah edgesagh edgesahg edgesgah
edgesgha edgeshga edgeshag edgaehgs edgaehsg edgaeghs edgaegsh edgaesgh edgaeshg edgahegs edgahesg
edgahges edgahgse edgahsge edgahseg edgaghes edgaghse edgagehs edgagesh edgagseh edgagshe edgashge
edgasheg edgasghe edgasgeh edgasegh edgasehg edggeahs edggeash edggehas edggehsa edggesha edggesah
edggaehs edggaesh edggahes edggahse edggashe edggaseh edgghaes edgghase edggheas edgghesa edgghsea
edgghsae edggsahe edggsaeh edggshae edggshea edggseha edggseah edgseagh edgseahg edgsegah edgsegha
edgsehga edgsehag edgsaegh edgsaehg edgsageh edgsaghe edgsahge edgsaheg edgsgaeh edgsgahe edgsgeah
edgsgeha edgsghea edgsghae edgshage edgshaeg edgshgae edgshgea edgshega edgsheag edsheagg edsheagg
edshegag edshegga edshegga edshegag edshaegg edshaegg edshageg edshagge edshagge edshageg edshgaeg
edshgage edshgeag edshgega edshggea edshggae edshgage edshgaeg edshggae edshggea edshgega edshgeag
edsehagg edsehagg edsehgag edsehgga edsehgga edsehgag edseahgg edseahgg edseaghg edseaggh edseaggh
edseaghg edsegahg edsegagh edseghag edseghga edseggha edseggah edsegagh edsegahg edseggah edseggha
edseghga edseghag edsaehgg edsaehgg edsaeghg edsaeggh edsaeggh edsaeghg edsahegg edsahegg edsahgeg
edsahgge edsahgge edsahgeg edsagheg edsaghge edsagehg edsagegh edsaggeh edsagghe edsaghge edsagheg
edsagghe edsaggeh edsagegh edsagehg edsgeahg edsgeagh edsgehag edsgehga edsgegha edsgegah edsgaehg
edsgaegh edsgaheg edsgahge edsgaghe edsgageh edsghaeg edsghage edsgheag edsghega edsghgea edsghgae
edsggahe edsggaeh edsgghae edsgghea edsggeha edsggeah edsgeagh edsgeahg edsgegah edsgegha edsgehga
edsgehag edsgaegh edsgaehg edsgageh edsgaghe edsgahge edsgaheg edsggaeh edsggahe edsggeah edsggeha
edsgghea edsgghae edsghage edsghaeg edsghgae edsghgea edsghega edsgheag esgheadg esgheagd esghedag
esghedga esghegda esghegad esghaedg esghaegd esghadeg esghadge esghagde esghaged esghdaeg esghdage
esghdeag esghdega esghdgea esghdgae esghgade esghgaed esghgdae esghgdea esghgeda esghgead esgehadg
esgehagd esgehdag esgehdga esgehgda esgehgad esgeahdg esgeahgd esgeadhg esgeadgh esgeagdh esgeaghd
esgedahg esgedagh esgedhag esgedhga esgedgha esgedgah esgegadh esgegahd esgegdah esgegdha esgeghda
esgeghad esgaehdg esgaehgd esgaedhg esgaedgh esgaegdh esgaeghd esgahedg esgahegd esgahdeg esgahdge
esgahgde esgahged esgadheg esgadhge esgadehg esgadegh esgadgeh esgadghe esgaghde esgaghed esgagdhe
esgagdeh esgagedh esgagehd esgdeahg esgdeagh esgdehag esgdehga esgdegha esgdegah esgdaehg esgdaegh
esgdaheg esgdahge esgdaghe esgdageh esgdhaeg esgdhage esgdheag esgdhega esgdhgea esgdhgae esgdgahe
esgdgaeh esgdghae esgdghea esgdgeha esgdgeah esggeadh esggeahd esggedah esggedha esggehda esggehad
esggaedh esggaehd esggadeh esggadhe esggahde esggahed esggdaeh esggdahe esggdeah esggdeha esggdhea
