easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

colorers

mcadoo

microfilming

bromization

recoil

parathyroidectomy

clarklake

becquet

madcat

inogenesis

abstinueras

meandrine

sibraim

nonreformation

presubscribe

earthward

starshoot

kinsmith


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: dunkelberger
cipher variations:
evolfmcfshfs fwpmgndgtigt gxqnhoehujhu hyroipfivkiv izspjqgjwljw
jatqkrhkxmkx kburlsilynly lcvsmtjmzomz mdwtnuknapna nexuovlobqob
ofyvpwmpcrpc pgzwqxnqdsqd qhaxryoretre ribyszpsfusf sjcztaqtgvtg
tkdaubruhwuh ulebvcsvixvi vmfcwdtwjywj wngdxeuxkzxk xoheyfvylayl
ypifzgwzmbzm zqjgahxancan arkhbiybodbo bslicjzcpecp ctmjdkadqfdq

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: dunkelberger
Cipher: wfmpvoyvitvi

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: dunkelberger
Cipher: AAABB BAABB ABBAA ABAAB AABAA ABABA AAAAB AABAA BAAAA AABBA AABAA BAAAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: dunkelberger
cipher variations:
evolfmcfshfskjofnienatnaqxozvegvifviwlotdaidqrdqczonlwklydlyinohtsmtgptgupovjkqjwnjwadoprgsrezre
grojzcuzmlzmmfodhywhuxhustoxpuypcjpcyhorxqaxkvxkfwpmgndgtigtlkpgojfobuobrypawfhwjgwjxmpuebjerser
dapomxlmzemzjopiutnuhquhvqpwklrkxokxbepqshtsfasfhspkadvanmanngpeizxivyivtupyqvzqdkqdzipsyrbylwyl
gxqnhoehujhumlqhpkgpcvpcszqbxgixkhxkynqvfckfstfsebqpnymnafnakpqjvuovirviwrqxlmslyplycfqrtiutgbtg
itqlbewbonboohqfjayjwzjwuvqzrwarelreajqtzsczmxzmhyroipfivkivnmriqlhqdwqdtarcyhjyliylzorwgdlgtugt
fcrqoznobgoblqrkwvpwjswjxsrymntmzqmzdgrsujvuhcuhjurmcfxcpocppirgkbzkxakxvwrasxbsfmsfbkruatdanyan
izspjqgjwljwonsjrmirexreubsdzikzmjzmapsxhemhuvhugdsrpaopchpcmrslxwqxktxkytsznounarnaehstvkwvidvi
kvsndgydqpdqqjshlcalyblywxsbtyctgntgclsvbuebozbojatqkrhkxmkxpotksnjsfysfvcteajlankanbqtyifnivwiv
hetsqbpqdiqdnstmyxryluylzutaopvobsobfituwlxwjewjlwtoehzerqerrktimdbmzcmzxytcuzduhouhdmtwcvfcpacp
kburlsilynlyqpultoktgztgwdufbkmbolbocruzjgojwxjwifutrcqrejreotunzyszmvzmavubpqwpctpcgjuvxmyxkfxk
mxupfiafsrfsslujnecnadnayzudvaevipvienuxdwgdqbdqlcvsmtjmzomzrqvmupluhauhxevgclncpmcpdsvakhpkxykx
jgvusdrsfksfpuvoaztanwanbwvcqrxqduqdhkvwynzylgylnyvqgjbgtsgttmvkofdobeobzavewbfwjqwjfovyexhercer
mdwtnuknapnasrwnvqmvibviyfwhdmodqndqetwbliqlyzlykhwvtestgltgqvwpbauboxbocxwdrsyrevreilwxzoazmhzm
ozwrhkchuthuunwlpgepcfpcabwfxcgxkrxkgpwzfyifsdfsnexuovlobqobtsxowrnwjcwjzgxienperoerfuxcmjrmzamz
lixwuftuhmuhrwxqcbvcpycpdyxestzsfwsfjmxyapbanianpaxsildivuivvoxmqhfqdgqdbcxgydhylsylhqxagzjgtegt
ofyvpwmpcrpcutypxsoxkdxkahyjfoqfspfsgvydnksnabnamjyxvguvinvisxyrdcwdqzdqezyftuatgxtgknyzbqcbojbo
qbytjmejwvjwwpynrigrehrecdyhzeizmtzmirybhakhufhupgzwqxnqdsqdvuzqytpyleylbizkgprgtqgthwzeoltobcob
nkzywhvwjowjtyzsedxeraerfazguvbuhyuhlozacrdcpkcprczuknfkxwkxxqzosjhsfisfdeziafjanuanjszciblivgiv
qhaxryoretrewvarzuqzmfzmcjalhqshurhuixafpmupcdpcolazxiwxkpxkuzatfeyfsbfsgbahvwcvizvimpabdsedqldq
sdavloglyxlyyraptkitgjtgefajbgkbovboktadjcmjwhjwribyszpsfusfxwbsavrangandkbmirtivsivjybgqnvqdeqd
pmbayjxylqylvabugfzgtcgthcbiwxdwjawjnqbcetfermertebwmphmzymzzsbquljuhkuhfgbkchlcpwcplubekdnkxikx
sjcztaqtgvtgyxctbwsbohboelcnjsujwtjwkzchrowrefreqncbzkyzmrzmwbcvhgahudhuidcjxyexkbxkorcdfugfsnfs
ufcxnqinaznaatcrvmkvilvighcldimdqxdqmvcfleolyjlytkdaubruhwuhzyducxtcpicpfmdoktvkxukxladispxsfgsf
rodcalzansanxcdwihbiveivjedkyzfylcylpsdegvhgtogtvgdyorjobaobbudswnlwjmwjhidmejneryernwdgmfpmzkmz
ulebvcsvixviazevdyudqjdqgnepluwlyvlymbejtqytghtgspedbmabotboydexjicjwfjwkfelzagzmdzmqtefhwihuphu
whezpskpcbpccvetxomxknxkijenfkofszfsoxehngqnalnavmfcwdtwjywjbafwezverkerhofqmvxmzwmzncfkurzuhiuh
tqfecnbcpucpzefykjdkxgkxlgfmabhaneanrufgixjivqivxifaqtlqdcqddwfuypnyloyljkfoglpgtagtpyfiohrobmob
wngdxeuxkzxkcbgxfawfslfsipgrnwynaxnaodglvsavijviurgfdocdqvdqafgzlkelyhlymhgnbcibofbosvghjykjwrjw
yjgbrumredreexgvzqozmpzmklgphmqhubhuqzgjpispcnpcxoheyfvylayldchygbxgtmgtjqhsoxzobyobpehmwtbwjkwj
vshgepderwerbghamlfmzimznihocdjcpgcptwhikzlkxskxzkhcsvnsfesffyhwarpanqanlmhqinrivcivrahkqjtqdoqd
ypifzgwzmbzmedizhcyhunhukritpyapczpcqfinxucxklxkwtihfqefsxfschibnmgnajnaojipdekdqhdquxijlamlytly
alidtwotgftggzixbsqborbomnirjosjwdjwsbilrkureprezqjgahxancanfejaidzivoivlsjuqzbqdaqdrgjoyvdylmyl
xujigrfgtygtdijconhobkobpkjqefleriervyjkmbnmzumzbmjeuxpuhguhhajyctrcpscpnojskptkxekxtcjmslvsfqsf
arkhbiybodbogfkbjeajwpjwmtkvracrebreshkpzwezmnzmyvkjhsghuzhuejkdpoipclpcqlkrfgmfsjfswzklnconavna
cnkfvyqvihviibkzdusdqtdqopktlqulyflyudkntmwtgrtgbslicjzcpecphglckfbkxqkxnulwsbdsfcsftilqaxfanoan
zwlkithivaivfkleqpjqdmqdrmlsghngtkgtxalmodpobwobdolgwzrwjiwjjclaevteruerpqlumrvmzgmzvelounxuhsuh
ctmjdkadqfdqihmdlgclyrlyovmxtcetgdtgujmrbygbopboaxmljuijwbjwglmfrqkrenresnmthiohulhuybmnpeqpcxpc
epmhxasxkjxkkdmbfwufsvfsqrmvnswnahnawfmpvoyvitvidunkelbergerjinemhdmzsmzpwnyudfuheuhvknsczhcpqcp
bynmkvjkxckxhmngsrlsfosftonuijpivmivzcnoqfrqdyqdfqniybtylkyllencgxvgtwgtrsnwotxobiobxgnqwpzwjuwj

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: dunkelberger
Cipher: qhaxryoretre

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: dunkelberger
Cipher: 415433525113215124225124

Extended Methods:
Method #1

Plaintext: dunkelberger
method variations:
izspkqgkwmkwoexupvmpbrpbtkczuarugwugyphezfwzmbzm

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
d u n k e l b e r g e r 
4 5 3 5 5 1 2 5 2 2 5 2 
1 4 3 2 1 3 1 1 4 2 1 4 
They are then read out in rows:
453551252252143213114214
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: dunkelberger
Cipher: yxewgkqhlaiq

Read more ...
Method #3

Plaintext: dunkelberger
method variations:
voxwahvfiwft oxwahvfiwftv xwahvfiwftvo
wahvfiwftvox ahvfiwftvoxw hvfiwftvoxwa
vfiwftvoxwah fiwftvoxwahv iwftvoxwahvf
wftvoxwahvfi ftvoxwahvfiw tvoxwahvfiwf

