easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

papistly

metachromogenes

vaccinii

unspectacularly

trementum

chestnut

arcebitis

tullus

typhloenteritis

uramilic

dizziness

giglia

trespiedras

itabunt

versantis

clabaugh

mpangwe

usings


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: driller
cipher variations:
esjmmfs ftknngt guloohu hvmppiv iwnqqjw
jxorrkx kypssly lzqttmz maruuna nbsvvob
octwwpc pduxxqd qevyyre rfwzzsf sgxaatg
thybbuh uizccvi vjaddwj wkbeexk xlcffyl
ymdggzm znehhan aofiibo bpgjjcp cqhkkdq

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: driller
Cipher: wiroovi

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: driller
Cipher: AAABB BAAAA ABAAA ABABA ABABA AABAA BAAAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: driller
cipher variations:
esjmmfskaziinaqipeeviwqfaadqcyvwwlyiglsstguwrkkjwaehggre
gmxcczmmunyyhuscduupcyktqqxkftknngtlbajjobrjqffwjxrgbber
dzwxxmzjhmttuhvxsllkxbfihhsfhnyddannvozzivtdevvqdzlurryl
guloohumcbkkpcskrggxkyshccfseaxyynakinuuviwytmmlycgjiitg
iozeeboowpaajwuefwwreamvsszmhvmppivndcllqdtlshhylztiddgt
fbyzzobljovvwjxzunnmzdhkjjuhjpaffcppxqbbkxvfgxxsfbnwttan
iwnqqjwoedmmreumtiizmaujeehugczaapcmkpwwxkyavoonaeilkkvi
kqbggdqqyrcclywghyytgcoxuubojxorrkxpfennsfvnujjanbvkffiv
hdabbqdnlqxxylzbwppobfjmllwjlrchherrzsddmzxhizzuhdpyvvcp
kypsslyqgfootgwovkkbocwlggjwiebccreomryyzmacxqqpcgknmmxk
msdiifssateenayijaavieqzwwdqlzqttmzrhgppuhxpwllcpdxmhhkx
jfcddsfpnszzanbdyrrqdhlonnylntejjgttbuffobzjkbbwjfraxxer
maruunasihqqviyqxmmdqeyniilykgdeetgqotaabocezssreimpoozm
oufkkhuucvggpcaklccxkgsbyyfsnbsvvobtjirrwjzrynnerfzojjmz
lheffuhrpubbcpdfattsfjnqppanpvgllivvdwhhqdblmddylhtczzgt
octwwpcukjssxkaszoofsgapkknamifggvisqvccdqegbuutgkorqqbo
qwhmmjwwexiirecmneezmiudaahupduxxqdvlkttylbtappgthbqllob
njghhwjtrwdderfhcvvuhlpsrrcprxinnkxxfyjjsfdnoffanjvebbiv
qevyyrewmluuzmcubqqhuicrmmpcokhiixkusxeefsgidwwvimqtssdq
syjoolyygzkktgeopggbokwfccjwrfwzzsfxnmvvandvcrrivjdsnnqd
plijjylvtyffgthjexxwjnruttertzkppmzzhalluhfpqhhcplxgddkx
sgxaatgyonwwboewdssjwketooreqmjkkzmwuzgghuikfyyxkosvuufs
ualqqnaaibmmvigqriidqmyheelythybbuhzpoxxcpfxettkxlfuppsf
rnkllanxvahhivjlgzzylptwvvgtvbmrrobbjcnnwjhrsjjernziffmz
uizccviaqpyydqgyfuulymgvqqtgsolmmboywbiijwkmhaazmquxwwhu
wcnsspcckdooxkistkkfsoajggnavjaddwjbrqzzerhzgvvmznhwrruh
tpmnncpzxcjjkxlnibbanrvyxxivxdottqddleppyljtullgtpbkhhob
wkbeexkcsraafsiahwwnaoixssviuqnoodqaydkklymojccboswzyyjw
yepuureemfqqzmkuvmmhuqcliipcxlcffyldtsbbgtjbixxobpjyttwj
vropperbzellmznpkddcptxazzkxzfqvvsffngrranlvwnnivrdmjjqd
ymdggzmeutcchukcjyypcqkzuuxkwspqqfscafmmnaoqleedquybaaly
agrwwtggohssbomwxoojwsenkkreznehhanfvuddivldkzzqdrlavvyl
xtqrrgtdbgnnobprmffervzcbbmzbhsxxuhhpittcpnxyppkxtfollsf
aofiibogwveejwmelaaresmbwwzmyursshuechoopcqsnggfswadccna
cityyviiqjuudqoyzqqlyugpmmtgbpgjjcphxwffkxnfmbbsftncxxan
zvsttivfdippqdrtohhgtxbeddobdjuzzwjjrkvverpzarrmzvhqnnuh
cqhkkdqiyxgglyogncctguodyyboawtuujwgejqqresupiihuycfeepc
ekvaaxkkslwwfsqabssnawiroovidrillerjzyhhmzphodduhvpezzcp
bxuvvkxhfkrrsftvqjjivzdgffqdflwbbylltmxxgtrbcttobxjsppwj

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: driller
Cipher: qevyyre

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: driller
Cipher: 41244213135124

Extended Methods:
Method #1

Plaintext: driller
method variations:
iwoqqkwobtvvpbtgyaaugymdffzm

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
d r i l l e r 
4 2 4 1 1 5 2 
1 4 2 3 3 1 4 
They are then read out in rows:
42411521423314
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: driller
Cipher: idvbinq

Read more ...
Method #3

Plaintext: driller
method variations:
ftbcxft tbcxftf bcxftft
cxftftb xftftbc ftftbcx
tftbcxf