esggdhae esgghade esgghaed esgghdae esgghdea esggheda esgghead eshgeadg eshgeagd eshgedag eshgedga
eshgegda eshgegad eshgaedg eshgaegd eshgadeg eshgadge eshgagde eshgaged eshgdaeg eshgdage eshgdeag
eshgdega eshgdgea eshgdgae eshggade eshggaed eshggdae eshggdea eshggeda eshggead eshegadg eshegagd
eshegdag eshegdga esheggda esheggad esheagdg esheaggd esheadgg esheadgg esheagdg esheaggd eshedagg
eshedagg eshedgag eshedgga eshedgga eshedgag eshegadg eshegagd eshegdag eshegdga esheggda esheggad
eshaegdg eshaeggd eshaedgg eshaedgg eshaegdg eshaeggd eshagedg eshagegd eshagdeg eshagdge eshaggde
eshagged eshadgeg eshadgge eshadegg eshadegg eshadgeg eshadgge eshaggde eshagged eshagdge eshagdeg
eshagedg eshagegd eshdeagg eshdeagg eshdegag eshdegga eshdegga eshdegag eshdaegg eshdaegg eshdageg
eshdagge eshdagge eshdageg eshdgaeg eshdgage eshdgeag eshdgega eshdggea eshdggae eshdgage eshdgaeg
eshdggae eshdggea eshdgega eshdgeag eshgeadg eshgeagd eshgedag eshgedga eshgegda eshgegad eshgaedg
eshgaegd eshgadeg eshgadge eshgagde eshgaged eshgdaeg eshgdage eshgdeag eshgdega eshgdgea eshgdgae
eshggade eshggaed eshggdae eshggdea eshggeda eshggead esehgadg esehgagd esehgdag esehgdga esehggda
esehggad esehagdg esehaggd esehadgg esehadgg esehagdg esehaggd esehdagg esehdagg esehdgag esehdgga
esehdgga esehdgag esehgadg esehgagd esehgdag esehgdga esehggda esehggad eseghadg eseghagd eseghdag
eseghdga eseghgda eseghgad esegahdg esegahgd esegadhg esegadgh esegagdh esegaghd esegdahg esegdagh
esegdhag esegdhga esegdgha esegdgah eseggadh eseggahd eseggdah eseggdha esegghda esegghad eseaghdg
eseaghgd eseagdhg eseagdgh eseaggdh eseagghd eseahgdg eseahggd eseahdgg eseahdgg eseahgdg eseahggd
eseadhgg eseadhgg eseadghg eseadggh eseadggh eseadghg eseaghdg eseaghgd eseagdhg eseagdgh eseaggdh
eseagghd esedgahg esedgagh esedghag esedghga esedggha esedggah esedaghg esedaggh esedahgg esedahgg
esedaghg esedaggh esedhagg esedhagg esedhgag esedhgga esedhgga esedhgag esedgahg esedgagh esedghag
esedghga esedggha esedggah eseggadh eseggahd eseggdah eseggdha esegghda esegghad esegagdh esegaghd
esegadgh esegadhg esegahdg esegahgd esegdagh esegdahg esegdgah esegdgha esegdhga esegdhag eseghadg
eseghagd eseghdag eseghdga eseghgda eseghgad esahegdg esaheggd esahedgg esahedgg esahegdg esaheggd
esahgedg esahgegd esahgdeg esahgdge esahggde esahgged esahdgeg esahdgge esahdegg esahdegg esahdgeg
esahdgge esahggde esahgged esahgdge esahgdeg esahgedg esahgegd esaehgdg esaehggd esaehdgg esaehdgg
esaehgdg esaehggd esaeghdg esaeghgd esaegdhg esaegdgh esaeggdh esaegghd esaedghg esaedggh esaedhgg
esaedhgg esaedghg esaedggh esaeggdh esaegghd esaegdgh esaegdhg esaeghdg esaeghgd esagehdg esagehgd
esagedhg esagedgh esagegdh esageghd esaghedg esaghegd esaghdeg esaghdge esaghgde esaghged esagdheg