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: dunkelberger

first 5040 cipher variations(475687488 total)
dunkelberger dunkelbergre dunkelberegr dunkelbererg dunkelberreg dunkelberrge dunkelbegrer dunkelbegrre dunkelbegerr
dunkelbegerr dunkelbegrer dunkelbegrre dunkelbeegrr dunkelbeegrr dunkelbeergr dunkelbeerrg dunkelbeerrg dunkelbeergr
dunkelberger dunkelbergre dunkelberegr dunkelbererg dunkelberreg dunkelberrge dunkelbreger dunkelbregre dunkelbreegr
dunkelbreerg dunkelbrereg dunkelbrerge dunkelbrgeer dunkelbrgere dunkelbrgeer dunkelbrgere dunkelbrgree dunkelbrgree
dunkelbreger dunkelbregre dunkelbreegr dunkelbreerg dunkelbrereg dunkelbrerge dunkelbrrgee dunkelbrrgee dunkelbrrege
dunkelbrreeg dunkelbrreeg dunkelbrrege dunkelbgreer dunkelbgrere dunkelbgreer dunkelbgrere dunkelbgrree dunkelbgrree
dunkelbgerer dunkelbgerre dunkelbgeerr dunkelbgeerr dunkelbgerer dunkelbgerre dunkelbgeerr dunkelbgeerr dunkelbgerer
dunkelbgerre dunkelbgerre dunkelbgerer dunkelbgreer dunkelbgrere dunkelbgreer dunkelbgrere dunkelbgrree dunkelbgrree
dunkelberger dunkelbergre dunkelberegr dunkelbererg dunkelberreg dunkelberrge dunkelbegrer dunkelbegrre dunkelbegerr
dunkelbegerr dunkelbegrer dunkelbegrre dunkelbeegrr dunkelbeegrr dunkelbeergr dunkelbeerrg dunkelbeerrg dunkelbeergr
dunkelberger dunkelbergre dunkelberegr dunkelbererg dunkelberreg dunkelberrge dunkelbrrgee dunkelbrrgee dunkelbrrege
dunkelbrreeg dunkelbrreeg dunkelbrrege dunkelbrgree dunkelbrgree dunkelbrgere dunkelbrgeer dunkelbrgeer dunkelbrgere
dunkelbregre dunkelbreger dunkelbrerge dunkelbrereg dunkelbreerg dunkelbreegr dunkelbreger dunkelbregre dunkelbreegr
dunkelbreerg dunkelbrereg dunkelbrerge dunkelebrger dunkelebrgre dunkelebregr dunkelebrerg dunkelebrreg dunkelebrrge
dunkelebgrer dunkelebgrre dunkelebgerr dunkelebgerr dunkelebgrer dunkelebgrre dunkelebegrr dunkelebegrr dunkelebergr
dunkeleberrg dunkeleberrg dunkelebergr dunkelebrger dunkelebrgre dunkelebregr dunkelebrerg dunkelebrreg dunkelebrrge
dunkelerbger dunkelerbgre dunkelerbegr dunkelerberg dunkelerbreg dunkelerbrge dunkelergber dunkelergbre dunkelergebr
dunkelergerb dunkelergreb dunkelergrbe dunkeleregbr dunkeleregrb dunkelerebgr dunkelerebrg dunkelererbg dunkelerergb
dunkelerrgeb dunkelerrgbe dunkelerregb dunkelerrebg dunkelerrbeg dunkelerrbge dunkelegrber dunkelegrbre dunkelegrebr
dunkelegrerb dunkelegrreb dunkelegrrbe dunkelegbrer dunkelegbrre dunkelegberr dunkelegberr dunkelegbrer dunkelegbrre
dunkelegebrr dunkelegebrr dunkelegerbr dunkelegerrb dunkelegerrb dunkelegerbr dunkelegrber dunkelegrbre dunkelegrebr
dunkelegrerb dunkelegrreb dunkelegrrbe dunkeleergbr dunkeleergrb dunkeleerbgr dunkeleerbrg dunkeleerrbg dunkeleerrgb
dunkeleegrbr dunkeleegrrb dunkeleegbrr dunkeleegbrr dunkeleegrbr dunkeleegrrb dunkeleebgrr dunkeleebgrr dunkeleebrgr
dunkeleebrrg dunkeleebrrg dunkeleebrgr dunkeleergbr dunkeleergrb dunkeleerbgr dunkeleerbrg dunkeleerrbg dunkeleerrgb
dunkelerrgeb dunkelerrgbe dunkelerregb dunkelerrebg dunkelerrbeg dunkelerrbge dunkelergreb dunkelergrbe dunkelergerb
dunkelergebr dunkelergber dunkelergbre dunkeleregrb dunkeleregbr dunkelerergb dunkelererbg dunkelerebrg dunkelerebgr
dunkelerbger dunkelerbgre dunkelerbegr dunkelerberg dunkelerbreg dunkelerbrge dunkelrebger dunkelrebgre dunkelrebegr
dunkelreberg dunkelrebreg dunkelrebrge dunkelregber dunkelregbre dunkelregebr dunkelregerb dunkelregreb dunkelregrbe
dunkelreegbr dunkelreegrb dunkelreebgr dunkelreebrg dunkelreerbg dunkelreergb dunkelrergeb dunkelrergbe dunkelreregb
dunkelrerebg dunkelrerbeg dunkelrerbge dunkelrbeger dunkelrbegre dunkelrbeegr dunkelrbeerg dunkelrbereg dunkelrberge
dunkelrbgeer dunkelrbgere dunkelrbgeer dunkelrbgere dunkelrbgree dunkelrbgree dunkelrbeger dunkelrbegre dunkelrbeegr
dunkelrbeerg dunkelrbereg dunkelrberge dunkelrbrgee dunkelrbrgee dunkelrbrege dunkelrbreeg dunkelrbreeg dunkelrbrege
dunkelrgbeer dunkelrgbere dunkelrgbeer dunkelrgbere dunkelrgbree dunkelrgbree dunkelrgeber dunkelrgebre dunkelrgeebr
dunkelrgeerb dunkelrgereb dunkelrgerbe dunkelrgeebr dunkelrgeerb dunkelrgeber dunkelrgebre dunkelrgerbe dunkelrgereb
dunkelrgreeb dunkelrgrebe dunkelrgreeb dunkelrgrebe dunkelrgrbee dunkelrgrbee dunkelrebger dunkelrebgre dunkelrebegr
dunkelreberg dunkelrebreg dunkelrebrge dunkelregber dunkelregbre dunkelregebr dunkelregerb dunkelregreb dunkelregrbe
dunkelreegbr dunkelreegrb dunkelreebgr dunkelreebrg dunkelreerbg dunkelreergb dunkelrergeb dunkelrergbe dunkelreregb
dunkelrerebg dunkelrerbeg dunkelrerbge dunkelrrbgee dunkelrrbgee dunkelrrbege dunkelrrbeeg dunkelrrbeeg dunkelrrbege
dunkelrrgbee dunkelrrgbee dunkelrrgebe dunkelrrgeeb dunkelrrgeeb dunkelrrgebe dunkelrregbe dunkelrregeb dunkelrrebge
dunkelrrebeg dunkelrreebg dunkelrreegb dunkelrregeb dunkelrregbe dunkelrreegb dunkelrreebg dunkelrrebeg dunkelrrebge
dunkelgerber dunkelgerbre dunkelgerebr dunkelgererb dunkelgerreb dunkelgerrbe dunkelgebrer dunkelgebrre dunkelgeberr
dunkelgeberr dunkelgebrer dunkelgebrre dunkelgeebrr dunkelgeebrr dunkelgeerbr dunkelgeerrb dunkelgeerrb dunkelgeerbr
dunkelgerber dunkelgerbre dunkelgerebr dunkelgererb dunkelgerreb dunkelgerrbe dunkelgreber dunkelgrebre dunkelgreebr
dunkelgreerb dunkelgrereb dunkelgrerbe dunkelgrbeer dunkelgrbere dunkelgrbeer dunkelgrbere dunkelgrbree dunkelgrbree
dunkelgreber dunkelgrebre dunkelgreebr dunkelgreerb dunkelgrereb dunkelgrerbe dunkelgrrbee dunkelgrrbee dunkelgrrebe
dunkelgrreeb dunkelgrreeb dunkelgrrebe dunkelgbreer dunkelgbrere dunkelgbreer dunkelgbrere dunkelgbrree dunkelgbrree
dunkelgberer dunkelgberre dunkelgbeerr dunkelgbeerr dunkelgberer dunkelgberre dunkelgbeerr dunkelgbeerr dunkelgberer
dunkelgberre dunkelgberre dunkelgberer dunkelgbreer dunkelgbrere dunkelgbreer dunkelgbrere dunkelgbrree dunkelgbrree
dunkelgerber dunkelgerbre dunkelgerebr dunkelgererb dunkelgerreb dunkelgerrbe dunkelgebrer dunkelgebrre dunkelgeberr
dunkelgeberr dunkelgebrer dunkelgebrre dunkelgeebrr dunkelgeebrr dunkelgeerbr dunkelgeerrb dunkelgeerrb dunkelgeerbr
dunkelgerber dunkelgerbre dunkelgerebr dunkelgererb dunkelgerreb dunkelgerrbe dunkelgrrbee dunkelgrrbee dunkelgrrebe
dunkelgrreeb dunkelgrreeb dunkelgrrebe dunkelgrbree dunkelgrbree dunkelgrbere dunkelgrbeer dunkelgrbeer dunkelgrbere
dunkelgrebre dunkelgreber dunkelgrerbe dunkelgrereb dunkelgreerb dunkelgreebr dunkelgreber dunkelgrebre dunkelgreebr
dunkelgreerb dunkelgrereb dunkelgrerbe dunkeleergbr dunkeleergrb dunkeleerbgr dunkeleerbrg dunkeleerrbg dunkeleerrgb
dunkeleegrbr dunkeleegrrb dunkeleegbrr dunkeleegbrr dunkeleegrbr dunkeleegrrb dunkeleebgrr dunkeleebgrr dunkeleebrgr
dunkeleebrrg dunkeleebrrg dunkeleebrgr dunkeleergbr dunkeleergrb dunkeleerbgr dunkeleerbrg dunkeleerrbg dunkeleerrgb
dunkeleregbr dunkeleregrb dunkelerebgr dunkelerebrg dunkelererbg dunkelerergb dunkelergebr dunkelergerb dunkelergber
dunkelergbre dunkelergrbe dunkelergreb dunkelerbger dunkelerbgre dunkelerbegr dunkelerberg dunkelerbreg dunkelerbrge
dunkelerrgbe dunkelerrgeb dunkelerrbge dunkelerrbeg dunkelerrebg dunkelerregb dunkelegrebr dunkelegrerb dunkelegrber
dunkelegrbre dunkelegrrbe dunkelegrreb dunkelegerbr dunkelegerrb dunkelegebrr dunkelegebrr dunkelegerbr dunkelegerrb
dunkelegberr dunkelegberr dunkelegbrer dunkelegbrre dunkelegbrre dunkelegbrer dunkelegrebr dunkelegrerb dunkelegrber
dunkelegrbre dunkelegrrbe dunkelegrreb dunkelebrger dunkelebrgre dunkelebregr dunkelebrerg dunkelebrreg dunkelebrrge
dunkelebgrer dunkelebgrre dunkelebgerr dunkelebgerr dunkelebgrer dunkelebgrre dunkelebegrr dunkelebegrr dunkelebergr
dunkeleberrg dunkeleberrg dunkelebergr dunkelebrger dunkelebrgre dunkelebregr dunkelebrerg dunkelebrreg dunkelebrrge
dunkelerrgbe dunkelerrgeb dunkelerrbge dunkelerrbeg dunkelerrebg dunkelerregb dunkelergrbe dunkelergreb dunkelergbre
dunkelergber dunkelergebr dunkelergerb dunkelerbgre dunkelerbger dunkelerbrge dunkelerbreg dunkelerberg dunkelerbegr
dunkeleregbr dunkeleregrb dunkelerebgr dunkelerebrg dunkelererbg dunkelerergb dunkelrergeb dunkelrergbe dunkelreregb
dunkelrerebg dunkelrerbeg dunkelrerbge dunkelregreb dunkelregrbe dunkelregerb dunkelregebr dunkelregber dunkelregbre
dunkelreegrb dunkelreegbr dunkelreergb dunkelreerbg dunkelreebrg dunkelreebgr dunkelrebger dunkelrebgre dunkelrebegr
dunkelreberg dunkelrebreg dunkelrebrge dunkelrregeb dunkelrregbe dunkelrreegb dunkelrreebg dunkelrrebeg dunkelrrebge
dunkelrrgeeb dunkelrrgebe dunkelrrgeeb dunkelrrgebe dunkelrrgbee dunkelrrgbee dunkelrregeb dunkelrregbe dunkelrreegb
dunkelrreebg dunkelrrebeg dunkelrrebge dunkelrrbgee dunkelrrbgee dunkelrrbege dunkelrrbeeg dunkelrrbeeg dunkelrrbege
dunkelrgreeb dunkelrgrebe dunkelrgreeb dunkelrgrebe dunkelrgrbee dunkelrgrbee dunkelrgereb dunkelrgerbe dunkelrgeerb
dunkelrgeebr dunkelrgeber dunkelrgebre dunkelrgeerb dunkelrgeebr dunkelrgereb dunkelrgerbe dunkelrgebre dunkelrgeber
dunkelrgbeer dunkelrgbere dunkelrgbeer dunkelrgbere dunkelrgbree dunkelrgbree dunkelrergeb dunkelrergbe dunkelreregb
dunkelrerebg dunkelrerbeg dunkelrerbge dunkelregreb dunkelregrbe dunkelregerb dunkelregebr dunkelregber dunkelregbre
dunkelreegrb dunkelreegbr dunkelreergb dunkelreerbg dunkelreebrg dunkelreebgr dunkelrebger dunkelrebgre dunkelrebegr
dunkelreberg dunkelrebreg dunkelrebrge dunkelrbrgee dunkelrbrgee dunkelrbrege dunkelrbreeg dunkelrbreeg dunkelrbrege
dunkelrbgree dunkelrbgree dunkelrbgere dunkelrbgeer dunkelrbgeer dunkelrbgere dunkelrbegre dunkelrbeger dunkelrberge