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: driller

all 5040 cipher variations:
driller drillre drilelr drilerl drilrel drilrle driller drillre drilelr drilerl drilrel
drilrle driellr drielrl driellr drielrl drierll drierll drirlel drirlle drirell drirell
drirlel drirlle drliler drlilre drlielr drlierl drlirel drlirle drllier drllire drlleir
drlleri drllrei drllrie drlelir drlelri drleilr drleirl drleril drlerli drlrlei drlrlie
drlreli drlreil drlriel drlrile drllier drllire drlleir drlleri drllrei drllrie drliler
drlilre drlielr drlierl drlirel drlirle drleilr drleirl drlelir drlelri drlerli drleril
drlriel drlrile drlreil drlreli drlrlei drlrlie drellir drellri drelilr drelirl drelril
drelrli drellir drellri drelilr drelirl drelril drelrli dreillr dreilrl dreillr dreilrl
dreirll dreirll drerlil drerlli drerill drerill drerlil drerlli drrllei drrllie drrleli
drrleil drrliel drrlile drrllei drrllie drrleli drrleil drrliel drrlile drrelli drrelil
drrelli drrelil drreill drreill drrilel drrille drriell drriell drrilel drrille dirller
dirllre dirlelr dirlerl dirlrel dirlrle dirller dirllre dirlelr dirlerl dirlrel dirlrle
direllr direlrl direllr direlrl direrll direrll dirrlel dirrlle dirrell dirrell dirrlel
dirrlle dilrler dilrlre dilrelr dilrerl dilrrel dilrrle dillrer dillrre dillerr dillerr
dillrer dillrre dilelrr dilelrr dilerlr dilerrl dilerrl dilerlr dilrler dilrlre dilrelr
dilrerl dilrrel dilrrle dillrer dillrre dillerr dillerr dillrer dillrre dilrler dilrlre
dilrelr dilrerl dilrrel dilrrle dilerlr dilerrl dilelrr dilelrr dilerlr dilerrl dilrrel
dilrrle dilrerl dilrelr dilrler dilrlre diellrr diellrr dielrlr dielrrl dielrrl dielrlr
diellrr diellrr dielrlr dielrrl dielrrl dielrlr dierllr dierlrl dierllr dierlrl dierrll
dierrll dierlrl dierllr dierrll dierrll dierlrl dierllr dirller dirllre dirlelr dirlerl
dirlrel dirlrle dirller dirllre dirlelr dirlerl dirlrel dirlrle direllr direlrl direllr
direlrl direrll direrll dirrlel dirrlle dirrell dirrell dirrlel dirrlle dlirler dlirlre
dlirelr dlirerl dlirrel dlirrle dlilrer dlilrre dlilerr dlilerr dlilrer dlilrre dlielrr
dlielrr dlierlr dlierrl dlierrl dlierlr dlirler dlirlre dlirelr dlirerl dlirrel dlirrle
dlriler dlrilre dlrielr dlrierl dlrirel dlrirle dlrlier dlrlire dlrleir dlrleri dlrlrei
dlrlrie dlrelir dlrelri dlreilr dlreirl dlreril dlrerli dlrrlei dlrrlie dlrreli dlrreil
dlrriel dlrrile dllrier dllrire dllreir dllreri dllrrei dllrrie dllirer dllirre dllierr
dllierr dllirer dllirre dlleirr dlleirr dllerir dllerri dllerri dllerir dllrier dllrire
dllreir dllreri dllrrei dllrrie dlerlir dlerlri dlerilr dlerirl dlerril dlerrli dlelrir
dlelrri dlelirr dlelirr dlelrir dlelrri dleilrr dleilrr dleirlr dleirrl dleirrl dleirlr
dlerlir dlerlri dlerilr dlerirl dlerril dlerrli dlrrlei dlrrlie dlrreli dlrreil dlrriel
dlrrile dlrlrei dlrlrie dlrleri dlrleir dlrlier dlrlire dlrelri dlrelir dlrerli dlreril
dlreirl dlreilr dlriler dlrilre dlrielr dlrierl dlrirel dlrirle dlilrer dlilrre dlilerr
dlilerr dlilrer dlilrre dlirler dlirlre dlirelr dlirerl dlirrel dlirrle dlierlr dlierrl
dlielrr dlielrr dlierlr dlierrl dlirrel dlirrle dlirerl dlirelr dlirler dlirlre dllirer
dllirre dllierr dllierr dllirer dllirre dllrier dllrire dllreir dllreri dllrrei dllrrie
dllerir dllerri dlleirr dlleirr dllerir dllerri dllrrei dllrrie dllreri dllreir dllrier
dllrire dlrlier dlrlire dlrleir dlrleri dlrlrei dlrlrie dlriler dlrilre dlrielr dlrierl
dlrirel dlrirle dlreilr dlreirl dlrelir dlrelri dlrerli dlreril dlrriel dlrrile dlrreil
dlrreli dlrrlei dlrrlie dlelrir dlelrri dlelirr dlelirr dlelrir dlelrri dlerlir dlerlri
dlerilr dlerirl dlerril dlerrli dleirlr dleirrl dleilrr dleilrr dleirlr dleirrl dlerril
dlerrli dlerirl dlerilr dlerlir dlerlri dlrlrei dlrlrie dlrleri dlrleir dlrlier dlrlire
dlrrlei dlrrlie dlrreli dlrreil dlrriel dlrrile dlrerli dlreril dlrelri dlrelir dlreilr
dlreirl dlrirel dlrirle dlrierl dlrielr dlriler dlrilre deillrr deillrr deilrlr deilrrl
deilrrl deilrlr deillrr deillrr deilrlr deilrrl deilrrl deilrlr deirllr deirlrl deirllr
deirlrl deirrll deirrll deirlrl deirllr deirrll deirrll deirlrl deirllr delilrr delilrr
delirlr delirrl delirrl delirlr dellirr dellirr dellrir dellrri dellrri dellrir delrlir
delrlri delrilr delrirl delrril delrrli delrlri delrlir delrrli delrril delrirl delrilr
dellirr dellirr dellrir dellrri dellrri dellrir delilrr delilrr delirlr delirrl delirrl
delirlr delrilr delrirl delrlir delrlri delrrli delrril delrirl delrilr delrril delrrli
delrlri delrlir derllir derllri derlilr derlirl derlril derlrli derllir derllri derlilr
derlirl derlril derlrli derillr derilrl derillr derilrl derirll derirll derrlil derrlli
derrill derrill derrlil derrlli derllri derllir derlrli derlril derlirl derlilr derllri
derllir derlrli derlril derlirl derlilr derrlli derrlil derrlli derrlil derrill derrill
derilrl derillr derirll derirll derilrl derillr driller drillre drilelr drilerl drilrel
drilrle driller drillre drilelr drilerl drilrel drilrle driellr drielrl driellr drielrl
drierll drierll drirlel drirlle drirell drirell drirlel drirlle drliler drlilre drlielr
drlierl drlirel drlirle drllier drllire drlleir drlleri drllrei drllrie drlelir drlelri
drleilr drleirl drleril drlerli drlrlei drlrlie drlreli drlreil drlriel drlrile drllier
drllire drlleir drlleri drllrei drllrie drliler drlilre drlielr drlierl drlirel drlirle
drleilr drleirl drlelir drlelri drlerli drleril drlriel drlrile drlreil drlreli drlrlei
drlrlie drellir drellri drelilr drelirl drelril drelrli drellir drellri drelilr drelirl
drelril drelrli dreillr dreilrl dreillr dreilrl dreirll dreirll drerlil drerlli drerill
drerill drerlil drerlli drrllei drrllie drrleli drrleil drrliel drrlile drrllei drrllie
drrleli drrleil drrliel drrlile drrelli drrelil drrelli drrelil drreill drreill drrilel