esagdhge esagdehg esagdegh esagdgeh esagdghe esagghde esagghed esaggdhe esaggdeh esaggedh esaggehd
esadeghg esadeggh esadehgg esadehgg esadeghg esadeggh esadgehg esadgegh esadgheg esadghge esadgghe
esadggeh esadhgeg esadhgge esadhegg esadhegg esadhgeg esadhgge esadgghe esadggeh esadghge esadgheg
esadgehg esadgegh esagegdh esageghd esagedgh esagedhg esagehdg esagehgd esaggedh esaggehd esaggdeh
esaggdhe esagghde esagghed esagdgeh esagdghe esagdegh esagdehg esagdheg esagdhge esaghgde esaghged
esaghdge esaghdeg esaghedg esaghegd esdheagg esdheagg esdhegag esdhegga esdhegga esdhegag esdhaegg
esdhaegg esdhageg esdhagge esdhagge esdhageg esdhgaeg esdhgage esdhgeag esdhgega esdhggea esdhggae
esdhgage esdhgaeg esdhggae esdhggea esdhgega esdhgeag esdehagg esdehagg esdehgag esdehgga esdehgga
esdehgag esdeahgg esdeahgg esdeaghg esdeaggh esdeaggh esdeaghg esdegahg esdegagh esdeghag esdeghga
esdeggha esdeggah esdegagh esdegahg esdeggah esdeggha esdeghga esdeghag esdaehgg esdaehgg esdaeghg
esdaeggh esdaeggh esdaeghg esdahegg esdahegg esdahgeg esdahgge esdahgge esdahgeg esdagheg esdaghge
esdagehg esdagegh esdaggeh esdagghe esdaghge esdagheg esdagghe esdaggeh esdagegh esdagehg esdgeahg
esdgeagh esdgehag esdgehga esdgegha esdgegah esdgaehg esdgaegh esdgaheg esdgahge esdgaghe esdgageh
esdghaeg esdghage esdgheag esdghega esdghgea esdghgae esdggahe esdggaeh esdgghae esdgghea esdggeha
esdggeah esdgeagh esdgeahg esdgegah esdgegha esdgehga esdgehag esdgaegh esdgaehg esdgageh esdgaghe
esdgahge esdgaheg esdggaeh esdggahe esdggeah esdggeha esdgghea esdgghae esdghage esdghaeg esdghgae
esdghgea esdghega esdgheag esgheadg esgheagd esghedag esghedga esghegda esghegad esghaedg esghaegd
esghadeg esghadge esghagde esghaged esghdaeg esghdage esghdeag esghdega esghdgea esghdgae esghgade
esghgaed esghgdae esghgdea esghgeda esghgead esgehadg esgehagd esgehdag esgehdga esgehgda esgehgad
esgeahdg esgeahgd esgeadhg esgeadgh esgeagdh esgeaghd esgedahg esgedagh esgedhag esgedhga esgedgha
esgedgah esgegadh esgegahd esgegdah esgegdha esgeghda esgeghad esgaehdg esgaehgd esgaedhg esgaedgh
esgaegdh esgaeghd esgahedg esgahegd esgahdeg esgahdge esgahgde esgahged esgadheg esgadhge esgadehg
esgadegh esgadgeh esgadghe esgaghde esgaghed esgagdhe esgagdeh esgagedh esgagehd esgdeahg esgdeagh
esgdehag esgdehga esgdegha esgdegah esgdaehg esgdaegh esgdaheg esgdahge esgdaghe esgdageh esgdhaeg
esgdhage esgdheag esgdhega esgdhgea esgdhgae esgdgahe esgdgaeh esgdghae esgdghea esgdgeha esgdgeah
esggeadh esggeahd esggedah esggedha esggehda esggehad esggaedh esggaehd esggadeh esggadhe esggahde
esggahed esggdaeh esggdahe esggdeah esggdeha esggdhea esggdhae esgghade esgghaed esgghdae esgghdea
esggheda esgghead

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us