dunkelrbereg dunkelrbeerg dunkelrbeegr dunkelrbeger dunkelrbegre dunkelrbeegr dunkelrbeerg dunkelrbereg dunkelrberge
dunkeblerger dunkeblergre dunkebleregr dunkeblererg dunkeblerreg dunkeblerrge dunkeblegrer dunkeblegrre dunkeblegerr
dunkeblegerr dunkeblegrer dunkeblegrre dunkebleegrr dunkebleegrr dunkebleergr dunkebleerrg dunkebleerrg dunkebleergr
dunkeblerger dunkeblergre dunkebleregr dunkeblererg dunkeblerreg dunkeblerrge dunkeblreger dunkeblregre dunkeblreegr
dunkeblreerg dunkeblrereg dunkeblrerge dunkeblrgeer dunkeblrgere dunkeblrgeer dunkeblrgere dunkeblrgree dunkeblrgree
dunkeblreger dunkeblregre dunkeblreegr dunkeblreerg dunkeblrereg dunkeblrerge dunkeblrrgee dunkeblrrgee dunkeblrrege
dunkeblrreeg dunkeblrreeg dunkeblrrege dunkeblgreer dunkeblgrere dunkeblgreer dunkeblgrere dunkeblgrree dunkeblgrree
dunkeblgerer dunkeblgerre dunkeblgeerr dunkeblgeerr dunkeblgerer dunkeblgerre dunkeblgeerr dunkeblgeerr dunkeblgerer
dunkeblgerre dunkeblgerre dunkeblgerer dunkeblgreer dunkeblgrere dunkeblgreer dunkeblgrere dunkeblgrree dunkeblgrree
dunkeblerger dunkeblergre dunkebleregr dunkeblererg dunkeblerreg dunkeblerrge dunkeblegrer dunkeblegrre dunkeblegerr
dunkeblegerr dunkeblegrer dunkeblegrre dunkebleegrr dunkebleegrr dunkebleergr dunkebleerrg dunkebleerrg dunkebleergr
dunkeblerger dunkeblergre dunkebleregr dunkeblererg dunkeblerreg dunkeblerrge dunkeblrrgee dunkeblrrgee dunkeblrrege
dunkeblrreeg dunkeblrreeg dunkeblrrege dunkeblrgree dunkeblrgree dunkeblrgere dunkeblrgeer dunkeblrgeer dunkeblrgere
dunkeblregre dunkeblreger dunkeblrerge dunkeblrereg dunkeblreerg dunkeblreegr dunkeblreger dunkeblregre dunkeblreegr
dunkeblreerg dunkeblrereg dunkeblrerge dunkebelrger dunkebelrgre dunkebelregr dunkebelrerg dunkebelrreg dunkebelrrge
dunkebelgrer dunkebelgrre dunkebelgerr dunkebelgerr dunkebelgrer dunkebelgrre dunkebelegrr dunkebelegrr dunkebelergr
dunkebelerrg dunkebelerrg dunkebelergr dunkebelrger dunkebelrgre dunkebelregr dunkebelrerg dunkebelrreg dunkebelrrge
dunkeberlger dunkeberlgre dunkeberlegr dunkeberlerg dunkeberlreg dunkeberlrge dunkebergler dunkeberglre dunkebergelr
dunkebergerl dunkebergrel dunkebergrle dunkebereglr dunkeberegrl dunkeberelgr dunkeberelrg dunkebererlg dunkeberergl
dunkeberrgel dunkeberrgle dunkeberregl dunkeberrelg dunkeberrleg dunkeberrlge dunkebegrler dunkebegrlre dunkebegrelr
dunkebegrerl dunkebegrrel dunkebegrrle dunkebeglrer dunkebeglrre dunkebeglerr dunkebeglerr dunkebeglrer dunkebeglrre
dunkebegelrr dunkebegelrr dunkebegerlr dunkebegerrl dunkebegerrl dunkebegerlr dunkebegrler dunkebegrlre dunkebegrelr
dunkebegrerl dunkebegrrel dunkebegrrle dunkebeerglr dunkebeergrl dunkebeerlgr dunkebeerlrg dunkebeerrlg dunkebeerrgl
dunkebeegrlr dunkebeegrrl dunkebeeglrr dunkebeeglrr dunkebeegrlr dunkebeegrrl dunkebeelgrr dunkebeelgrr dunkebeelrgr
dunkebeelrrg dunkebeelrrg dunkebeelrgr dunkebeerglr dunkebeergrl dunkebeerlgr dunkebeerlrg dunkebeerrlg dunkebeerrgl
dunkeberrgel dunkeberrgle dunkeberregl dunkeberrelg dunkeberrleg dunkeberrlge dunkebergrel dunkebergrle dunkebergerl
dunkebergelr dunkebergler dunkeberglre dunkeberegrl dunkebereglr dunkeberergl dunkebererlg dunkeberelrg dunkeberelgr
dunkeberlger dunkeberlgre dunkeberlegr dunkeberlerg dunkeberlreg dunkeberlrge dunkebrelger dunkebrelgre dunkebrelegr
dunkebrelerg dunkebrelreg dunkebrelrge dunkebregler dunkebreglre dunkebregelr dunkebregerl dunkebregrel dunkebregrle
dunkebreeglr dunkebreegrl dunkebreelgr dunkebreelrg dunkebreerlg dunkebreergl dunkebrergel dunkebrergle dunkebreregl
dunkebrerelg dunkebrerleg dunkebrerlge dunkebrleger dunkebrlegre dunkebrleegr dunkebrleerg dunkebrlereg dunkebrlerge
dunkebrlgeer dunkebrlgere dunkebrlgeer dunkebrlgere dunkebrlgree dunkebrlgree dunkebrleger dunkebrlegre dunkebrleegr
dunkebrleerg dunkebrlereg dunkebrlerge dunkebrlrgee dunkebrlrgee dunkebrlrege dunkebrlreeg dunkebrlreeg dunkebrlrege
dunkebrgleer dunkebrglere dunkebrgleer dunkebrglere dunkebrglree dunkebrglree dunkebrgeler dunkebrgelre dunkebrgeelr
dunkebrgeerl dunkebrgerel dunkebrgerle dunkebrgeelr dunkebrgeerl dunkebrgeler dunkebrgelre dunkebrgerle dunkebrgerel
dunkebrgreel dunkebrgrele dunkebrgreel dunkebrgrele dunkebrgrlee dunkebrgrlee dunkebrelger dunkebrelgre dunkebrelegr
dunkebrelerg dunkebrelreg dunkebrelrge dunkebregler dunkebreglre dunkebregelr dunkebregerl dunkebregrel dunkebregrle
dunkebreeglr dunkebreegrl dunkebreelgr dunkebreelrg dunkebreerlg dunkebreergl dunkebrergel dunkebrergle dunkebreregl
dunkebrerelg dunkebrerleg dunkebrerlge dunkebrrlgee dunkebrrlgee dunkebrrlege dunkebrrleeg dunkebrrleeg dunkebrrlege
dunkebrrglee dunkebrrglee dunkebrrgele dunkebrrgeel dunkebrrgeel dunkebrrgele dunkebrregle dunkebrregel dunkebrrelge
dunkebrreleg dunkebrreelg dunkebrreegl dunkebrregel dunkebrregle dunkebrreegl dunkebrreelg dunkebrreleg dunkebrrelge
dunkebgerler dunkebgerlre dunkebgerelr dunkebgererl dunkebgerrel dunkebgerrle dunkebgelrer dunkebgelrre dunkebgelerr
dunkebgelerr dunkebgelrer dunkebgelrre dunkebgeelrr dunkebgeelrr dunkebgeerlr dunkebgeerrl dunkebgeerrl dunkebgeerlr
dunkebgerler dunkebgerlre dunkebgerelr dunkebgererl dunkebgerrel dunkebgerrle dunkebgreler dunkebgrelre dunkebgreelr
dunkebgreerl dunkebgrerel dunkebgrerle dunkebgrleer dunkebgrlere dunkebgrleer dunkebgrlere dunkebgrlree dunkebgrlree
dunkebgreler dunkebgrelre dunkebgreelr dunkebgreerl dunkebgrerel dunkebgrerle dunkebgrrlee dunkebgrrlee dunkebgrrele
dunkebgrreel dunkebgrreel dunkebgrrele dunkebglreer dunkebglrere dunkebglreer dunkebglrere dunkebglrree dunkebglrree
dunkebglerer dunkebglerre dunkebgleerr dunkebgleerr dunkebglerer dunkebglerre dunkebgleerr dunkebgleerr dunkebglerer
dunkebglerre dunkebglerre dunkebglerer dunkebglreer dunkebglrere dunkebglreer dunkebglrere dunkebglrree dunkebglrree
dunkebgerler dunkebgerlre dunkebgerelr dunkebgererl dunkebgerrel dunkebgerrle dunkebgelrer dunkebgelrre dunkebgelerr
dunkebgelerr dunkebgelrer dunkebgelrre dunkebgeelrr dunkebgeelrr dunkebgeerlr dunkebgeerrl dunkebgeerrl dunkebgeerlr
dunkebgerler dunkebgerlre dunkebgerelr dunkebgererl dunkebgerrel dunkebgerrle dunkebgrrlee dunkebgrrlee dunkebgrrele
dunkebgrreel dunkebgrreel dunkebgrrele dunkebgrlree dunkebgrlree dunkebgrlere dunkebgrleer dunkebgrleer dunkebgrlere
dunkebgrelre dunkebgreler dunkebgrerle dunkebgrerel dunkebgreerl dunkebgreelr dunkebgreler dunkebgrelre dunkebgreelr
dunkebgreerl dunkebgrerel dunkebgrerle dunkebeerglr dunkebeergrl dunkebeerlgr dunkebeerlrg dunkebeerrlg dunkebeerrgl
dunkebeegrlr dunkebeegrrl dunkebeeglrr dunkebeeglrr dunkebeegrlr dunkebeegrrl dunkebeelgrr dunkebeelgrr dunkebeelrgr
dunkebeelrrg dunkebeelrrg dunkebeelrgr dunkebeerglr dunkebeergrl dunkebeerlgr dunkebeerlrg dunkebeerrlg dunkebeerrgl
dunkebereglr dunkeberegrl dunkeberelgr dunkeberelrg dunkebererlg dunkeberergl dunkebergelr dunkebergerl dunkebergler
dunkeberglre dunkebergrle dunkebergrel dunkeberlger dunkeberlgre dunkeberlegr dunkeberlerg dunkeberlreg dunkeberlrge
dunkeberrgle dunkeberrgel dunkeberrlge dunkeberrleg dunkeberrelg dunkeberregl dunkebegrelr dunkebegrerl dunkebegrler
dunkebegrlre dunkebegrrle dunkebegrrel dunkebegerlr dunkebegerrl dunkebegelrr dunkebegelrr dunkebegerlr dunkebegerrl
dunkebeglerr dunkebeglerr dunkebeglrer dunkebeglrre dunkebeglrre dunkebeglrer dunkebegrelr dunkebegrerl dunkebegrler
dunkebegrlre dunkebegrrle dunkebegrrel dunkebelrger dunkebelrgre dunkebelregr dunkebelrerg dunkebelrreg dunkebelrrge
dunkebelgrer dunkebelgrre dunkebelgerr dunkebelgerr dunkebelgrer dunkebelgrre dunkebelegrr dunkebelegrr dunkebelergr
dunkebelerrg dunkebelerrg dunkebelergr dunkebelrger dunkebelrgre dunkebelregr dunkebelrerg dunkebelrreg dunkebelrrge
dunkeberrgle dunkeberrgel dunkeberrlge dunkeberrleg dunkeberrelg dunkeberregl dunkebergrle dunkebergrel dunkeberglre
dunkebergler dunkebergelr dunkebergerl dunkeberlgre dunkeberlger dunkeberlrge dunkeberlreg dunkeberlerg dunkeberlegr
dunkebereglr dunkeberegrl dunkeberelgr dunkeberelrg dunkebererlg dunkeberergl dunkebrergel dunkebrergle dunkebreregl
dunkebrerelg dunkebrerleg dunkebrerlge dunkebregrel dunkebregrle dunkebregerl dunkebregelr dunkebregler dunkebreglre
dunkebreegrl dunkebreeglr dunkebreergl dunkebreerlg dunkebreelrg dunkebreelgr dunkebrelger dunkebrelgre dunkebrelegr
dunkebrelerg dunkebrelreg dunkebrelrge dunkebrregel dunkebrregle dunkebrreegl dunkebrreelg dunkebrreleg dunkebrrelge
dunkebrrgeel dunkebrrgele dunkebrrgeel dunkebrrgele dunkebrrglee dunkebrrglee dunkebrregel dunkebrregle dunkebrreegl
dunkebrreelg dunkebrreleg dunkebrrelge dunkebrrlgee dunkebrrlgee dunkebrrlege dunkebrrleeg dunkebrrleeg dunkebrrlege
dunkebrgreel dunkebrgrele dunkebrgreel dunkebrgrele dunkebrgrlee dunkebrgrlee dunkebrgerel dunkebrgerle dunkebrgeerl
dunkebrgeelr dunkebrgeler dunkebrgelre dunkebrgeerl dunkebrgeelr dunkebrgerel dunkebrgerle dunkebrgelre dunkebrgeler
dunkebrgleer dunkebrglere dunkebrgleer dunkebrglere dunkebrglree dunkebrglree dunkebrergel dunkebrergle dunkebreregl
dunkebrerelg dunkebrerleg dunkebrerlge dunkebregrel dunkebregrle dunkebregerl dunkebregelr dunkebregler dunkebreglre
dunkebreegrl dunkebreeglr dunkebreergl dunkebreerlg dunkebreelrg dunkebreelgr dunkebrelger dunkebrelgre dunkebrelegr
dunkebrelerg dunkebrelreg dunkebrelrge dunkebrlrgee dunkebrlrgee dunkebrlrege dunkebrlreeg dunkebrlreeg dunkebrlrege
dunkebrlgree dunkebrlgree dunkebrlgere dunkebrlgeer dunkebrlgeer dunkebrlgere dunkebrlegre dunkebrleger dunkebrlerge