drrille drriell drriell drrilel drrille rdiller rdillre rdilelr rdilerl rdilrel rdilrle
rdiller rdillre rdilelr rdilerl rdilrel rdilrle rdiellr rdielrl rdiellr rdielrl rdierll
rdierll rdirlel rdirlle rdirell rdirell rdirlel rdirlle rdliler rdlilre rdlielr rdlierl
rdlirel rdlirle rdllier rdllire rdlleir rdlleri rdllrei rdllrie rdlelir rdlelri rdleilr
rdleirl rdleril rdlerli rdlrlei rdlrlie rdlreli rdlreil rdlriel rdlrile rdllier rdllire
rdlleir rdlleri rdllrei rdllrie rdliler rdlilre rdlielr rdlierl rdlirel rdlirle rdleilr
rdleirl rdlelir rdlelri rdlerli rdleril rdlriel rdlrile rdlreil rdlreli rdlrlei rdlrlie
rdellir rdellri rdelilr rdelirl rdelril rdelrli rdellir rdellri rdelilr rdelirl rdelril
rdelrli rdeillr rdeilrl rdeillr rdeilrl rdeirll rdeirll rderlil rderlli rderill rderill
rderlil rderlli rdrllei rdrllie rdrleli rdrleil rdrliel rdrlile rdrllei rdrllie rdrleli
rdrleil rdrliel rdrlile rdrelli rdrelil rdrelli rdrelil rdreill rdreill rdrilel rdrille
rdriell rdriell rdrilel rdrille ridller ridllre ridlelr ridlerl ridlrel ridlrle ridller
ridllre ridlelr ridlerl ridlrel ridlrle ridellr ridelrl ridellr ridelrl riderll riderll
ridrlel ridrlle ridrell ridrell ridrlel ridrlle rildler rildlre rildelr rilderl rildrel
rildrle rillder rilldre rilledr rillerd rillred rillrde rileldr rilelrd riledlr riledrl
rilerdl rilerld rilrled rilrlde rilreld rilredl rilrdel rilrdle rillder rilldre rilledr
rillerd rillred rillrde rildler rildlre rildelr rilderl rildrel rildrle riledlr riledrl
rileldr rilelrd rilerld rilerdl rilrdel rilrdle rilredl rilreld rilrled rilrlde rielldr
riellrd rieldlr rieldrl rielrdl rielrld rielldr riellrd rieldlr rieldrl rielrdl rielrld
riedllr riedlrl riedllr riedlrl riedrll riedrll rierldl rierlld rierdll rierdll rierldl
rierlld rirlled rirllde rirleld rirledl rirldel rirldle rirlled rirllde rirleld rirledl
rirldel rirldle rirelld rireldl rirelld rireldl riredll riredll rirdlel rirdlle rirdell
rirdell rirdlel rirdlle rlidler rlidlre rlidelr rliderl rlidrel rlidrle rlilder rlildre
rliledr rlilerd rlilred rlilrde rlieldr rlielrd rliedlr rliedrl rlierdl rlierld rlirled
rlirlde rlireld rliredl rlirdel rlirdle rldiler rldilre rldielr rldierl rldirel rldirle
rldlier rldlire rldleir rldleri rldlrei rldlrie rldelir rldelri rldeilr rldeirl rlderil
rlderli rldrlei rldrlie rldreli rldreil rldriel rldrile rlldier rlldire rlldeir rllderi
rlldrei rlldrie rllider rllidre rlliedr rllierd rllired rllirde rlleidr rlleird rlledir
rlledri rllerdi rllerid rllried rllride rllreid rllredi rllrdei rllrdie rledlir rledlri
rledilr rledirl rledril rledrli rleldir rleldri rlelidr rlelird rlelrid rlelrdi rleildr
rleilrd rleidlr rleidrl rleirdl rleirld rlerlid rlerldi rlerild rleridl rlerdil rlerdli
rlrdlei rlrdlie rlrdeli rlrdeil rlrdiel rlrdile rlrldei rlrldie rlrledi rlrleid rlrlied
rlrlide rlreldi rlrelid rlredli rlredil rlreidl rlreild rlriled rlrilde rlrield rlriedl
rlridel rlridle rlilder rlildre rliledr rlilerd rlilred rlilrde rlidler rlidlre rlidelr
rliderl rlidrel rlidrle rliedlr rliedrl rlieldr rlielrd rlierld rlierdl rlirdel rlirdle
rliredl rlireld rlirled rlirlde rllider rllidre rlliedr rllierd rllired rllirde rlldier
rlldire rlldeir rllderi rlldrei rlldrie rlledir rlledri rlleidr rlleird rllerid rllerdi
rllrdei rllrdie rllredi rllreid rllried rllride rldlier rldlire rldleir rldleri rldlrei
rldlrie rldiler rldilre rldielr rldierl rldirel rldirle rldeilr rldeirl rldelir rldelri
rlderli rlderil rldriel rldrile rldreil rldreli rldrlei rldrlie rleldir rleldri rlelidr
rlelird rlelrid rlelrdi rledlir rledlri rledilr rledirl rledril rledrli rleidlr rleidrl
rleildr rleilrd rleirld rleirdl rlerdil rlerdli rleridl rlerild rlerlid rlerldi rlrldei
rlrldie rlrledi rlrleid rlrlied rlrlide rlrdlei rlrdlie rlrdeli rlrdeil rlrdiel rlrdile
rlredli rlredil rlreldi rlrelid rlreild rlreidl rlridel rlridle rlriedl rlrield rlriled
rlrilde reilldr reillrd reildlr reildrl reilrdl reilrld reilldr reillrd reildlr reildrl
reilrdl reilrld reidllr reidlrl reidllr reidlrl reidrll reidrll reirldl reirlld reirdll
reirdll reirldl reirlld relildr relilrd relidlr relidrl relirdl relirld rellidr rellird
relldir relldri rellrdi rellrid reldlir reldlri reldilr reldirl reldril reldrli relrldi
relrlid relrdli relrdil relridl relrild rellidr rellird relldir relldri rellrdi rellrid
relildr relilrd relidlr relidrl relirdl relirld reldilr reldirl reldlir reldlri reldrli
reldril relridl relrild relrdil relrdli relrldi relrlid redllir redllri redlilr redlirl
redlril redlrli redllir redllri redlilr redlirl redlril redlrli redillr redilrl redillr
redilrl redirll redirll redrlil redrlli redrill redrill redrlil redrlli rerlldi rerllid
rerldli rerldil rerlidl rerlild rerlldi rerllid rerldli rerldil rerlidl rerlild rerdlli
rerdlil rerdlli rerdlil rerdill rerdill rerildl rerilld reridll reridll rerildl rerilld
rrilled rrillde rrileld rriledl rrildel rrildle rrilled rrillde rrileld rriledl rrildel
rrildle rrielld rrieldl rrielld rrieldl rriedll rriedll rridlel rridlle rridell rridell
rridlel rridlle rrliled rrlilde rrlield rrliedl rrlidel rrlidle rrllied rrllide rrlleid
rrlledi rrlldei rrlldie rrlelid rrleldi rrleild rrleidl rrledil rrledli rrldlei rrldlie
rrldeli rrldeil rrldiel rrldile rrllied rrllide rrlleid rrlledi rrlldei rrlldie rrliled
rrlilde rrlield rrliedl rrlidel rrlidle rrleild rrleidl rrlelid rrleldi rrledli rrledil
rrldiel rrldile rrldeil rrldeli rrldlei rrldlie rrellid rrelldi rrelild rrelidl rreldil
rreldli rrellid rrelldi rrelild rrelidl rreldil rreldli rreilld rreildl rreilld rreildl
rreidll rreidll rredlil rredlli rredill rredill rredlil rredlli rrdllei rrdllie rrdleli
rrdleil rrdliel rrdlile rrdllei rrdllie rrdleli rrdleil rrdliel rrdlile rrdelli rrdelil