dunkebrlereg dunkebrleerg dunkebrleegr dunkebrleger dunkebrlegre dunkebrleegr dunkebrleerg dunkebrlereg dunkebrlerge
dunkeeblrger dunkeeblrgre dunkeeblregr dunkeeblrerg dunkeeblrreg dunkeeblrrge dunkeeblgrer dunkeeblgrre dunkeeblgerr
dunkeeblgerr dunkeeblgrer dunkeeblgrre dunkeeblegrr dunkeeblegrr dunkeeblergr dunkeeblerrg dunkeeblerrg dunkeeblergr
dunkeeblrger dunkeeblrgre dunkeeblregr dunkeeblrerg dunkeeblrreg dunkeeblrrge dunkeebrlger dunkeebrlgre dunkeebrlegr
dunkeebrlerg dunkeebrlreg dunkeebrlrge dunkeebrgler dunkeebrglre dunkeebrgelr dunkeebrgerl dunkeebrgrel dunkeebrgrle
dunkeebreglr dunkeebregrl dunkeebrelgr dunkeebrelrg dunkeebrerlg dunkeebrergl dunkeebrrgel dunkeebrrgle dunkeebrregl
dunkeebrrelg dunkeebrrleg dunkeebrrlge dunkeebgrler dunkeebgrlre dunkeebgrelr dunkeebgrerl dunkeebgrrel dunkeebgrrle
dunkeebglrer dunkeebglrre dunkeebglerr dunkeebglerr dunkeebglrer dunkeebglrre dunkeebgelrr dunkeebgelrr dunkeebgerlr
dunkeebgerrl dunkeebgerrl dunkeebgerlr dunkeebgrler dunkeebgrlre dunkeebgrelr dunkeebgrerl dunkeebgrrel dunkeebgrrle
dunkeeberglr dunkeebergrl dunkeeberlgr dunkeeberlrg dunkeeberrlg dunkeeberrgl dunkeebegrlr dunkeebegrrl dunkeebeglrr
dunkeebeglrr dunkeebegrlr dunkeebegrrl dunkeebelgrr dunkeebelgrr dunkeebelrgr dunkeebelrrg dunkeebelrrg dunkeebelrgr
dunkeeberglr dunkeebergrl dunkeeberlgr dunkeeberlrg dunkeeberrlg dunkeeberrgl dunkeebrrgel dunkeebrrgle dunkeebrregl
dunkeebrrelg dunkeebrrleg dunkeebrrlge dunkeebrgrel dunkeebrgrle dunkeebrgerl dunkeebrgelr dunkeebrgler dunkeebrglre
dunkeebregrl dunkeebreglr dunkeebrergl dunkeebrerlg dunkeebrelrg dunkeebrelgr dunkeebrlger dunkeebrlgre dunkeebrlegr
dunkeebrlerg dunkeebrlreg dunkeebrlrge dunkeelbrger dunkeelbrgre dunkeelbregr dunkeelbrerg dunkeelbrreg dunkeelbrrge
dunkeelbgrer dunkeelbgrre dunkeelbgerr dunkeelbgerr dunkeelbgrer dunkeelbgrre dunkeelbegrr dunkeelbegrr dunkeelbergr
dunkeelberrg dunkeelberrg dunkeelbergr dunkeelbrger dunkeelbrgre dunkeelbregr dunkeelbrerg dunkeelbrreg dunkeelbrrge
dunkeelrbger dunkeelrbgre dunkeelrbegr dunkeelrberg dunkeelrbreg dunkeelrbrge dunkeelrgber dunkeelrgbre dunkeelrgebr
dunkeelrgerb dunkeelrgreb dunkeelrgrbe dunkeelregbr dunkeelregrb dunkeelrebgr dunkeelrebrg dunkeelrerbg dunkeelrergb
dunkeelrrgeb dunkeelrrgbe dunkeelrregb dunkeelrrebg dunkeelrrbeg dunkeelrrbge dunkeelgrber dunkeelgrbre dunkeelgrebr
dunkeelgrerb dunkeelgrreb dunkeelgrrbe dunkeelgbrer dunkeelgbrre dunkeelgberr dunkeelgberr dunkeelgbrer dunkeelgbrre
dunkeelgebrr dunkeelgebrr dunkeelgerbr dunkeelgerrb dunkeelgerrb dunkeelgerbr dunkeelgrber dunkeelgrbre dunkeelgrebr
dunkeelgrerb dunkeelgrreb dunkeelgrrbe dunkeelergbr dunkeelergrb dunkeelerbgr dunkeelerbrg dunkeelerrbg dunkeelerrgb
dunkeelegrbr dunkeelegrrb dunkeelegbrr dunkeelegbrr dunkeelegrbr dunkeelegrrb dunkeelebgrr dunkeelebgrr dunkeelebrgr
dunkeelebrrg dunkeelebrrg dunkeelebrgr dunkeelergbr dunkeelergrb dunkeelerbgr dunkeelerbrg dunkeelerrbg dunkeelerrgb
dunkeelrrgeb dunkeelrrgbe dunkeelrregb dunkeelrrebg dunkeelrrbeg dunkeelrrbge dunkeelrgreb dunkeelrgrbe dunkeelrgerb
dunkeelrgebr dunkeelrgber dunkeelrgbre dunkeelregrb dunkeelregbr dunkeelrergb dunkeelrerbg dunkeelrebrg dunkeelrebgr
dunkeelrbger dunkeelrbgre dunkeelrbegr dunkeelrberg dunkeelrbreg dunkeelrbrge dunkeerlbger dunkeerlbgre dunkeerlbegr
dunkeerlberg dunkeerlbreg dunkeerlbrge dunkeerlgber dunkeerlgbre dunkeerlgebr dunkeerlgerb dunkeerlgreb dunkeerlgrbe
dunkeerlegbr dunkeerlegrb dunkeerlebgr dunkeerlebrg dunkeerlerbg dunkeerlergb dunkeerlrgeb dunkeerlrgbe dunkeerlregb
dunkeerlrebg dunkeerlrbeg dunkeerlrbge dunkeerblger dunkeerblgre dunkeerblegr dunkeerblerg dunkeerblreg dunkeerblrge
dunkeerbgler dunkeerbglre dunkeerbgelr dunkeerbgerl dunkeerbgrel dunkeerbgrle dunkeerbeglr dunkeerbegrl dunkeerbelgr
dunkeerbelrg dunkeerberlg dunkeerbergl dunkeerbrgel dunkeerbrgle dunkeerbregl dunkeerbrelg dunkeerbrleg dunkeerbrlge
dunkeergbler dunkeergblre dunkeergbelr dunkeergberl dunkeergbrel dunkeergbrle dunkeerglber dunkeerglbre dunkeerglebr
dunkeerglerb dunkeerglreb dunkeerglrbe dunkeergelbr dunkeergelrb dunkeergeblr dunkeergebrl dunkeergerbl dunkeergerlb
dunkeergrleb dunkeergrlbe dunkeergrelb dunkeergrebl dunkeergrbel dunkeergrble dunkeerebglr dunkeerebgrl dunkeereblgr
dunkeereblrg dunkeerebrlg dunkeerebrgl dunkeeregblr dunkeeregbrl dunkeereglbr dunkeereglrb dunkeeregrlb dunkeeregrbl
dunkeerelgbr dunkeerelgrb dunkeerelbgr dunkeerelbrg dunkeerelrbg dunkeerelrgb dunkeererglb dunkeerergbl dunkeererlgb
dunkeererlbg dunkeererblg dunkeererbgl dunkeerrbgel dunkeerrbgle dunkeerrbegl dunkeerrbelg dunkeerrbleg dunkeerrblge
dunkeerrgbel dunkeerrgble dunkeerrgebl dunkeerrgelb dunkeerrgleb dunkeerrglbe dunkeerregbl dunkeerreglb dunkeerrebgl
dunkeerreblg dunkeerrelbg dunkeerrelgb dunkeerrlgeb dunkeerrlgbe dunkeerrlegb dunkeerrlebg dunkeerrlbeg dunkeerrlbge
dunkeeglrber dunkeeglrbre dunkeeglrebr dunkeeglrerb dunkeeglrreb dunkeeglrrbe dunkeeglbrer dunkeeglbrre dunkeeglberr
dunkeeglberr dunkeeglbrer dunkeeglbrre dunkeeglebrr dunkeeglebrr dunkeeglerbr dunkeeglerrb dunkeeglerrb dunkeeglerbr
dunkeeglrber dunkeeglrbre dunkeeglrebr dunkeeglrerb dunkeeglrreb dunkeeglrrbe dunkeegrlber dunkeegrlbre dunkeegrlebr
dunkeegrlerb dunkeegrlreb dunkeegrlrbe dunkeegrbler dunkeegrblre dunkeegrbelr dunkeegrberl dunkeegrbrel dunkeegrbrle
dunkeegreblr dunkeegrebrl dunkeegrelbr dunkeegrelrb dunkeegrerlb dunkeegrerbl dunkeegrrbel dunkeegrrble dunkeegrrebl
dunkeegrrelb dunkeegrrleb dunkeegrrlbe dunkeegbrler dunkeegbrlre dunkeegbrelr dunkeegbrerl dunkeegbrrel dunkeegbrrle
dunkeegblrer dunkeegblrre dunkeegblerr dunkeegblerr dunkeegblrer dunkeegblrre dunkeegbelrr dunkeegbelrr dunkeegberlr
dunkeegberrl dunkeegberrl dunkeegberlr dunkeegbrler dunkeegbrlre dunkeegbrelr dunkeegbrerl dunkeegbrrel dunkeegbrrle
dunkeegerblr dunkeegerbrl dunkeegerlbr dunkeegerlrb dunkeegerrlb dunkeegerrbl dunkeegebrlr dunkeegebrrl dunkeegeblrr
dunkeegeblrr dunkeegebrlr dunkeegebrrl dunkeegelbrr dunkeegelbrr dunkeegelrbr dunkeegelrrb dunkeegelrrb dunkeegelrbr
dunkeegerblr dunkeegerbrl dunkeegerlbr dunkeegerlrb dunkeegerrlb dunkeegerrbl dunkeegrrbel dunkeegrrble dunkeegrrebl
dunkeegrrelb dunkeegrrleb dunkeegrrlbe dunkeegrbrel dunkeegrbrle dunkeegrberl dunkeegrbelr dunkeegrbler dunkeegrblre
dunkeegrebrl dunkeegreblr dunkeegrerbl dunkeegrerlb dunkeegrelrb dunkeegrelbr dunkeegrlber dunkeegrlbre dunkeegrlebr
dunkeegrlerb dunkeegrlreb dunkeegrlrbe dunkeeelrgbr dunkeeelrgrb dunkeeelrbgr dunkeeelrbrg dunkeeelrrbg dunkeeelrrgb
dunkeeelgrbr dunkeeelgrrb dunkeeelgbrr dunkeeelgbrr dunkeeelgrbr dunkeeelgrrb dunkeeelbgrr dunkeeelbgrr dunkeeelbrgr
dunkeeelbrrg dunkeeelbrrg dunkeeelbrgr dunkeeelrgbr dunkeeelrgrb dunkeeelrbgr dunkeeelrbrg dunkeeelrrbg dunkeeelrrgb
dunkeeerlgbr dunkeeerlgrb dunkeeerlbgr dunkeeerlbrg dunkeeerlrbg dunkeeerlrgb dunkeeerglbr dunkeeerglrb dunkeeergblr
dunkeeergbrl dunkeeergrbl dunkeeergrlb dunkeeerbglr dunkeeerbgrl dunkeeerblgr dunkeeerblrg dunkeeerbrlg dunkeeerbrgl
dunkeeerrgbl dunkeeerrglb dunkeeerrbgl dunkeeerrblg dunkeeerrlbg dunkeeerrlgb dunkeeegrlbr dunkeeegrlrb dunkeeegrblr
dunkeeegrbrl dunkeeegrrbl dunkeeegrrlb dunkeeeglrbr dunkeeeglrrb dunkeeeglbrr dunkeeeglbrr dunkeeeglrbr dunkeeeglrrb
dunkeeegblrr dunkeeegblrr dunkeeegbrlr dunkeeegbrrl dunkeeegbrrl dunkeeegbrlr dunkeeegrlbr dunkeeegrlrb dunkeeegrblr
dunkeeegrbrl dunkeeegrrbl dunkeeegrrlb dunkeeebrglr dunkeeebrgrl dunkeeebrlgr dunkeeebrlrg dunkeeebrrlg dunkeeebrrgl
dunkeeebgrlr dunkeeebgrrl dunkeeebglrr dunkeeebglrr dunkeeebgrlr dunkeeebgrrl dunkeeeblgrr dunkeeeblgrr dunkeeeblrgr
dunkeeeblrrg dunkeeeblrrg dunkeeeblrgr dunkeeebrglr dunkeeebrgrl dunkeeebrlgr dunkeeebrlrg dunkeeebrrlg dunkeeebrrgl
dunkeeerrgbl dunkeeerrglb dunkeeerrbgl dunkeeerrblg dunkeeerrlbg dunkeeerrlgb dunkeeergrbl dunkeeergrlb dunkeeergbrl
dunkeeergblr dunkeeerglbr dunkeeerglrb dunkeeerbgrl dunkeeerbglr dunkeeerbrgl dunkeeerbrlg dunkeeerblrg dunkeeerblgr
dunkeeerlgbr dunkeeerlgrb dunkeeerlbgr dunkeeerlbrg dunkeeerlrbg dunkeeerlrgb dunkeerlrgeb dunkeerlrgbe dunkeerlregb
dunkeerlrebg dunkeerlrbeg dunkeerlrbge dunkeerlgreb dunkeerlgrbe dunkeerlgerb dunkeerlgebr dunkeerlgber dunkeerlgbre
dunkeerlegrb dunkeerlegbr dunkeerlergb dunkeerlerbg dunkeerlebrg dunkeerlebgr dunkeerlbger dunkeerlbgre dunkeerlbegr
dunkeerlberg dunkeerlbreg dunkeerlbrge dunkeerrlgeb dunkeerrlgbe dunkeerrlegb dunkeerrlebg dunkeerrlbeg dunkeerrlbge
dunkeerrgleb dunkeerrglbe dunkeerrgelb dunkeerrgebl dunkeerrgbel dunkeerrgble dunkeerreglb dunkeerregbl dunkeerrelgb
dunkeerrelbg dunkeerreblg dunkeerrebgl dunkeerrbgel dunkeerrbgle dunkeerrbegl dunkeerrbelg dunkeerrbleg dunkeerrblge
dunkeergrleb dunkeergrlbe dunkeergrelb dunkeergrebl dunkeergrbel dunkeergrble dunkeerglreb dunkeerglrbe dunkeerglerb
dunkeerglebr dunkeerglber dunkeerglbre dunkeergelrb dunkeergelbr dunkeergerlb dunkeergerbl dunkeergebrl dunkeergeblr
dunkeergbler dunkeergblre dunkeergbelr dunkeergberl dunkeergbrel dunkeergbrle dunkeererglb dunkeerergbl dunkeererlgb
dunkeererlbg dunkeererblg dunkeererbgl dunkeeregrlb dunkeeregrbl dunkeereglrb dunkeereglbr dunkeeregblr dunkeeregbrl
dunkeerelgrb dunkeerelgbr dunkeerelrgb dunkeerelrbg dunkeerelbrg dunkeerelbgr dunkeerebglr dunkeerebgrl dunkeereblgr
dunkeereblrg dunkeerebrlg dunkeerebrgl dunkeerbrgel dunkeerbrgle dunkeerbregl dunkeerbrelg dunkeerbrleg dunkeerbrlge
dunkeerbgrel dunkeerbgrle dunkeerbgerl dunkeerbgelr dunkeerbgler dunkeerbglre dunkeerbegrl dunkeerbeglr dunkeerbergl
dunkeerberlg dunkeerbelrg dunkeerbelgr dunkeerblger dunkeerblgre dunkeerblegr dunkeerblerg dunkeerblreg dunkeerblrge
dunkerbelger dunkerbelgre dunkerbelegr dunkerbelerg dunkerbelreg dunkerbelrge dunkerbegler dunkerbeglre dunkerbegelr
dunkerbegerl dunkerbegrel dunkerbegrle dunkerbeeglr dunkerbeegrl dunkerbeelgr dunkerbeelrg dunkerbeerlg dunkerbeergl
dunkerbergel dunkerbergle dunkerberegl dunkerberelg dunkerberleg dunkerberlge dunkerbleger dunkerblegre dunkerbleegr
dunkerbleerg dunkerblereg dunkerblerge dunkerblgeer dunkerblgere dunkerblgeer dunkerblgere dunkerblgree dunkerblgree
dunkerbleger dunkerblegre dunkerbleegr dunkerbleerg dunkerblereg dunkerblerge dunkerblrgee dunkerblrgee dunkerblrege
dunkerblreeg dunkerblreeg dunkerblrege dunkerbgleer dunkerbglere dunkerbgleer dunkerbglere dunkerbglree dunkerbglree
dunkerbgeler dunkerbgelre dunkerbgeelr dunkerbgeerl dunkerbgerel dunkerbgerle dunkerbgeelr dunkerbgeerl dunkerbgeler
dunkerbgelre dunkerbgerle dunkerbgerel dunkerbgreel dunkerbgrele dunkerbgreel dunkerbgrele dunkerbgrlee dunkerbgrlee
dunkerbelger dunkerbelgre dunkerbelegr dunkerbelerg dunkerbelreg dunkerbelrge dunkerbegler dunkerbeglre dunkerbegelr
dunkerbegerl dunkerbegrel dunkerbegrle dunkerbeeglr dunkerbeegrl dunkerbeelgr dunkerbeelrg dunkerbeerlg dunkerbeergl
dunkerbergel dunkerbergle dunkerberegl dunkerberelg dunkerberleg dunkerberlge dunkerbrlgee dunkerbrlgee dunkerbrlege
dunkerbrleeg dunkerbrleeg dunkerbrlege dunkerbrglee dunkerbrglee dunkerbrgele dunkerbrgeel dunkerbrgeel dunkerbrgele
dunkerbregle dunkerbregel dunkerbrelge dunkerbreleg dunkerbreelg dunkerbreegl dunkerbregel dunkerbregle dunkerbreegl
dunkerbreelg dunkerbreleg dunkerbrelge dunkereblger dunkereblgre dunkereblegr dunkereblerg dunkereblreg dunkereblrge
dunkerebgler dunkerebglre dunkerebgelr dunkerebgerl dunkerebgrel dunkerebgrle dunkerebeglr dunkerebegrl dunkerebelgr
dunkerebelrg dunkereberlg dunkerebergl dunkerebrgel dunkerebrgle dunkerebregl dunkerebrelg dunkerebrleg dunkerebrlge
dunkerelbger dunkerelbgre dunkerelbegr dunkerelberg dunkerelbreg dunkerelbrge dunkerelgber dunkerelgbre dunkerelgebr
dunkerelgerb dunkerelgreb dunkerelgrbe dunkerelegbr dunkerelegrb dunkerelebgr dunkerelebrg dunkerelerbg dunkerelergb
dunkerelrgeb dunkerelrgbe dunkerelregb dunkerelrebg dunkerelrbeg dunkerelrbge dunkereglber dunkereglbre dunkereglebr
dunkereglerb dunkereglreb dunkereglrbe dunkeregbler dunkeregblre dunkeregbelr dunkeregberl dunkeregbrel dunkeregbrle
dunkeregeblr dunkeregebrl dunkeregelbr dunkeregelrb dunkeregerlb dunkeregerbl dunkeregrbel dunkeregrble dunkeregrebl
dunkeregrelb dunkeregrleb dunkeregrlbe dunkereelgbr dunkereelgrb dunkereelbgr dunkereelbrg dunkereelrbg dunkereelrgb
dunkereeglbr dunkereeglrb dunkereegblr dunkereegbrl dunkereegrbl dunkereegrlb dunkereebglr dunkereebgrl dunkereeblgr
dunkereeblrg dunkereebrlg dunkereebrgl dunkereergbl dunkereerglb dunkereerbgl dunkereerblg dunkereerlbg dunkereerlgb
dunkererlgeb dunkererlgbe dunkererlegb dunkererlebg dunkererlbeg dunkererlbge dunkerergleb dunkererglbe dunkerergelb
dunkerergebl dunkerergbel dunkerergble dunkerereglb dunkereregbl dunkererelgb dunkererelbg dunkerereblg dunkererebgl
dunkererbgel dunkererbgle dunkererbegl dunkererbelg dunkererbleg dunkererblge dunkerlebger dunkerlebgre dunkerlebegr
dunkerleberg dunkerlebreg dunkerlebrge dunkerlegber dunkerlegbre dunkerlegebr dunkerlegerb dunkerlegreb dunkerlegrbe
dunkerleegbr dunkerleegrb dunkerleebgr dunkerleebrg dunkerleerbg dunkerleergb dunkerlergeb dunkerlergbe dunkerleregb
dunkerlerebg dunkerlerbeg dunkerlerbge dunkerlbeger dunkerlbegre dunkerlbeegr dunkerlbeerg dunkerlbereg dunkerlberge
dunkerlbgeer dunkerlbgere dunkerlbgeer dunkerlbgere dunkerlbgree dunkerlbgree dunkerlbeger dunkerlbegre dunkerlbeegr
dunkerlbeerg dunkerlbereg dunkerlberge dunkerlbrgee dunkerlbrgee dunkerlbrege dunkerlbreeg dunkerlbreeg dunkerlbrege
dunkerlgbeer dunkerlgbere dunkerlgbeer dunkerlgbere dunkerlgbree dunkerlgbree dunkerlgeber dunkerlgebre dunkerlgeebr
dunkerlgeerb dunkerlgereb dunkerlgerbe dunkerlgeebr dunkerlgeerb dunkerlgeber dunkerlgebre dunkerlgerbe dunkerlgereb
dunkerlgreeb dunkerlgrebe dunkerlgreeb dunkerlgrebe dunkerlgrbee dunkerlgrbee dunkerlebger dunkerlebgre dunkerlebegr
dunkerleberg dunkerlebreg dunkerlebrge dunkerlegber dunkerlegbre dunkerlegebr dunkerlegerb dunkerlegreb dunkerlegrbe
dunkerleegbr dunkerleegrb dunkerleebgr dunkerleebrg dunkerleerbg dunkerleergb dunkerlergeb dunkerlergbe dunkerleregb
dunkerlerebg dunkerlerbeg dunkerlerbge dunkerlrbgee dunkerlrbgee dunkerlrbege dunkerlrbeeg dunkerlrbeeg dunkerlrbege
dunkerlrgbee dunkerlrgbee dunkerlrgebe dunkerlrgeeb dunkerlrgeeb dunkerlrgebe dunkerlregbe dunkerlregeb dunkerlrebge
dunkerlrebeg dunkerlreebg dunkerlreegb dunkerlregeb dunkerlregbe dunkerlreegb dunkerlreebg dunkerlrebeg dunkerlrebge
dunkergelber dunkergelbre dunkergelebr dunkergelerb dunkergelreb dunkergelrbe dunkergebler dunkergeblre dunkergebelr
dunkergeberl dunkergebrel dunkergebrle dunkergeeblr dunkergeebrl dunkergeelbr dunkergeelrb dunkergeerlb dunkergeerbl
dunkergerbel dunkergerble dunkergerebl dunkergerelb dunkergerleb dunkergerlbe dunkergleber dunkerglebre dunkergleebr
dunkergleerb dunkerglereb dunkerglerbe dunkerglbeer dunkerglbere dunkerglbeer dunkerglbere dunkerglbree dunkerglbree
dunkergleber dunkerglebre dunkergleebr dunkergleerb dunkerglereb dunkerglerbe dunkerglrbee dunkerglrbee dunkerglrebe
dunkerglreeb dunkerglreeb dunkerglrebe dunkergbleer dunkergblere dunkergbleer dunkergblere dunkergblree dunkergblree
dunkergbeler dunkergbelre dunkergbeelr dunkergbeerl dunkergberel dunkergberle dunkergbeelr dunkergbeerl dunkergbeler
dunkergbelre dunkergberle dunkergberel dunkergbreel dunkergbrele dunkergbreel dunkergbrele dunkergbrlee dunkergbrlee
dunkergelber dunkergelbre dunkergelebr dunkergelerb dunkergelreb dunkergelrbe dunkergebler dunkergeblre dunkergebelr
dunkergeberl dunkergebrel dunkergebrle dunkergeeblr dunkergeebrl dunkergeelbr dunkergeelrb dunkergeerlb dunkergeerbl
dunkergerbel dunkergerble dunkergerebl dunkergerelb dunkergerleb dunkergerlbe dunkergrlbee dunkergrlbee dunkergrlebe
dunkergrleeb dunkergrleeb dunkergrlebe dunkergrblee dunkergrblee dunkergrbele dunkergrbeel dunkergrbeel dunkergrbele
dunkergreble dunkergrebel dunkergrelbe dunkergreleb dunkergreelb dunkergreebl dunkergrebel dunkergreble dunkergreebl
dunkergreelb dunkergreleb dunkergrelbe dunkereelgbr dunkereelgrb dunkereelbgr dunkereelbrg dunkereelrbg dunkereelrgb
dunkereeglbr dunkereeglrb dunkereegblr dunkereegbrl dunkereegrbl dunkereegrlb dunkereebglr dunkereebgrl dunkereeblgr
dunkereeblrg dunkereebrlg dunkereebrgl dunkereergbl dunkereerglb dunkereerbgl dunkereerblg dunkereerlbg dunkereerlgb
dunkerelegbr dunkerelegrb dunkerelebgr dunkerelebrg dunkerelerbg dunkerelergb dunkerelgebr dunkerelgerb dunkerelgber
dunkerelgbre dunkerelgrbe dunkerelgreb dunkerelbger dunkerelbgre dunkerelbegr dunkerelberg dunkerelbreg dunkerelbrge
dunkerelrgbe dunkerelrgeb dunkerelrbge dunkerelrbeg dunkerelrebg dunkerelregb dunkereglebr dunkereglerb dunkereglber
dunkereglbre dunkereglrbe dunkereglreb dunkeregelbr dunkeregelrb dunkeregeblr dunkeregebrl dunkeregerbl dunkeregerlb
dunkeregbelr dunkeregberl dunkeregbler dunkeregblre dunkeregbrle dunkeregbrel dunkeregrebl dunkeregrelb dunkeregrbel
dunkeregrble dunkeregrlbe dunkeregrleb dunkereblger dunkereblgre dunkereblegr dunkereblerg dunkereblreg dunkereblrge
dunkerebgler dunkerebglre dunkerebgelr dunkerebgerl dunkerebgrel dunkerebgrle dunkerebeglr dunkerebegrl dunkerebelgr
dunkerebelrg dunkereberlg dunkerebergl dunkerebrgel dunkerebrgle dunkerebregl dunkerebrelg dunkerebrleg dunkerebrlge
dunkererlgbe dunkererlgeb dunkererlbge dunkererlbeg dunkererlebg dunkererlegb dunkererglbe dunkerergleb dunkerergble
dunkerergbel dunkerergebl dunkerergelb dunkererbgle dunkererbgel dunkererblge dunkererbleg dunkererbelg dunkererbegl
dunkereregbl dunkerereglb dunkererebgl dunkerereblg dunkererelbg dunkererelgb dunkerrelgeb dunkerrelgbe dunkerrelegb
dunkerrelebg dunkerrelbeg dunkerrelbge dunkerregleb dunkerreglbe dunkerregelb dunkerregebl dunkerregbel dunkerregble
dunkerreeglb dunkerreegbl dunkerreelgb dunkerreelbg dunkerreeblg dunkerreebgl dunkerrebgel dunkerrebgle dunkerrebegl
dunkerrebelg dunkerrebleg dunkerreblge dunkerrlegeb dunkerrlegbe dunkerrleegb dunkerrleebg dunkerrlebeg dunkerrlebge
dunkerrlgeeb dunkerrlgebe dunkerrlgeeb dunkerrlgebe dunkerrlgbee dunkerrlgbee dunkerrlegeb dunkerrlegbe dunkerrleegb
dunkerrleebg dunkerrlebeg dunkerrlebge dunkerrlbgee dunkerrlbgee dunkerrlbege dunkerrlbeeg dunkerrlbeeg dunkerrlbege
dunkerrgleeb dunkerrglebe dunkerrgleeb dunkerrglebe dunkerrglbee dunkerrglbee dunkerrgeleb dunkerrgelbe dunkerrgeelb
dunkerrgeebl dunkerrgebel dunkerrgeble dunkerrgeelb dunkerrgeebl dunkerrgeleb dunkerrgelbe dunkerrgeble dunkerrgebel
dunkerrgbeel dunkerrgbele dunkerrgbeel dunkerrgbele dunkerrgblee dunkerrgblee dunkerrelgeb dunkerrelgbe dunkerrelegb
dunkerrelebg dunkerrelbeg dunkerrelbge dunkerregleb dunkerreglbe dunkerregelb dunkerregebl dunkerregbel dunkerregble
dunkerreeglb dunkerreegbl dunkerreelgb dunkerreelbg dunkerreeblg dunkerreebgl dunkerrebgel dunkerrebgle dunkerrebegl
dunkerrebelg dunkerrebleg dunkerreblge dunkerrblgee dunkerrblgee dunkerrblege dunkerrbleeg dunkerrbleeg dunkerrblege
dunkerrbglee dunkerrbglee dunkerrbgele dunkerrbgeel dunkerrbgeel dunkerrbgele dunkerrbegle dunkerrbegel dunkerrbelge
dunkerrbeleg dunkerrbeelg dunkerrbeegl dunkerrbegel dunkerrbegle dunkerrbeegl dunkerrbeelg dunkerrbeleg dunkerrbelge