rrdelli rrdelil rrdeill rrdeill rrdilel rrdille rrdiell rrdiell rrdilel rrdille irdller
irdllre irdlelr irdlerl irdlrel irdlrle irdller irdllre irdlelr irdlerl irdlrel irdlrle
irdellr irdelrl irdellr irdelrl irderll irderll irdrlel irdrlle irdrell irdrell irdrlel
irdrlle irldler irldlre irldelr irlderl irldrel irldrle irllder irlldre irlledr irllerd
irllred irllrde irleldr irlelrd irledlr irledrl irlerdl irlerld irlrled irlrlde irlreld
irlredl irlrdel irlrdle irllder irlldre irlledr irllerd irllred irllrde irldler irldlre
irldelr irlderl irldrel irldrle irledlr irledrl irleldr irlelrd irlerld irlerdl irlrdel
irlrdle irlredl irlreld irlrled irlrlde irelldr irellrd ireldlr ireldrl irelrdl irelrld
irelldr irellrd ireldlr ireldrl irelrdl irelrld iredllr iredlrl iredllr iredlrl iredrll
iredrll irerldl irerlld irerdll irerdll irerldl irerlld irrlled irrllde irrleld irrledl
irrldel irrldle irrlled irrllde irrleld irrledl irrldel irrldle irrelld irreldl irrelld
irreldl irredll irredll irrdlel irrdlle irrdell irrdell irrdlel irrdlle idrller idrllre
idrlelr idrlerl idrlrel idrlrle idrller idrllre idrlelr idrlerl idrlrel idrlrle idrellr
idrelrl idrellr idrelrl idrerll idrerll idrrlel idrrlle idrrell idrrell idrrlel idrrlle
idlrler idlrlre idlrelr idlrerl idlrrel idlrrle idllrer idllrre idllerr idllerr idllrer
idllrre idlelrr idlelrr idlerlr idlerrl idlerrl idlerlr idlrler idlrlre idlrelr idlrerl
idlrrel idlrrle idllrer idllrre idllerr idllerr idllrer idllrre idlrler idlrlre idlrelr
idlrerl idlrrel idlrrle idlerlr idlerrl idlelrr idlelrr idlerlr idlerrl idlrrel idlrrle
idlrerl idlrelr idlrler idlrlre idellrr idellrr idelrlr idelrrl idelrrl idelrlr idellrr
idellrr idelrlr idelrrl idelrrl idelrlr iderllr iderlrl iderllr iderlrl iderrll iderrll
iderlrl iderllr iderrll iderrll iderlrl iderllr idrller idrllre idrlelr idrlerl idrlrel
idrlrle idrller idrllre idrlelr idrlerl idrlrel idrlrle idrellr idrelrl idrellr idrelrl
idrerll idrerll idrrlel idrrlle idrrell idrrell idrrlel idrrlle ildrler ildrlre ildrelr
ildrerl ildrrel ildrrle ildlrer ildlrre ildlerr ildlerr ildlrer ildlrre ildelrr ildelrr
ilderlr ilderrl ilderrl ilderlr ildrler ildrlre ildrelr ildrerl ildrrel ildrrle ilrdler
ilrdlre ilrdelr ilrderl ilrdrel ilrdrle ilrlder ilrldre ilrledr ilrlerd ilrlred ilrlrde
ilreldr ilrelrd ilredlr ilredrl ilrerdl ilrerld ilrrled ilrrlde ilrreld ilrredl ilrrdel
ilrrdle illrder illrdre illredr illrerd illrred illrrde illdrer illdrre illderr illderr
illdrer illdrre illedrr illedrr illerdr illerrd illerrd illerdr illrder illrdre illredr
illrerd illrred illrrde ilerldr ilerlrd ilerdlr ilerdrl ilerrdl ilerrld ilelrdr ilelrrd
ileldrr ileldrr ilelrdr ilelrrd iledlrr iledlrr iledrlr iledrrl iledrrl iledrlr ilerldr
ilerlrd ilerdlr ilerdrl ilerrdl ilerrld ilrrled ilrrlde ilrreld ilrredl ilrrdel ilrrdle
ilrlred ilrlrde ilrlerd ilrledr ilrlder ilrldre ilrelrd ilreldr ilrerld ilrerdl ilredrl
ilredlr ilrdler ilrdlre ilrdelr ilrderl ilrdrel ilrdrle ildlrer ildlrre ildlerr ildlerr
ildlrer ildlrre ildrler ildrlre ildrelr ildrerl ildrrel ildrrle ilderlr ilderrl ildelrr
ildelrr ilderlr ilderrl ildrrel ildrrle ildrerl ildrelr ildrler ildrlre illdrer illdrre
illderr illderr illdrer illdrre illrder illrdre illredr illrerd illrred illrrde illerdr
illerrd illedrr illedrr illerdr illerrd illrred illrrde illrerd illredr illrder illrdre
ilrlder ilrldre ilrledr ilrlerd ilrlred ilrlrde ilrdler ilrdlre ilrdelr ilrderl ilrdrel
ilrdrle ilredlr ilredrl ilreldr ilrelrd ilrerld ilrerdl ilrrdel ilrrdle ilrredl ilrreld
ilrrled ilrrlde ilelrdr ilelrrd ileldrr ileldrr ilelrdr ilelrrd ilerldr ilerlrd ilerdlr
ilerdrl ilerrdl ilerrld iledrlr iledrrl iledlrr iledlrr iledrlr iledrrl ilerrdl ilerrld
ilerdrl ilerdlr ilerldr ilerlrd ilrlred ilrlrde ilrlerd ilrledr ilrlder ilrldre ilrrled
ilrrlde ilrreld ilrredl ilrrdel ilrrdle ilrerld ilrerdl ilrelrd ilreldr ilredlr ilredrl
ilrdrel ilrdrle ilrderl ilrdelr ilrdler ilrdlre iedllrr iedllrr iedlrlr iedlrrl iedlrrl
iedlrlr iedllrr iedllrr iedlrlr iedlrrl iedlrrl iedlrlr iedrllr iedrlrl iedrllr iedrlrl
iedrrll iedrrll iedrlrl iedrllr iedrrll iedrrll iedrlrl iedrllr ieldlrr ieldlrr ieldrlr
ieldrrl ieldrrl ieldrlr ielldrr ielldrr iellrdr iellrrd iellrrd iellrdr ielrldr ielrlrd
ielrdlr ielrdrl ielrrdl ielrrld ielrlrd ielrldr ielrrld ielrrdl ielrdrl ielrdlr ielldrr
ielldrr iellrdr iellrrd iellrrd iellrdr ieldlrr ieldlrr ieldrlr ieldrrl ieldrrl ieldrlr
ielrdlr ielrdrl ielrldr ielrlrd ielrrld ielrrdl ielrdrl ielrdlr ielrrdl ielrrld ielrlrd
ielrldr ierlldr ierllrd ierldlr ierldrl ierlrdl ierlrld ierlldr ierllrd ierldlr ierldrl
ierlrdl ierlrld ierdllr ierdlrl ierdllr ierdlrl ierdrll ierdrll ierrldl ierrlld ierrdll
ierrdll ierrldl ierrlld ierllrd ierlldr ierlrld ierlrdl ierldrl ierldlr ierllrd ierlldr
ierlrld ierlrdl ierldrl ierldlr ierrlld ierrldl ierrlld ierrldl ierrdll ierrdll ierdlrl
ierdllr ierdrll ierdrll ierdlrl ierdllr irdller irdllre irdlelr irdlerl irdlrel irdlrle
irdller irdllre irdlelr irdlerl irdlrel irdlrle irdellr irdelrl irdellr irdelrl irderll
irderll irdrlel irdrlle irdrell irdrell irdrlel irdrlle irldler irldlre irldelr irlderl
irldrel irldrle irllder irlldre irlledr irllerd irllred irllrde irleldr irlelrd irledlr
irledrl irlerdl irlerld irlrled irlrlde irlreld irlredl irlrdel irlrdle irllder irlldre
irlledr irllerd irllred irllrde irldler irldlre irldelr irlderl irldrel irldrle irledlr
irledrl irleldr irlelrd irlerld irlerdl irlrdel irlrdle irlredl irlreld irlrled irlrlde
irelldr irellrd ireldlr ireldrl irelrdl irelrld irelldr irellrd ireldlr ireldrl irelrdl
irelrld iredllr iredlrl iredllr iredlrl iredrll iredrll irerldl irerlld irerdll irerdll
irerldl irerlld irrlled irrllde irrleld irrledl irrldel irrldle irrlled irrllde irrleld
irrledl irrldel irrldle irrelld irreldl irrelld irreldl irredll irredll irrdlel irrdlle