dunkegberler dunkegberlre dunkegberelr dunkegbererl dunkegberrel dunkegberrle dunkegbelrer dunkegbelrre dunkegbelerr
dunkegbelerr dunkegbelrer dunkegbelrre dunkegbeelrr dunkegbeelrr dunkegbeerlr dunkegbeerrl dunkegbeerrl dunkegbeerlr
dunkegberler dunkegberlre dunkegberelr dunkegbererl dunkegberrel dunkegberrle dunkegbreler dunkegbrelre dunkegbreelr
dunkegbreerl dunkegbrerel dunkegbrerle dunkegbrleer dunkegbrlere dunkegbrleer dunkegbrlere dunkegbrlree dunkegbrlree
dunkegbreler dunkegbrelre dunkegbreelr dunkegbreerl dunkegbrerel dunkegbrerle dunkegbrrlee dunkegbrrlee dunkegbrrele
dunkegbrreel dunkegbrreel dunkegbrrele dunkegblreer dunkegblrere dunkegblreer dunkegblrere dunkegblrree dunkegblrree
dunkegblerer dunkegblerre dunkegbleerr dunkegbleerr dunkegblerer dunkegblerre dunkegbleerr dunkegbleerr dunkegblerer
dunkegblerre dunkegblerre dunkegblerer dunkegblreer dunkegblrere dunkegblreer dunkegblrere dunkegblrree dunkegblrree
dunkegberler dunkegberlre dunkegberelr dunkegbererl dunkegberrel dunkegberrle dunkegbelrer dunkegbelrre dunkegbelerr
dunkegbelerr dunkegbelrer dunkegbelrre dunkegbeelrr dunkegbeelrr dunkegbeerlr dunkegbeerrl dunkegbeerrl dunkegbeerlr
dunkegberler dunkegberlre dunkegberelr dunkegbererl dunkegberrel dunkegberrle dunkegbrrlee dunkegbrrlee dunkegbrrele
dunkegbrreel dunkegbrreel dunkegbrrele dunkegbrlree dunkegbrlree dunkegbrlere dunkegbrleer dunkegbrleer dunkegbrlere
dunkegbrelre dunkegbreler dunkegbrerle dunkegbrerel dunkegbreerl dunkegbreelr dunkegbreler dunkegbrelre dunkegbreelr
dunkegbreerl dunkegbrerel dunkegbrerle dunkegebrler dunkegebrlre dunkegebrelr dunkegebrerl dunkegebrrel dunkegebrrle
dunkegeblrer dunkegeblrre dunkegeblerr dunkegeblerr dunkegeblrer dunkegeblrre dunkegebelrr dunkegebelrr dunkegeberlr
dunkegeberrl dunkegeberrl dunkegeberlr dunkegebrler dunkegebrlre dunkegebrelr dunkegebrerl dunkegebrrel dunkegebrrle
dunkegerbler dunkegerblre dunkegerbelr dunkegerberl dunkegerbrel dunkegerbrle dunkegerlber dunkegerlbre dunkegerlebr
dunkegerlerb dunkegerlreb dunkegerlrbe dunkegerelbr dunkegerelrb dunkegereblr dunkegerebrl dunkegererbl dunkegererlb
dunkegerrleb dunkegerrlbe dunkegerrelb dunkegerrebl dunkegerrbel dunkegerrble dunkegelrber dunkegelrbre dunkegelrebr
dunkegelrerb dunkegelrreb dunkegelrrbe dunkegelbrer dunkegelbrre dunkegelberr dunkegelberr dunkegelbrer dunkegelbrre
dunkegelebrr dunkegelebrr dunkegelerbr dunkegelerrb dunkegelerrb dunkegelerbr dunkegelrber dunkegelrbre dunkegelrebr
dunkegelrerb dunkegelrreb dunkegelrrbe dunkegeerlbr dunkegeerlrb dunkegeerblr dunkegeerbrl dunkegeerrbl dunkegeerrlb
dunkegeelrbr dunkegeelrrb dunkegeelbrr dunkegeelbrr dunkegeelrbr dunkegeelrrb dunkegeeblrr dunkegeeblrr dunkegeebrlr
dunkegeebrrl dunkegeebrrl dunkegeebrlr dunkegeerlbr dunkegeerlrb dunkegeerblr dunkegeerbrl dunkegeerrbl dunkegeerrlb
dunkegerrleb dunkegerrlbe dunkegerrelb dunkegerrebl dunkegerrbel dunkegerrble dunkegerlreb dunkegerlrbe dunkegerlerb
dunkegerlebr dunkegerlber dunkegerlbre dunkegerelrb dunkegerelbr dunkegererlb dunkegererbl dunkegerebrl dunkegereblr
dunkegerbler dunkegerblre dunkegerbelr dunkegerberl dunkegerbrel dunkegerbrle dunkegrebler dunkegreblre dunkegrebelr
dunkegreberl dunkegrebrel dunkegrebrle dunkegrelber dunkegrelbre dunkegrelebr dunkegrelerb dunkegrelreb dunkegrelrbe
dunkegreelbr dunkegreelrb dunkegreeblr dunkegreebrl dunkegreerbl dunkegreerlb dunkegrerleb dunkegrerlbe dunkegrerelb
dunkegrerebl dunkegrerbel dunkegrerble dunkegrbeler dunkegrbelre dunkegrbeelr dunkegrbeerl dunkegrberel dunkegrberle
dunkegrbleer dunkegrblere dunkegrbleer dunkegrblere dunkegrblree dunkegrblree dunkegrbeler dunkegrbelre dunkegrbeelr
dunkegrbeerl dunkegrberel dunkegrberle dunkegrbrlee dunkegrbrlee dunkegrbrele dunkegrbreel dunkegrbreel dunkegrbrele
dunkegrlbeer dunkegrlbere dunkegrlbeer dunkegrlbere dunkegrlbree dunkegrlbree dunkegrleber dunkegrlebre dunkegrleebr
dunkegrleerb dunkegrlereb dunkegrlerbe dunkegrleebr dunkegrleerb dunkegrleber dunkegrlebre dunkegrlerbe dunkegrlereb
dunkegrlreeb dunkegrlrebe dunkegrlreeb dunkegrlrebe dunkegrlrbee dunkegrlrbee dunkegrebler dunkegreblre dunkegrebelr
dunkegreberl dunkegrebrel dunkegrebrle dunkegrelber dunkegrelbre dunkegrelebr dunkegrelerb dunkegrelreb dunkegrelrbe
dunkegreelbr dunkegreelrb dunkegreeblr dunkegreebrl dunkegreerbl dunkegreerlb dunkegrerleb dunkegrerlbe dunkegrerelb
dunkegrerebl dunkegrerbel dunkegrerble dunkegrrblee dunkegrrblee dunkegrrbele dunkegrrbeel dunkegrrbeel dunkegrrbele
dunkegrrlbee dunkegrrlbee dunkegrrlebe dunkegrrleeb dunkegrrleeb dunkegrrlebe dunkegrrelbe dunkegrreleb dunkegrreble
dunkegrrebel dunkegrreebl dunkegrreelb dunkegrreleb dunkegrrelbe dunkegrreelb dunkegrreebl dunkegrrebel dunkegrreble
dunkeglerber dunkeglerbre dunkeglerebr dunkeglererb dunkeglerreb dunkeglerrbe dunkeglebrer dunkeglebrre dunkegleberr
dunkegleberr dunkeglebrer dunkeglebrre dunkegleebrr dunkegleebrr dunkegleerbr dunkegleerrb dunkegleerrb dunkegleerbr
dunkeglerber dunkeglerbre dunkeglerebr dunkeglererb dunkeglerreb dunkeglerrbe dunkeglreber dunkeglrebre dunkeglreebr
dunkeglreerb dunkeglrereb dunkeglrerbe dunkeglrbeer dunkeglrbere dunkeglrbeer dunkeglrbere dunkeglrbree dunkeglrbree
dunkeglreber dunkeglrebre dunkeglreebr dunkeglreerb dunkeglrereb dunkeglrerbe dunkeglrrbee dunkeglrrbee dunkeglrrebe
dunkeglrreeb dunkeglrreeb dunkeglrrebe dunkeglbreer dunkeglbrere dunkeglbreer dunkeglbrere dunkeglbrree dunkeglbrree
dunkeglberer dunkeglberre dunkeglbeerr dunkeglbeerr dunkeglberer dunkeglberre dunkeglbeerr dunkeglbeerr dunkeglberer
dunkeglberre dunkeglberre dunkeglberer dunkeglbreer dunkeglbrere dunkeglbreer dunkeglbrere dunkeglbrree dunkeglbrree
dunkeglerber dunkeglerbre dunkeglerebr dunkeglererb dunkeglerreb dunkeglerrbe dunkeglebrer dunkeglebrre dunkegleberr
dunkegleberr dunkeglebrer dunkeglebrre dunkegleebrr dunkegleebrr dunkegleerbr dunkegleerrb dunkegleerrb dunkegleerbr
dunkeglerber dunkeglerbre dunkeglerebr dunkeglererb dunkeglerreb dunkeglerrbe dunkeglrrbee dunkeglrrbee dunkeglrrebe
dunkeglrreeb dunkeglrreeb dunkeglrrebe dunkeglrbree dunkeglrbree dunkeglrbere dunkeglrbeer dunkeglrbeer dunkeglrbere
dunkeglrebre dunkeglreber dunkeglrerbe dunkeglrereb dunkeglreerb dunkeglreebr dunkeglreber dunkeglrebre dunkeglreebr
dunkeglreerb dunkeglrereb dunkeglrerbe dunkegeerlbr dunkegeerlrb dunkegeerblr dunkegeerbrl dunkegeerrbl dunkegeerrlb
dunkegeelrbr dunkegeelrrb dunkegeelbrr dunkegeelbrr dunkegeelrbr dunkegeelrrb dunkegeeblrr dunkegeeblrr dunkegeebrlr
dunkegeebrrl dunkegeebrrl dunkegeebrlr dunkegeerlbr dunkegeerlrb dunkegeerblr dunkegeerbrl dunkegeerrbl dunkegeerrlb
dunkegerelbr dunkegerelrb dunkegereblr dunkegerebrl dunkegererbl dunkegererlb dunkegerlebr dunkegerlerb dunkegerlber
dunkegerlbre dunkegerlrbe dunkegerlreb dunkegerbler dunkegerblre dunkegerbelr dunkegerberl dunkegerbrel dunkegerbrle
dunkegerrlbe dunkegerrleb dunkegerrble dunkegerrbel dunkegerrebl dunkegerrelb dunkegelrebr dunkegelrerb dunkegelrber
dunkegelrbre dunkegelrrbe dunkegelrreb dunkegelerbr dunkegelerrb dunkegelebrr dunkegelebrr dunkegelerbr dunkegelerrb
dunkegelberr dunkegelberr dunkegelbrer dunkegelbrre dunkegelbrre dunkegelbrer dunkegelrebr dunkegelrerb dunkegelrber
dunkegelrbre dunkegelrrbe dunkegelrreb dunkegebrler dunkegebrlre dunkegebrelr dunkegebrerl dunkegebrrel dunkegebrrle
dunkegeblrer dunkegeblrre dunkegeblerr dunkegeblerr dunkegeblrer dunkegeblrre dunkegebelrr dunkegebelrr dunkegeberlr
dunkegeberrl dunkegeberrl dunkegeberlr dunkegebrler dunkegebrlre dunkegebrelr dunkegebrerl dunkegebrrel dunkegebrrle
dunkegerrlbe dunkegerrleb dunkegerrble dunkegerrbel dunkegerrebl dunkegerrelb dunkegerlrbe dunkegerlreb dunkegerlbre
dunkegerlber dunkegerlebr dunkegerlerb dunkegerblre dunkegerbler dunkegerbrle dunkegerbrel dunkegerberl dunkegerbelr
dunkegerelbr dunkegerelrb dunkegereblr dunkegerebrl dunkegererbl dunkegererlb dunkegrerleb dunkegrerlbe dunkegrerelb
dunkegrerebl dunkegrerbel dunkegrerble dunkegrelreb dunkegrelrbe dunkegrelerb dunkegrelebr dunkegrelber dunkegrelbre
dunkegreelrb dunkegreelbr dunkegreerlb dunkegreerbl dunkegreebrl dunkegreeblr dunkegrebler dunkegreblre dunkegrebelr
dunkegreberl dunkegrebrel dunkegrebrle dunkegrreleb dunkegrrelbe dunkegrreelb dunkegrreebl dunkegrrebel dunkegrreble
dunkegrrleeb dunkegrrlebe dunkegrrleeb dunkegrrlebe dunkegrrlbee dunkegrrlbee dunkegrreleb dunkegrrelbe dunkegrreelb
dunkegrreebl dunkegrrebel dunkegrreble dunkegrrblee dunkegrrblee dunkegrrbele dunkegrrbeel dunkegrrbeel dunkegrrbele
dunkegrlreeb dunkegrlrebe dunkegrlreeb dunkegrlrebe dunkegrlrbee dunkegrlrbee dunkegrlereb dunkegrlerbe dunkegrleerb
dunkegrleebr dunkegrleber dunkegrlebre dunkegrleerb dunkegrleebr dunkegrlereb dunkegrlerbe dunkegrlebre dunkegrleber
dunkegrlbeer dunkegrlbere dunkegrlbeer dunkegrlbere dunkegrlbree dunkegrlbree dunkegrerleb dunkegrerlbe dunkegrerelb
dunkegrerebl dunkegrerbel dunkegrerble dunkegrelreb dunkegrelrbe dunkegrelerb dunkegrelebr dunkegrelber dunkegrelbre
dunkegreelrb dunkegreelbr dunkegreerlb dunkegreerbl dunkegreebrl dunkegreeblr dunkegrebler dunkegreblre dunkegrebelr
dunkegreberl dunkegrebrel dunkegrebrle dunkegrbrlee dunkegrbrlee dunkegrbrele dunkegrbreel dunkegrbreel dunkegrbrele
dunkegrblree dunkegrblree dunkegrblere dunkegrbleer dunkegrbleer dunkegrblere dunkegrbelre dunkegrbeler dunkegrberle
dunkegrberel dunkegrbeerl dunkegrbeelr dunkegrbeler dunkegrbelre dunkegrbeelr dunkegrbeerl dunkegrberel dunkegrberle
dunkeeberglr dunkeebergrl dunkeeberlgr dunkeeberlrg dunkeeberrlg dunkeeberrgl dunkeebegrlr dunkeebegrrl dunkeebeglrr
dunkeebeglrr dunkeebegrlr dunkeebegrrl dunkeebelgrr dunkeebelgrr dunkeebelrgr dunkeebelrrg dunkeebelrrg dunkeebelrgr
dunkeeberglr dunkeebergrl dunkeeberlgr dunkeeberlrg dunkeeberrlg dunkeeberrgl dunkeebreglr dunkeebregrl dunkeebrelgr
dunkeebrelrg dunkeebrerlg dunkeebrergl dunkeebrgelr dunkeebrgerl dunkeebrgler dunkeebrglre dunkeebrgrle dunkeebrgrel
dunkeebrlger dunkeebrlgre dunkeebrlegr dunkeebrlerg dunkeebrlreg dunkeebrlrge dunkeebrrgle dunkeebrrgel dunkeebrrlge
dunkeebrrleg dunkeebrrelg dunkeebrregl dunkeebgrelr dunkeebgrerl dunkeebgrler dunkeebgrlre dunkeebgrrle dunkeebgrrel
dunkeebgerlr dunkeebgerrl dunkeebgelrr dunkeebgelrr dunkeebgerlr dunkeebgerrl dunkeebglerr dunkeebglerr dunkeebglrer
dunkeebglrre dunkeebglrre dunkeebglrer dunkeebgrelr dunkeebgrerl dunkeebgrler dunkeebgrlre dunkeebgrrle dunkeebgrrel
dunkeeblrger dunkeeblrgre dunkeeblregr dunkeeblrerg dunkeeblrreg dunkeeblrrge dunkeeblgrer dunkeeblgrre dunkeeblgerr
dunkeeblgerr dunkeeblgrer dunkeeblgrre dunkeeblegrr dunkeeblegrr dunkeeblergr dunkeeblerrg dunkeeblerrg dunkeeblergr
dunkeeblrger dunkeeblrgre dunkeeblregr dunkeeblrerg dunkeeblrreg dunkeeblrrge dunkeebrrgle dunkeebrrgel dunkeebrrlge
dunkeebrrleg dunkeebrrelg dunkeebrregl dunkeebrgrle dunkeebrgrel dunkeebrglre dunkeebrgler dunkeebrgelr dunkeebrgerl
dunkeebrlgre dunkeebrlger dunkeebrlrge dunkeebrlreg dunkeebrlerg dunkeebrlegr dunkeebreglr dunkeebregrl dunkeebrelgr
dunkeebrelrg dunkeebrerlg dunkeebrergl dunkeeebrglr dunkeeebrgrl dunkeeebrlgr dunkeeebrlrg dunkeeebrrlg dunkeeebrrgl
dunkeeebgrlr dunkeeebgrrl dunkeeebglrr dunkeeebglrr dunkeeebgrlr dunkeeebgrrl dunkeeeblgrr dunkeeeblgrr dunkeeeblrgr
dunkeeeblrrg dunkeeeblrrg dunkeeeblrgr dunkeeebrglr dunkeeebrgrl dunkeeebrlgr dunkeeebrlrg dunkeeebrrlg dunkeeebrrgl
dunkeeerbglr dunkeeerbgrl dunkeeerblgr dunkeeerblrg dunkeeerbrlg dunkeeerbrgl dunkeeergblr dunkeeergbrl dunkeeerglbr
dunkeeerglrb dunkeeergrlb dunkeeergrbl dunkeeerlgbr dunkeeerlgrb dunkeeerlbgr dunkeeerlbrg dunkeeerlrbg dunkeeerlrgb
dunkeeerrglb dunkeeerrgbl dunkeeerrlgb dunkeeerrlbg dunkeeerrblg dunkeeerrbgl dunkeeegrblr dunkeeegrbrl dunkeeegrlbr
dunkeeegrlrb dunkeeegrrlb dunkeeegrrbl dunkeeegbrlr dunkeeegbrrl dunkeeegblrr dunkeeegblrr dunkeeegbrlr dunkeeegbrrl
dunkeeeglbrr dunkeeeglbrr dunkeeeglrbr dunkeeeglrrb dunkeeeglrrb dunkeeeglrbr dunkeeegrblr dunkeeegrbrl dunkeeegrlbr
dunkeeegrlrb dunkeeegrrlb dunkeeegrrbl dunkeeelrgbr dunkeeelrgrb dunkeeelrbgr dunkeeelrbrg dunkeeelrrbg dunkeeelrrgb
dunkeeelgrbr dunkeeelgrrb dunkeeelgbrr dunkeeelgbrr dunkeeelgrbr dunkeeelgrrb dunkeeelbgrr dunkeeelbgrr dunkeeelbrgr
dunkeeelbrrg dunkeeelbrrg dunkeeelbrgr dunkeeelrgbr dunkeeelrgrb dunkeeelrbgr dunkeeelrbrg dunkeeelrrbg dunkeeelrrgb
dunkeeerrglb dunkeeerrgbl dunkeeerrlgb dunkeeerrlbg dunkeeerrblg dunkeeerrbgl dunkeeergrlb dunkeeergrbl dunkeeerglrb
dunkeeerglbr dunkeeergblr dunkeeergbrl dunkeeerlgrb dunkeeerlgbr dunkeeerlrgb dunkeeerlrbg dunkeeerlbrg dunkeeerlbgr
dunkeeerbglr dunkeeerbgrl dunkeeerblgr dunkeeerblrg dunkeeerbrlg dunkeeerbrgl dunkeerebglr dunkeerebgrl dunkeereblgr
dunkeereblrg dunkeerebrlg dunkeerebrgl dunkeeregblr dunkeeregbrl dunkeereglbr dunkeereglrb dunkeeregrlb dunkeeregrbl
dunkeerelgbr dunkeerelgrb dunkeerelbgr dunkeerelbrg dunkeerelrbg dunkeerelrgb dunkeererglb dunkeerergbl dunkeererlgb
dunkeererlbg dunkeererblg dunkeererbgl dunkeerbeglr dunkeerbegrl dunkeerbelgr dunkeerbelrg dunkeerberlg dunkeerbergl
dunkeerbgelr dunkeerbgerl dunkeerbgler dunkeerbglre dunkeerbgrle dunkeerbgrel dunkeerblger dunkeerblgre dunkeerblegr
dunkeerblerg dunkeerblreg dunkeerblrge dunkeerbrgle dunkeerbrgel dunkeerbrlge dunkeerbrleg dunkeerbrelg dunkeerbregl
dunkeergbelr dunkeergberl dunkeergbler dunkeergblre dunkeergbrle dunkeergbrel dunkeergeblr dunkeergebrl dunkeergelbr
dunkeergelrb dunkeergerlb dunkeergerbl dunkeerglebr dunkeerglerb dunkeerglber dunkeerglbre dunkeerglrbe dunkeerglreb
dunkeergrelb dunkeergrebl dunkeergrleb dunkeergrlbe dunkeergrble dunkeergrbel dunkeerlbger dunkeerlbgre dunkeerlbegr
dunkeerlberg dunkeerlbreg dunkeerlbrge dunkeerlgber dunkeerlgbre dunkeerlgebr dunkeerlgerb dunkeerlgreb dunkeerlgrbe
dunkeerlegbr dunkeerlegrb dunkeerlebgr dunkeerlebrg dunkeerlerbg dunkeerlergb dunkeerlrgeb dunkeerlrgbe dunkeerlregb
dunkeerlrebg dunkeerlrbeg dunkeerlrbge dunkeerrbgle dunkeerrbgel dunkeerrblge dunkeerrbleg dunkeerrbelg dunkeerrbegl
dunkeerrgble dunkeerrgbel dunkeerrglbe dunkeerrgleb dunkeerrgelb dunkeerrgebl dunkeerrlgbe dunkeerrlgeb dunkeerrlbge
dunkeerrlbeg dunkeerrlebg dunkeerrlegb dunkeerreglb dunkeerregbl dunkeerrelgb dunkeerrelbg dunkeerreblg dunkeerrebgl
dunkeegerblr dunkeegerbrl dunkeegerlbr dunkeegerlrb dunkeegerrlb dunkeegerrbl dunkeegebrlr dunkeegebrrl dunkeegeblrr
dunkeegeblrr dunkeegebrlr dunkeegebrrl dunkeegelbrr dunkeegelbrr dunkeegelrbr dunkeegelrrb dunkeegelrrb dunkeegelrbr
dunkeegerblr dunkeegerbrl dunkeegerlbr dunkeegerlrb dunkeegerrlb dunkeegerrbl dunkeegreblr dunkeegrebrl dunkeegrelbr
dunkeegrelrb dunkeegrerlb dunkeegrerbl dunkeegrbelr dunkeegrberl dunkeegrbler dunkeegrblre dunkeegrbrle dunkeegrbrel
dunkeegrlber dunkeegrlbre dunkeegrlebr dunkeegrlerb dunkeegrlreb dunkeegrlrbe dunkeegrrble dunkeegrrbel dunkeegrrlbe
dunkeegrrleb dunkeegrrelb dunkeegrrebl dunkeegbrelr dunkeegbrerl dunkeegbrler dunkeegbrlre dunkeegbrrle dunkeegbrrel
dunkeegberlr dunkeegberrl dunkeegbelrr dunkeegbelrr dunkeegberlr dunkeegberrl dunkeegblerr dunkeegblerr dunkeegblrer
dunkeegblrre dunkeegblrre dunkeegblrer dunkeegbrelr dunkeegbrerl dunkeegbrler dunkeegbrlre dunkeegbrrle dunkeegbrrel
dunkeeglrber dunkeeglrbre dunkeeglrebr dunkeeglrerb dunkeeglrreb dunkeeglrrbe dunkeeglbrer dunkeeglbrre dunkeeglberr
dunkeeglberr dunkeeglbrer dunkeeglbrre dunkeeglebrr dunkeeglebrr dunkeeglerbr dunkeeglerrb dunkeeglerrb dunkeeglerbr
dunkeeglrber dunkeeglrbre dunkeeglrebr dunkeeglrerb dunkeeglrreb dunkeeglrrbe dunkeegrrble dunkeegrrbel dunkeegrrlbe
dunkeegrrleb dunkeegrrelb dunkeegrrebl dunkeegrbrle dunkeegrbrel dunkeegrblre dunkeegrbler dunkeegrbelr dunkeegrberl
dunkeegrlbre dunkeegrlber dunkeegrlrbe dunkeegrlreb dunkeegrlerb dunkeegrlebr dunkeegreblr dunkeegrebrl dunkeegrelbr
dunkeegrelrb dunkeegrerlb dunkeegrerbl dunkeelergbr dunkeelergrb dunkeelerbgr dunkeelerbrg dunkeelerrbg dunkeelerrgb
dunkeelegrbr dunkeelegrrb dunkeelegbrr dunkeelegbrr dunkeelegrbr dunkeelegrrb dunkeelebgrr dunkeelebgrr dunkeelebrgr
dunkeelebrrg dunkeelebrrg dunkeelebrgr dunkeelergbr dunkeelergrb dunkeelerbgr dunkeelerbrg dunkeelerrbg dunkeelerrgb
dunkeelregbr dunkeelregrb dunkeelrebgr dunkeelrebrg dunkeelrerbg dunkeelrergb dunkeelrgebr dunkeelrgerb dunkeelrgber
dunkeelrgbre dunkeelrgrbe dunkeelrgreb dunkeelrbger dunkeelrbgre dunkeelrbegr dunkeelrberg dunkeelrbreg dunkeelrbrge
dunkeelrrgbe dunkeelrrgeb dunkeelrrbge dunkeelrrbeg dunkeelrrebg dunkeelrregb dunkeelgrebr dunkeelgrerb dunkeelgrber
dunkeelgrbre dunkeelgrrbe dunkeelgrreb dunkeelgerbr dunkeelgerrb dunkeelgebrr dunkeelgebrr dunkeelgerbr dunkeelgerrb
dunkeelgberr dunkeelgberr dunkeelgbrer dunkeelgbrre dunkeelgbrre dunkeelgbrer dunkeelgrebr dunkeelgrerb dunkeelgrber
dunkeelgrbre dunkeelgrrbe dunkeelgrreb dunkeelbrger dunkeelbrgre dunkeelbregr dunkeelbrerg dunkeelbrreg dunkeelbrrge
dunkeelbgrer dunkeelbgrre dunkeelbgerr dunkeelbgerr dunkeelbgrer dunkeelbgrre dunkeelbegrr dunkeelbegrr dunkeelbergr
dunkeelberrg dunkeelberrg dunkeelbergr dunkeelbrger dunkeelbrgre dunkeelbregr dunkeelbrerg dunkeelbrreg dunkeelbrrge
dunkeelrrgbe dunkeelrrgeb dunkeelrrbge dunkeelrrbeg dunkeelrrebg dunkeelrregb dunkeelrgrbe dunkeelrgreb dunkeelrgbre
dunkeelrgber dunkeelrgebr dunkeelrgerb dunkeelrbgre dunkeelrbger dunkeelrbrge dunkeelrbreg dunkeelrberg dunkeelrbegr
dunkeelregbr dunkeelregrb dunkeelrebgr dunkeelrebrg dunkeelrerbg dunkeelrergb dunkeererglb dunkeerergbl dunkeererlgb
dunkeererlbg dunkeererblg dunkeererbgl dunkeeregrlb dunkeeregrbl dunkeereglrb dunkeereglbr dunkeeregblr dunkeeregbrl
dunkeerelgrb dunkeerelgbr dunkeerelrgb dunkeerelrbg dunkeerelbrg dunkeerelbgr dunkeerebglr dunkeerebgrl dunkeereblgr
dunkeereblrg dunkeerebrlg dunkeerebrgl dunkeerreglb dunkeerregbl dunkeerrelgb dunkeerrelbg dunkeerreblg dunkeerrebgl
dunkeerrgelb dunkeerrgebl dunkeerrgleb dunkeerrglbe dunkeerrgble dunkeerrgbel dunkeerrlgeb dunkeerrlgbe dunkeerrlegb
dunkeerrlebg dunkeerrlbeg dunkeerrlbge dunkeerrbgle dunkeerrbgel dunkeerrblge dunkeerrbleg dunkeerrbelg dunkeerrbegl
dunkeergrelb dunkeergrebl dunkeergrleb dunkeergrlbe dunkeergrble dunkeergrbel dunkeergerlb dunkeergerbl dunkeergelrb
dunkeergelbr dunkeergeblr dunkeergebrl dunkeerglerb dunkeerglebr dunkeerglreb dunkeerglrbe dunkeerglbre dunkeerglber
dunkeergbelr dunkeergberl dunkeergbler dunkeergblre dunkeergbrle dunkeergbrel dunkeerlrgeb dunkeerlrgbe dunkeerlregb
dunkeerlrebg dunkeerlrbeg dunkeerlrbge dunkeerlgreb dunkeerlgrbe dunkeerlgerb dunkeerlgebr dunkeerlgber dunkeerlgbre
dunkeerlegrb dunkeerlegbr dunkeerlergb dunkeerlerbg dunkeerlebrg dunkeerlebgr dunkeerlbger dunkeerlbgre dunkeerlbegr
dunkeerlberg dunkeerlbreg dunkeerlbrge dunkeerbrgle dunkeerbrgel dunkeerbrlge dunkeerbrleg dunkeerbrelg dunkeerbregl
dunkeerbgrle dunkeerbgrel dunkeerbglre dunkeerbgler dunkeerbgelr dunkeerbgerl dunkeerblgre dunkeerblger dunkeerblrge
dunkeerblreg dunkeerblerg dunkeerblegr dunkeerbeglr dunkeerbegrl dunkeerbelgr dunkeerbelrg dunkeerberlg dunkeerbergl