irrdell irrdell irrdlel irrdlle lridler lridlre lridelr lriderl lridrel lridrle lrilder
lrildre lriledr lrilerd lrilred lrilrde lrieldr lrielrd lriedlr lriedrl lrierdl lrierld
lrirled lrirlde lrireld lriredl lrirdel lrirdle lrdiler lrdilre lrdielr lrdierl lrdirel
lrdirle lrdlier lrdlire lrdleir lrdleri lrdlrei lrdlrie lrdelir lrdelri lrdeilr lrdeirl
lrderil lrderli lrdrlei lrdrlie lrdreli lrdreil lrdriel lrdrile lrldier lrldire lrldeir
lrlderi lrldrei lrldrie lrlider lrlidre lrliedr lrlierd lrlired lrlirde lrleidr lrleird
lrledir lrledri lrlerdi lrlerid lrlried lrlride lrlreid lrlredi lrlrdei lrlrdie lredlir
lredlri lredilr lredirl lredril lredrli lreldir lreldri lrelidr lrelird lrelrid lrelrdi
lreildr lreilrd lreidlr lreidrl lreirdl lreirld lrerlid lrerldi lrerild lreridl lrerdil
lrerdli lrrdlei lrrdlie lrrdeli lrrdeil lrrdiel lrrdile lrrldei lrrldie lrrledi lrrleid
lrrlied lrrlide lrreldi lrrelid lrredli lrredil lrreidl lrreild lrriled lrrilde lrrield
lrriedl lrridel lrridle lirdler lirdlre lirdelr lirderl lirdrel lirdrle lirlder lirldre
lirledr lirlerd lirlred lirlrde lireldr lirelrd liredlr liredrl lirerdl lirerld lirrled
lirrlde lirreld lirredl lirrdel lirrdle lidrler lidrlre lidrelr lidrerl lidrrel lidrrle
lidlrer lidlrre lidlerr lidlerr lidlrer lidlrre lidelrr lidelrr liderlr liderrl liderrl
liderlr lidrler lidrlre lidrelr lidrerl lidrrel lidrrle lildrer lildrre lilderr lilderr
lildrer lildrre lilrder lilrdre lilredr lilrerd lilrred lilrrde lilerdr lilerrd liledrr
liledrr lilerdr lilerrd lilrred lilrrde lilrerd lilredr lilrder lilrdre liedlrr liedlrr
liedrlr liedrrl liedrrl liedrlr lieldrr lieldrr lielrdr lielrrd lielrrd lielrdr lierldr
lierlrd lierdlr lierdrl lierrdl lierrld lierlrd lierldr lierrld lierrdl lierdrl lierdlr
lirdler lirdlre lirdelr lirderl lirdrel lirdrle lirlder lirldre lirledr lirlerd lirlred
lirlrde lireldr lirelrd liredlr liredrl lirerdl lirerld lirrled lirrlde lirreld lirredl
lirrdel lirrdle ldirler ldirlre ldirelr ldirerl ldirrel ldirrle ldilrer ldilrre ldilerr
ldilerr ldilrer ldilrre ldielrr ldielrr ldierlr ldierrl ldierrl ldierlr ldirler ldirlre
ldirelr ldirerl ldirrel ldirrle ldriler ldrilre ldrielr ldrierl ldrirel ldrirle ldrlier
ldrlire ldrleir ldrleri ldrlrei ldrlrie ldrelir ldrelri ldreilr ldreirl ldreril ldrerli
ldrrlei ldrrlie ldrreli ldrreil ldrriel ldrrile ldlrier ldlrire ldlreir ldlreri ldlrrei
ldlrrie ldlirer ldlirre ldlierr ldlierr ldlirer ldlirre ldleirr ldleirr ldlerir ldlerri
ldlerri ldlerir ldlrier ldlrire ldlreir ldlreri ldlrrei ldlrrie lderlir lderlri lderilr
lderirl lderril lderrli ldelrir ldelrri ldelirr ldelirr ldelrir ldelrri ldeilrr ldeilrr
ldeirlr ldeirrl ldeirrl ldeirlr lderlir lderlri lderilr lderirl lderril lderrli ldrrlei
ldrrlie ldrreli ldrreil ldrriel ldrrile ldrlrei ldrlrie ldrleri ldrleir ldrlier ldrlire
ldrelri ldrelir ldrerli ldreril ldreirl ldreilr ldriler ldrilre ldrielr ldrierl ldrirel
ldrirle llidrer llidrre lliderr lliderr llidrer llidrre llirder llirdre lliredr llirerd
llirred llirrde llierdr llierrd lliedrr lliedrr llierdr llierrd llirred llirrde llirerd
lliredr llirder llirdre lldirer lldirre lldierr lldierr lldirer lldirre lldrier lldrire
lldreir lldreri lldrrei lldrrie llderir llderri lldeirr lldeirr llderir llderri lldrrei
lldrrie lldreri lldreir lldrier lldrire llrdier llrdire llrdeir llrderi llrdrei llrdrie
llrider llridre llriedr llrierd llrired llrirde llreidr llreird llredir llredri llrerdi
llrerid llrried llrride llrreid llrredi llrrdei llrrdie lledrir lledrri lledirr lledirr
lledrir lledrri llerdir llerdri lleridr llerird llerrid llerrdi lleirdr lleirrd lleidrr
lleidrr lleirdr lleirrd llerrid llerrdi llerird lleridr llerdir llerdri llrdrei llrdrie
llrderi llrdeir llrdier llrdire llrrdei llrrdie llrredi llrreid llrried llrride llrerdi
llrerid llredri llredir llreidr llreird llrired llrirde llrierd llriedr llrider llridre
leidlrr leidlrr leidrlr leidrrl leidrrl leidrlr leildrr leildrr leilrdr leilrrd leilrrd
leilrdr leirldr leirlrd leirdlr leirdrl leirrdl leirrld leirlrd leirldr leirrld leirrdl
leirdrl leirdlr ledilrr ledilrr ledirlr ledirrl ledirrl ledirlr ledlirr ledlirr ledlrir
ledlrri ledlrri ledlrir ledrlir ledrlri ledrilr ledrirl ledrril ledrrli ledrlri ledrlir
ledrrli ledrril ledrirl ledrilr leldirr leldirr leldrir leldrri leldrri leldrir lelidrr
lelidrr lelirdr lelirrd lelirrd lelirdr lelridr lelrird lelrdir lelrdri lelrrdi lelrrid
lelrird lelridr lelrrid lelrrdi lelrdri lelrdir lerdlir lerdlri lerdilr lerdirl lerdril
lerdrli lerldir lerldri lerlidr lerlird lerlrid lerlrdi lerildr lerilrd leridlr leridrl
lerirdl lerirld lerrlid lerrldi lerrild lerridl lerrdil lerrdli lerdlri lerdlir lerdrli
lerdril lerdirl lerdilr lerldri lerldir lerlrdi lerlrid lerlird lerlidr lerrldi lerrlid
lerrdli lerrdil lerridl lerrild lerilrd lerildr lerirld lerirdl leridrl leridlr lridler
lridlre lridelr lriderl lridrel lridrle lrilder lrildre lriledr lrilerd lrilred lrilrde
lrieldr lrielrd lriedlr lriedrl lrierdl lrierld lrirled lrirlde lrireld lriredl lrirdel
lrirdle lrdiler lrdilre lrdielr lrdierl lrdirel lrdirle lrdlier lrdlire lrdleir lrdleri
lrdlrei lrdlrie lrdelir lrdelri lrdeilr lrdeirl lrderil lrderli lrdrlei lrdrlie lrdreli
lrdreil lrdriel lrdrile lrldier lrldire lrldeir lrlderi lrldrei lrldrie lrlider lrlidre
lrliedr lrlierd lrlired lrlirde lrleidr lrleird lrledir lrledri lrlerdi lrlerid lrlried
lrlride lrlreid lrlredi lrlrdei lrlrdie lredlir lredlri lredilr lredirl lredril lredrli
lreldir lreldri lrelidr lrelird lrelrid lrelrdi lreildr lreilrd lreidlr lreidrl lreirdl
lreirld lrerlid lrerldi lrerild lreridl lrerdil lrerdli lrrdlei lrrdlie lrrdeli lrrdeil
lrrdiel lrrdile lrrldei lrrldie lrrledi lrrleid lrrlied lrrlide lrreldi lrrelid lrredli
lrredil lrreidl lrreild lrriled lrrilde lrrield lrriedl lrridel lrridle lrilder lrildre