dunkerbergel dunkerbergle dunkerberegl dunkerberelg dunkerberleg dunkerberlge dunkerbegrel dunkerbegrle dunkerbegerl
dunkerbegelr dunkerbegler dunkerbeglre dunkerbeegrl dunkerbeeglr dunkerbeergl dunkerbeerlg dunkerbeelrg dunkerbeelgr
dunkerbelger dunkerbelgre dunkerbelegr dunkerbelerg dunkerbelreg dunkerbelrge dunkerbregel dunkerbregle dunkerbreegl
dunkerbreelg dunkerbreleg dunkerbrelge dunkerbrgeel dunkerbrgele dunkerbrgeel dunkerbrgele dunkerbrglee dunkerbrglee
dunkerbregel dunkerbregle dunkerbreegl dunkerbreelg dunkerbreleg dunkerbrelge dunkerbrlgee dunkerbrlgee dunkerbrlege
dunkerbrleeg dunkerbrleeg dunkerbrlege dunkerbgreel dunkerbgrele dunkerbgreel dunkerbgrele dunkerbgrlee dunkerbgrlee
dunkerbgerel dunkerbgerle dunkerbgeerl dunkerbgeelr dunkerbgeler dunkerbgelre dunkerbgeerl dunkerbgeelr dunkerbgerel
dunkerbgerle dunkerbgelre dunkerbgeler dunkerbgleer dunkerbglere dunkerbgleer dunkerbglere dunkerbglree dunkerbglree
dunkerbergel dunkerbergle dunkerberegl dunkerberelg dunkerberleg dunkerberlge dunkerbegrel dunkerbegrle dunkerbegerl
dunkerbegelr dunkerbegler dunkerbeglre dunkerbeegrl dunkerbeeglr dunkerbeergl dunkerbeerlg dunkerbeelrg dunkerbeelgr
dunkerbelger dunkerbelgre dunkerbelegr dunkerbelerg dunkerbelreg dunkerbelrge dunkerblrgee dunkerblrgee dunkerblrege
dunkerblreeg dunkerblreeg dunkerblrege dunkerblgree dunkerblgree dunkerblgere dunkerblgeer dunkerblgeer dunkerblgere
dunkerblegre dunkerbleger dunkerblerge dunkerblereg dunkerbleerg dunkerbleegr dunkerbleger dunkerblegre dunkerbleegr
dunkerbleerg dunkerblereg dunkerblerge dunkerebrgel dunkerebrgle dunkerebregl dunkerebrelg dunkerebrleg dunkerebrlge
dunkerebgrel dunkerebgrle dunkerebgerl dunkerebgelr dunkerebgler dunkerebglre dunkerebegrl dunkerebeglr dunkerebergl
dunkereberlg dunkerebelrg dunkerebelgr dunkereblger dunkereblgre dunkereblegr dunkereblerg dunkereblreg dunkereblrge
dunkererbgel dunkererbgle dunkererbegl dunkererbelg dunkererbleg dunkererblge dunkerergbel dunkerergble dunkerergebl
dunkerergelb dunkerergleb dunkererglbe dunkereregbl dunkerereglb dunkererebgl dunkerereblg dunkererelbg dunkererelgb
dunkererlgeb dunkererlgbe dunkererlegb dunkererlebg dunkererlbeg dunkererlbge dunkeregrbel dunkeregrble dunkeregrebl
dunkeregrelb dunkeregrleb dunkeregrlbe dunkeregbrel dunkeregbrle dunkeregberl dunkeregbelr dunkeregbler dunkeregblre
dunkeregebrl dunkeregeblr dunkeregerbl dunkeregerlb dunkeregelrb dunkeregelbr dunkereglber dunkereglbre dunkereglebr
dunkereglerb dunkereglreb dunkereglrbe dunkereergbl dunkereerglb dunkereerbgl dunkereerblg dunkereerlbg dunkereerlgb
dunkereegrbl dunkereegrlb dunkereegbrl dunkereegblr dunkereeglbr dunkereeglrb dunkereebgrl dunkereebglr dunkereebrgl
dunkereebrlg dunkereeblrg dunkereeblgr dunkereelgbr dunkereelgrb dunkereelbgr dunkereelbrg dunkereelrbg dunkereelrgb
dunkerelrgeb dunkerelrgbe dunkerelregb dunkerelrebg dunkerelrbeg dunkerelrbge dunkerelgreb dunkerelgrbe dunkerelgerb
dunkerelgebr dunkerelgber dunkerelgbre dunkerelegrb dunkerelegbr dunkerelergb dunkerelerbg dunkerelebrg dunkerelebgr
dunkerelbger dunkerelbgre dunkerelbegr dunkerelberg dunkerelbreg dunkerelbrge dunkerrebgel dunkerrebgle dunkerrebegl
dunkerrebelg dunkerrebleg dunkerreblge dunkerregbel dunkerregble dunkerregebl dunkerregelb dunkerregleb dunkerreglbe
dunkerreegbl dunkerreeglb dunkerreebgl dunkerreeblg dunkerreelbg dunkerreelgb dunkerrelgeb dunkerrelgbe dunkerrelegb
dunkerrelebg dunkerrelbeg dunkerrelbge dunkerrbegel dunkerrbegle dunkerrbeegl dunkerrbeelg dunkerrbeleg dunkerrbelge
dunkerrbgeel dunkerrbgele dunkerrbgeel dunkerrbgele dunkerrbglee dunkerrbglee dunkerrbegel dunkerrbegle dunkerrbeegl
dunkerrbeelg dunkerrbeleg dunkerrbelge dunkerrblgee dunkerrblgee dunkerrblege dunkerrbleeg dunkerrbleeg dunkerrblege
dunkerrgbeel dunkerrgbele dunkerrgbeel dunkerrgbele dunkerrgblee dunkerrgblee dunkerrgebel dunkerrgeble dunkerrgeebl
dunkerrgeelb dunkerrgeleb dunkerrgelbe dunkerrgeebl dunkerrgeelb dunkerrgebel dunkerrgeble dunkerrgelbe dunkerrgeleb
dunkerrgleeb dunkerrglebe dunkerrgleeb dunkerrglebe dunkerrglbee dunkerrglbee dunkerrebgel dunkerrebgle dunkerrebegl
dunkerrebelg dunkerrebleg dunkerreblge dunkerregbel dunkerregble dunkerregebl dunkerregelb dunkerregleb dunkerreglbe
dunkerreegbl dunkerreeglb dunkerreebgl dunkerreeblg dunkerreelbg dunkerreelgb dunkerrelgeb dunkerrelgbe dunkerrelegb
dunkerrelebg dunkerrelbeg dunkerrelbge dunkerrlbgee dunkerrlbgee dunkerrlbege dunkerrlbeeg dunkerrlbeeg dunkerrlbege
dunkerrlgbee dunkerrlgbee dunkerrlgebe dunkerrlgeeb dunkerrlgeeb dunkerrlgebe dunkerrlegbe dunkerrlegeb dunkerrlebge
dunkerrlebeg dunkerrleebg dunkerrleegb dunkerrlegeb dunkerrlegbe dunkerrleegb dunkerrleebg dunkerrlebeg dunkerrlebge
dunkergerbel dunkergerble dunkergerebl dunkergerelb dunkergerleb dunkergerlbe dunkergebrel dunkergebrle dunkergeberl
dunkergebelr dunkergebler dunkergeblre dunkergeebrl dunkergeeblr dunkergeerbl dunkergeerlb dunkergeelrb dunkergeelbr
dunkergelber dunkergelbre dunkergelebr dunkergelerb dunkergelreb dunkergelrbe dunkergrebel dunkergreble dunkergreebl
dunkergreelb dunkergreleb dunkergrelbe dunkergrbeel dunkergrbele dunkergrbeel dunkergrbele dunkergrblee dunkergrblee
dunkergrebel dunkergreble dunkergreebl dunkergreelb dunkergreleb dunkergrelbe dunkergrlbee dunkergrlbee dunkergrlebe
dunkergrleeb dunkergrleeb dunkergrlebe dunkergbreel dunkergbrele dunkergbreel dunkergbrele dunkergbrlee dunkergbrlee
dunkergberel dunkergberle dunkergbeerl dunkergbeelr dunkergbeler dunkergbelre dunkergbeerl dunkergbeelr dunkergberel
dunkergberle dunkergbelre dunkergbeler dunkergbleer dunkergblere dunkergbleer dunkergblere dunkergblree dunkergblree
dunkergerbel dunkergerble dunkergerebl dunkergerelb dunkergerleb dunkergerlbe dunkergebrel dunkergebrle dunkergeberl
dunkergebelr dunkergebler dunkergeblre dunkergeebrl dunkergeeblr dunkergeerbl dunkergeerlb dunkergeelrb dunkergeelbr
dunkergelber dunkergelbre dunkergelebr dunkergelerb dunkergelreb dunkergelrbe dunkerglrbee dunkerglrbee dunkerglrebe
dunkerglreeb dunkerglreeb dunkerglrebe dunkerglbree dunkerglbree dunkerglbere dunkerglbeer dunkerglbeer dunkerglbere
dunkerglebre dunkergleber dunkerglerbe dunkerglereb dunkergleerb dunkergleebr dunkergleber dunkerglebre dunkergleebr
dunkergleerb dunkerglereb dunkerglerbe dunkereergbl dunkereerglb dunkereerbgl dunkereerblg dunkereerlbg dunkereerlgb
dunkereegrbl dunkereegrlb dunkereegbrl dunkereegblr dunkereeglbr dunkereeglrb dunkereebgrl dunkereebglr dunkereebrgl
dunkereebrlg dunkereeblrg dunkereeblgr dunkereelgbr dunkereelgrb dunkereelbgr dunkereelbrg dunkereelrbg dunkereelrgb
dunkereregbl dunkerereglb dunkererebgl dunkerereblg dunkererelbg dunkererelgb dunkerergebl dunkerergelb dunkerergbel
dunkerergble dunkererglbe dunkerergleb dunkererbgel dunkererbgle dunkererbegl dunkererbelg dunkererbleg dunkererblge
dunkererlgbe dunkererlgeb dunkererlbge dunkererlbeg dunkererlebg dunkererlegb dunkeregrebl dunkeregrelb dunkeregrbel
dunkeregrble dunkeregrlbe dunkeregrleb dunkeregerbl dunkeregerlb dunkeregebrl dunkeregeblr dunkeregelbr dunkeregelrb
dunkeregberl dunkeregbelr dunkeregbrel dunkeregbrle dunkeregblre dunkeregbler dunkereglebr dunkereglerb dunkereglber
dunkereglbre dunkereglrbe dunkereglreb dunkerebrgel dunkerebrgle dunkerebregl dunkerebrelg dunkerebrleg dunkerebrlge
dunkerebgrel dunkerebgrle dunkerebgerl dunkerebgelr dunkerebgler dunkerebglre dunkerebegrl dunkerebeglr dunkerebergl
dunkereberlg dunkerebelrg dunkerebelgr dunkereblger dunkereblgre dunkereblegr dunkereblerg dunkereblreg dunkereblrge
dunkerelrgbe dunkerelrgeb dunkerelrbge dunkerelrbeg dunkerelrebg dunkerelregb dunkerelgrbe dunkerelgreb dunkerelgbre
dunkerelgber dunkerelgebr dunkerelgerb dunkerelbgre dunkerelbger dunkerelbrge dunkerelbreg dunkerelberg dunkerelbegr
dunkerelegbr dunkerelegrb dunkerelebgr dunkerelebrg dunkerelerbg dunkerelergb dunkerlergeb dunkerlergbe dunkerleregb
dunkerlerebg dunkerlerbeg dunkerlerbge dunkerlegreb dunkerlegrbe dunkerlegerb dunkerlegebr dunkerlegber dunkerlegbre
dunkerleegrb dunkerleegbr dunkerleergb dunkerleerbg dunkerleebrg dunkerleebgr dunkerlebger dunkerlebgre dunkerlebegr
dunkerleberg dunkerlebreg dunkerlebrge dunkerlregeb dunkerlregbe dunkerlreegb dunkerlreebg dunkerlrebeg dunkerlrebge
dunkerlrgeeb dunkerlrgebe dunkerlrgeeb dunkerlrgebe dunkerlrgbee dunkerlrgbee dunkerlregeb dunkerlregbe dunkerlreegb
dunkerlreebg dunkerlrebeg dunkerlrebge dunkerlrbgee dunkerlrbgee dunkerlrbege dunkerlrbeeg dunkerlrbeeg dunkerlrbege
dunkerlgreeb dunkerlgrebe dunkerlgreeb dunkerlgrebe dunkerlgrbee dunkerlgrbee dunkerlgereb dunkerlgerbe dunkerlgeerb
dunkerlgeebr dunkerlgeber dunkerlgebre dunkerlgeerb dunkerlgeebr dunkerlgereb dunkerlgerbe dunkerlgebre dunkerlgeber
dunkerlgbeer dunkerlgbere dunkerlgbeer dunkerlgbere dunkerlgbree dunkerlgbree dunkerlergeb dunkerlergbe dunkerleregb
dunkerlerebg dunkerlerbeg dunkerlerbge dunkerlegreb dunkerlegrbe dunkerlegerb dunkerlegebr dunkerlegber dunkerlegbre
dunkerleegrb dunkerleegbr dunkerleergb dunkerleerbg dunkerleebrg dunkerleebgr dunkerlebger dunkerlebgre dunkerlebegr
dunkerleberg dunkerlebreg dunkerlebrge dunkerlbrgee dunkerlbrgee dunkerlbrege dunkerlbreeg dunkerlbreeg dunkerlbrege
dunkerlbgree dunkerlbgree dunkerlbgere dunkerlbgeer dunkerlbgeer dunkerlbgere dunkerlbegre dunkerlbeger dunkerlberge
dunkerlbereg dunkerlbeerg dunkerlbeegr dunkerlbeger dunkerlbegre dunkerlbeegr dunkerlbeerg dunkerlbereg dunkerlberge

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us