lriledr lrilerd lrilred lrilrde lridler lridlre lridelr lriderl lridrel lridrle lriedlr
lriedrl lrieldr lrielrd lrierld lrierdl lrirdel lrirdle lriredl lrireld lrirled lrirlde
lrlider lrlidre lrliedr lrlierd lrlired lrlirde lrldier lrldire lrldeir lrlderi lrldrei
lrldrie lrledir lrledri lrleidr lrleird lrlerid lrlerdi lrlrdei lrlrdie lrlredi lrlreid
lrlried lrlride lrdlier lrdlire lrdleir lrdleri lrdlrei lrdlrie lrdiler lrdilre lrdielr
lrdierl lrdirel lrdirle lrdeilr lrdeirl lrdelir lrdelri lrderli lrderil lrdriel lrdrile
lrdreil lrdreli lrdrlei lrdrlie lreldir lreldri lrelidr lrelird lrelrid lrelrdi lredlir
lredlri lredilr lredirl lredril lredrli lreidlr lreidrl lreildr lreilrd lreirld lreirdl
lrerdil lrerdli lreridl lrerild lrerlid lrerldi lrrldei lrrldie lrrledi lrrleid lrrlied
lrrlide lrrdlei lrrdlie lrrdeli lrrdeil lrrdiel lrrdile lrredli lrredil lrreldi lrrelid
lrreild lrreidl lrridel lrridle lrriedl lrrield lrriled lrrilde lirlder lirldre lirledr
lirlerd lirlred lirlrde lirdler lirdlre lirdelr lirderl lirdrel lirdrle liredlr liredrl
lireldr lirelrd lirerld lirerdl lirrdel lirrdle lirredl lirreld lirrled lirrlde lilrder
lilrdre lilredr lilrerd lilrred lilrrde lildrer lildrre lilderr lilderr lildrer lildrre
liledrr liledrr lilerdr lilerrd lilerrd lilerdr lilrder lilrdre lilredr lilrerd lilrred
lilrrde lidlrer lidlrre lidlerr lidlerr lidlrer lidlrre lidrler lidrlre lidrelr lidrerl
lidrrel lidrrle liderlr liderrl lidelrr lidelrr liderlr liderrl lidrrel lidrrle lidrerl
lidrelr lidrler lidrlre lieldrr lieldrr lielrdr lielrrd lielrrd lielrdr liedlrr liedlrr
liedrlr liedrrl liedrrl liedrlr lierdlr lierdrl lierldr lierlrd lierrld lierrdl lierdrl
lierdlr lierrdl lierrld lierlrd lierldr lirlder lirldre lirledr lirlerd lirlred lirlrde
lirdler lirdlre lirdelr lirderl lirdrel lirdrle liredlr liredrl lireldr lirelrd lirerld
lirerdl lirrdel lirrdle lirredl lirreld lirrled lirrlde llirder llirdre lliredr llirerd
llirred llirrde llidrer llidrre lliderr lliderr llidrer llidrre lliedrr lliedrr llierdr
llierrd llierrd llierdr llirder llirdre lliredr llirerd llirred llirrde llrider llridre
llriedr llrierd llrired llrirde llrdier llrdire llrdeir llrderi llrdrei llrdrie llredir
llredri llreidr llreird llrerid llrerdi llrrdei llrrdie llrredi llrreid llrried llrride
lldrier lldrire lldreir lldreri lldrrei lldrrie lldirer lldirre lldierr lldierr lldirer
lldirre lldeirr lldeirr llderir llderri llderri llderir lldrier lldrire lldreir lldreri
lldrrei lldrrie llerdir llerdri lleridr llerird llerrid llerrdi lledrir lledrri lledirr
lledirr lledrir lledrri lleidrr lleidrr lleirdr lleirrd lleirrd lleirdr llerdir llerdri
lleridr llerird llerrid llerrdi llrrdei llrrdie llrredi llrreid llrried llrride llrdrei
llrdrie llrderi llrdeir llrdier llrdire llredri llredir llrerdi llrerid llreird llreidr
llrider llridre llriedr llrierd llrired llrirde ldilrer ldilrre ldilerr ldilerr ldilrer
ldilrre ldirler ldirlre ldirelr ldirerl ldirrel ldirrle ldierlr ldierrl ldielrr ldielrr
ldierlr ldierrl ldirrel ldirrle ldirerl ldirelr ldirler ldirlre ldlirer ldlirre ldlierr
ldlierr ldlirer ldlirre ldlrier ldlrire ldlreir ldlreri ldlrrei ldlrrie ldlerir ldlerri
ldleirr ldleirr ldlerir ldlerri ldlrrei ldlrrie ldlreri ldlreir ldlrier ldlrire ldrlier
ldrlire ldrleir ldrleri ldrlrei ldrlrie ldriler ldrilre ldrielr ldrierl ldrirel ldrirle
ldreilr ldreirl ldrelir ldrelri ldrerli ldreril ldrriel ldrrile ldrreil ldrreli ldrrlei
ldrrlie ldelrir ldelrri ldelirr ldelirr ldelrir ldelrri lderlir lderlri lderilr lderirl
lderril lderrli ldeirlr ldeirrl ldeilrr ldeilrr ldeirlr ldeirrl lderril lderrli lderirl
lderilr lderlir lderlri ldrlrei ldrlrie ldrleri ldrleir ldrlier ldrlire ldrrlei ldrrlie
ldrreli ldrreil ldrriel ldrrile ldrerli ldreril ldrelri ldrelir ldreilr ldreirl ldrirel
ldrirle ldrierl ldrielr ldriler ldrilre leildrr leildrr leilrdr leilrrd leilrrd leilrdr
leidlrr leidlrr leidrlr leidrrl leidrrl leidrlr leirdlr leirdrl leirldr leirlrd leirrld
leirrdl leirdrl leirdlr leirrdl leirrld leirlrd leirldr lelidrr lelidrr lelirdr lelirrd
lelirrd lelirdr leldirr leldirr leldrir leldrri leldrri leldrir lelrdir lelrdri lelridr
lelrird lelrrid lelrrdi lelrdri lelrdir lelrrdi lelrrid lelrird lelridr ledlirr ledlirr
ledlrir ledlrri ledlrri ledlrir ledilrr ledilrr ledirlr ledirrl ledirrl ledirlr ledrilr
ledrirl ledrlir ledrlri ledrrli ledrril ledrirl ledrilr ledrril ledrrli ledrlri ledrlir
lerldir lerldri lerlidr lerlird lerlrid lerlrdi lerdlir lerdlri lerdilr lerdirl lerdril
lerdrli leridlr leridrl lerildr lerilrd lerirld lerirdl lerrdil lerrdli lerridl lerrild
lerrlid lerrldi lerldri lerldir lerlrdi lerlrid lerlird lerlidr lerdlri lerdlir lerdrli
lerdril lerdirl lerdilr lerrdli lerrdil lerrldi lerrlid lerrild lerridl leridrl leridlr
lerirdl lerirld lerilrd lerildr lrilder lrildre lriledr lrilerd lrilred lrilrde lridler
lridlre lridelr lriderl lridrel lridrle lriedlr lriedrl lrieldr lrielrd lrierld lrierdl
lrirdel lrirdle lriredl lrireld lrirled lrirlde lrlider lrlidre lrliedr lrlierd lrlired
lrlirde lrldier lrldire lrldeir lrlderi lrldrei lrldrie lrledir lrledri lrleidr lrleird
lrlerid lrlerdi lrlrdei lrlrdie lrlredi lrlreid lrlried lrlride lrdlier lrdlire lrdleir
lrdleri lrdlrei lrdlrie lrdiler lrdilre lrdielr lrdierl lrdirel lrdirle lrdeilr lrdeirl
lrdelir lrdelri lrderli lrderil lrdriel lrdrile lrdreil lrdreli lrdrlei lrdrlie lreldir
lreldri lrelidr lrelird lrelrid lrelrdi lredlir lredlri lredilr lredirl lredril lredrli
lreidlr lreidrl lreildr lreilrd lreirld lreirdl lrerdil lrerdli lreridl lrerild lrerlid
lrerldi lrrldei lrrldie lrrledi lrrleid lrrlied lrrlide lrrdlei lrrdlie lrrdeli lrrdeil
lrrdiel lrrdile lrredli lrredil lrreldi lrrelid lrreild lrreidl lrridel lrridle lrriedl
lrrield lrriled lrrilde erilldr erillrd erildlr erildrl erilrdl erilrld erilldr erillrd
erildlr erildrl erilrdl erilrld eridllr eridlrl eridllr eridlrl eridrll eridrll erirldl
erirlld erirdll erirdll erirldl erirlld erlildr erlilrd erlidlr erlidrl erlirdl erlirld
erllidr erllird erlldir erlldri erllrdi erllrid erldlir erldlri erldilr erldirl erldril
erldrli erlrldi erlrlid erlrdli erlrdil erlridl erlrild erllidr erllird erlldir erlldri
erllrdi erllrid erlildr erlilrd erlidlr erlidrl erlirdl erlirld erldilr erldirl erldlir
erldlri erldrli erldril erlridl erlrild erlrdil erlrdli erlrldi erlrlid erdllir erdllri
erdlilr erdlirl erdlril erdlrli erdllir erdllri erdlilr erdlirl erdlril erdlrli erdillr
erdilrl erdillr erdilrl erdirll erdirll erdrlil erdrlli erdrill erdrill erdrlil erdrlli
errlldi errllid errldli errldil errlidl errlild errlldi errllid errldli errldil errlidl
errlild errdlli errdlil errdlli errdlil errdill errdill errildl errilld erridll erridll
errildl errilld eirlldr eirllrd eirldlr eirldrl eirlrdl eirlrld eirlldr eirllrd eirldlr
eirldrl eirlrdl eirlrld eirdllr eirdlrl eirdllr eirdlrl eirdrll eirdrll eirrldl eirrlld
eirrdll eirrdll eirrldl eirrlld eilrldr eilrlrd eilrdlr eilrdrl eilrrdl eilrrld eillrdr
eillrrd eilldrr eilldrr eillrdr eillrrd eildlrr eildlrr eildrlr eildrrl eildrrl eildrlr
eilrldr eilrlrd eilrdlr eilrdrl eilrrdl eilrrld eillrdr eillrrd eilldrr eilldrr eillrdr
eillrrd eilrldr eilrlrd eilrdlr eilrdrl eilrrdl eilrrld eildrlr eildrrl eildlrr eildlrr
eildrlr eildrrl eilrrdl eilrrld eilrdrl eilrdlr eilrldr eilrlrd eidllrr eidllrr eidlrlr
eidlrrl eidlrrl eidlrlr eidllrr eidllrr eidlrlr eidlrrl eidlrrl eidlrlr eidrllr eidrlrl
eidrllr eidrlrl eidrrll eidrrll eidrlrl eidrllr eidrrll eidrrll eidrlrl eidrllr eirlldr
eirllrd eirldlr eirldrl eirlrdl eirlrld eirlldr eirllrd eirldlr eirldrl eirlrdl eirlrld
eirdllr eirdlrl eirdllr eirdlrl eirdrll eirdrll eirrldl eirrlld eirrdll eirrdll eirrldl
eirrlld elirldr elirlrd elirdlr elirdrl elirrdl elirrld elilrdr elilrrd elildrr elildrr
elilrdr elilrrd elidlrr elidlrr elidrlr elidrrl elidrrl elidrlr elirldr elirlrd elirdlr
elirdrl elirrdl elirrld elrildr elrilrd elridlr elridrl elrirdl elrirld elrlidr elrlird
elrldir elrldri elrlrdi elrlrid elrdlir elrdlri elrdilr elrdirl elrdril elrdrli elrrldi
elrrlid elrrdli elrrdil elrridl elrrild ellridr ellrird ellrdir ellrdri ellrrdi ellrrid
ellirdr ellirrd ellidrr ellidrr ellirdr ellirrd elldirr elldirr elldrir elldrri elldrri
elldrir ellridr ellrird ellrdir ellrdri ellrrdi ellrrid eldrlir eldrlri eldrilr eldrirl
eldrril eldrrli eldlrir eldlrri eldlirr eldlirr eldlrir eldlrri eldilrr eldilrr eldirlr
eldirrl eldirrl eldirlr eldrlir eldrlri eldrilr eldrirl eldrril eldrrli elrrldi elrrlid
elrrdli elrrdil elrridl elrrild elrlrdi elrlrid elrldri elrldir elrlidr elrlird elrdlri
elrdlir elrdrli elrdril elrdirl elrdilr elrildr elrilrd elridlr elridrl elrirdl elrirld
elilrdr elilrrd elildrr elildrr elilrdr elilrrd elirldr elirlrd elirdlr elirdrl elirrdl
elirrld elidrlr elidrrl elidlrr elidlrr elidrlr elidrrl elirrdl elirrld elirdrl elirdlr
elirldr elirlrd ellirdr ellirrd ellidrr ellidrr ellirdr ellirrd ellridr ellrird ellrdir
ellrdri ellrrdi ellrrid elldrir elldrri elldirr elldirr elldrir elldrri ellrrdi ellrrid
ellrdri ellrdir ellridr ellrird elrlidr elrlird elrldir elrldri elrlrdi elrlrid elrildr
elrilrd elridlr elridrl elrirdl elrirld elrdilr elrdirl elrdlir elrdlri elrdrli elrdril
elrridl elrrild elrrdil elrrdli elrrldi elrrlid eldlrir eldlrri eldlirr eldlirr eldlrir
eldlrri eldrlir eldrlri eldrilr eldrirl eldrril eldrrli eldirlr eldirrl eldilrr eldilrr
eldirlr eldirrl eldrril eldrrli eldrirl eldrilr eldrlir eldrlri elrlrdi elrlrid elrldri
elrldir elrlidr elrlird elrrldi elrrlid elrrdli elrrdil elrridl elrrild elrdrli elrdril
elrdlri elrdlir elrdilr elrdirl elrirdl elrirld elridrl elridlr elrildr elrilrd edillrr
edillrr edilrlr edilrrl edilrrl edilrlr edillrr edillrr edilrlr edilrrl edilrrl edilrlr
edirllr edirlrl edirllr edirlrl edirrll edirrll edirlrl edirllr edirrll edirrll edirlrl
edirllr edlilrr edlilrr edlirlr edlirrl edlirrl edlirlr edllirr edllirr edllrir edllrri
edllrri edllrir edlrlir edlrlri edlrilr edlrirl edlrril edlrrli edlrlri edlrlir edlrrli
edlrril edlrirl edlrilr edllirr edllirr edllrir edllrri edllrri edllrir edlilrr edlilrr
edlirlr edlirrl edlirrl edlirlr edlrilr edlrirl edlrlir edlrlri edlrrli edlrril edlrirl
edlrilr edlrril edlrrli edlrlri edlrlir edrllir edrllri edrlilr edrlirl edrlril edrlrli
edrllir edrllri edrlilr edrlirl edrlril edrlrli edrillr edrilrl edrillr edrilrl edrirll
edrirll edrrlil edrrlli edrrill edrrill edrrlil edrrlli edrllri edrllir edrlrli edrlril
edrlirl edrlilr edrllri edrllir edrlrli edrlril edrlirl edrlilr edrrlli edrrlil edrrlli
edrrlil edrrill edrrill edrilrl edrillr edrirll edrirll edrilrl edrillr erilldr erillrd
erildlr erildrl erilrdl erilrld erilldr erillrd erildlr erildrl erilrdl erilrld eridllr
eridlrl eridllr eridlrl eridrll eridrll erirldl erirlld erirdll erirdll erirldl erirlld
erlildr erlilrd erlidlr erlidrl erlirdl erlirld erllidr erllird erlldir erlldri erllrdi
erllrid erldlir erldlri erldilr erldirl erldril erldrli erlrldi erlrlid erlrdli erlrdil
erlridl erlrild erllidr erllird erlldir erlldri erllrdi erllrid erlildr erlilrd erlidlr
erlidrl erlirdl erlirld erldilr erldirl erldlir erldlri erldrli erldril erlridl erlrild
erlrdil erlrdli erlrldi erlrlid erdllir erdllri erdlilr erdlirl erdlril erdlrli erdllir
erdllri erdlilr erdlirl erdlril erdlrli erdillr erdilrl erdillr erdilrl erdirll erdirll
erdrlil erdrlli erdrill erdrill erdrlil erdrlli errlldi errllid errldli errldil errlidl
errlild errlldi errllid errldli errldil errlidl errlild errdlli errdlil errdlli errdlil
errdill errdill errildl errilld erridll erridll errildl errilld rrilled rrillde rrileld
rriledl rrildel rrildle rrilled rrillde rrileld rriledl rrildel rrildle rrielld rrieldl
rrielld rrieldl rriedll rriedll rridlel rridlle rridell rridell rridlel rridlle rrliled
rrlilde rrlield rrliedl rrlidel rrlidle rrllied rrllide rrlleid rrlledi rrlldei rrlldie
rrlelid rrleldi rrleild rrleidl rrledil rrledli rrldlei rrldlie rrldeli rrldeil rrldiel
rrldile rrllied rrllide rrlleid rrlledi rrlldei rrlldie rrliled rrlilde rrlield rrliedl
rrlidel rrlidle rrleild rrleidl rrlelid rrleldi rrledli rrledil rrldiel rrldile rrldeil
rrldeli rrldlei rrldlie rrellid rrelldi rrelild rrelidl rreldil rreldli rrellid rrelldi
rrelild rrelidl rreldil rreldli rreilld rreildl rreilld rreildl rreidll rreidll rredlil
rredlli rredill rredill rredlil rredlli rrdllei rrdllie rrdleli rrdleil rrdliel rrdlile
rrdllei rrdllie rrdleli rrdleil rrdliel rrdlile rrdelli rrdelil rrdelli rrdelil rrdeill
rrdeill rrdilel rrdille rrdiell rrdiell rrdilel rrdille rirlled rirllde rirleld rirledl
rirldel rirldle rirlled rirllde rirleld rirledl rirldel rirldle rirelld rireldl rirelld
rireldl riredll riredll rirdlel rirdlle rirdell rirdell rirdlel rirdlle rilrled rilrlde
rilreld rilredl rilrdel rilrdle rillred rillrde rillerd rilledr rillder rilldre rilelrd
rileldr rilerld rilerdl riledrl riledlr rildler rildlre rildelr rilderl rildrel rildrle
rillred rillrde rillerd rilledr rillder rilldre rilrled rilrlde rilreld rilredl rilrdel
rilrdle rilerld rilerdl rilelrd rileldr riledlr riledrl rildrel rildrle rilderl rildelr
rildler rildlre riellrd rielldr rielrld rielrdl rieldrl rieldlr riellrd rielldr rielrld
rielrdl rieldrl rieldlr rierlld rierldl rierlld rierldl rierdll rierdll riedlrl riedllr
riedrll riedrll riedlrl riedllr ridller ridllre ridlelr ridlerl ridlrel ridlrle ridller
ridllre ridlelr ridlerl ridlrel ridlrle ridellr ridelrl ridellr ridelrl riderll riderll
ridrlel ridrlle ridrell ridrell ridrlel ridrlle rlirled rlirlde rlireld rliredl rlirdel
rlirdle rlilred rlilrde rlilerd rliledr rlilder rlildre rlielrd rlieldr rlierld rlierdl
rliedrl rliedlr rlidler rlidlre rlidelr rliderl rlidrel rlidrle rlriled rlrilde rlrield
rlriedl rlridel rlridle rlrlied rlrlide rlrleid rlrledi rlrldei rlrldie rlrelid rlreldi
rlreild rlreidl rlredil rlredli rlrdlei rlrdlie rlrdeli rlrdeil rlrdiel rlrdile rllried
rllride rllreid rllredi rllrdei rllrdie rllired rllirde rllierd rlliedr rllider rllidre
rlleird rlleidr rllerid rllerdi rlledri rlledir rlldier rlldire rlldeir rllderi rlldrei
rlldrie rlerlid rlerldi rlerild rleridl rlerdil rlerdli rlelrid rlelrdi rlelird rlelidr
rleldir rleldri rleilrd rleildr rleirld rleirdl rleidrl rleidlr rledlir rledlri rledilr
rledirl rledril rledrli rldrlei rldrlie rldreli rldreil rldriel rldrile rldlrei rldlrie
rldleri rldleir rldlier rldlire rldelri rldelir rlderli rlderil rldeirl rldeilr rldiler
rldilre rldielr rldierl rldirel rldirle rlilred rlilrde rlilerd rliledr rlilder rlildre
rlirled rlirlde rlireld rliredl rlirdel rlirdle rlierld rlierdl rlielrd rlieldr rliedlr
rliedrl rlidrel rlidrle rliderl rlidelr rlidler rlidlre rllired rllirde rllierd rlliedr
rllider rllidre rllried rllride rllreid rllredi rllrdei rllrdie rllerid rllerdi rlleird
rlleidr rlledir rlledri rlldrei rlldrie rllderi rlldeir rlldier rlldire rlrlied rlrlide
rlrleid rlrledi rlrldei rlrldie rlriled rlrilde rlrield rlriedl rlridel rlridle rlreild
rlreidl rlrelid rlreldi rlredli rlredil rlrdiel rlrdile rlrdeil rlrdeli rlrdlei rlrdlie
rlelrid rlelrdi rlelird rlelidr rleldir rleldri rlerlid rlerldi rlerild rleridl rlerdil
rlerdli rleirld rleirdl rleilrd rleildr rleidlr rleidrl rledril rledrli rledirl rledilr
rledlir rledlri rldlrei rldlrie rldleri rldleir rldlier rldlire rldrlei rldrlie rldreli
rldreil rldriel rldrile rlderli rlderil rldelri rldelir rldeilr rldeirl rldirel rldirle
rldierl rldielr rldiler rldilre reillrd reilldr reilrld reilrdl reildrl reildlr reillrd
reilldr reilrld reilrdl reildrl reildlr reirlld reirldl reirlld reirldl reirdll reirdll
reidlrl reidllr reidrll reidrll reidlrl reidllr relilrd relildr relirld relirdl relidrl
relidlr rellird rellidr rellrid rellrdi relldri relldir relrlid relrldi relrild relridl
relrdil relrdli reldlri reldlir reldrli reldril reldirl reldilr rellird rellidr rellrid
rellrdi relldri relldir relilrd relildr relirld relirdl relidrl relidlr relrild relridl
relrlid relrldi relrdli relrdil reldirl reldilr reldril reldrli reldlri reldlir rerllid
rerlldi rerlild rerlidl rerldil rerldli rerllid rerlldi rerlild rerlidl rerldil rerldli
rerilld rerildl rerilld rerildl reridll reridll rerdlil rerdlli rerdill rerdill rerdlil
rerdlli redllri redllir redlrli redlril redlirl redlilr redllri redllir redlrli redlril
redlirl redlilr redrlli redrlil redrlli redrlil redrill redrill redilrl redillr redirll
redirll redilrl redillr rdiller rdillre rdilelr rdilerl rdilrel rdilrle rdiller rdillre
rdilelr rdilerl rdilrel rdilrle rdiellr rdielrl rdiellr rdielrl rdierll rdierll rdirlel
rdirlle rdirell rdirell rdirlel rdirlle rdliler rdlilre rdlielr rdlierl rdlirel rdlirle
rdllier rdllire rdlleir rdlleri rdllrei rdllrie rdlelir rdlelri rdleilr rdleirl rdleril
rdlerli rdlrlei rdlrlie rdlreli rdlreil rdlriel rdlrile rdllier rdllire rdlleir rdlleri
rdllrei rdllrie rdliler rdlilre rdlielr rdlierl rdlirel rdlirle rdleilr rdleirl rdlelir
rdlelri rdlerli rdleril rdlriel rdlrile rdlreil rdlreli rdlrlei rdlrlie rdellir rdellri
rdelilr rdelirl rdelril rdelrli rdellir rdellri rdelilr rdelirl rdelril rdelrli rdeillr
rdeilrl rdeillr rdeilrl rdeirll rdeirll rderlil rderlli rderill rderill rderlil rderlli
rdrllei rdrllie rdrleli rdrleil rdrliel rdrlile rdrllei rdrllie rdrleli rdrleil rdrliel
rdrlile rdrelli rdrelil rdrelli rdrelil rdreill rdreill rdrilel rdrille rdriell rdriell
rdrilel rdrille

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us