easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

trilli

incorporations

jobbers

bionomy

drivage

lintner

emphyteutic

virtutum

meniscoid

severs

jaups

emisisseque

plures

roelike

dopers

talibus

criminate

mutisia


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: dhritarashtra
cipher variations:
eisjubsbtiusb fjtkvctcujvtc gkulwdudvkwud hlvmxevewlxve imwnyfwfxmywf
jnxozgxgynzxg koypahyhzoayh lpzqbiziapbzi mqarcjajbqcaj nrbsdkbkcrdbk
osctelcldsecl ptdufmdmetfdm quevgnenfugen rvfwhofogvhfo swgxipgphwigp
txhyjqhqixjhq uyizkrirjykir vzjalsjskzljs wakbmtktlamkt xblcnulumbnlu
ycmdovmvncomv zdnepwnwodpnw aeofqxoxpeqox bfpgrypyqfrpy cgqhszqzrgsqz

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: dhritarashtra
Cipher: wsirgzizhsgiz

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: dhritarashtra
Cipher: AAABB AABBB BAAAA ABAAA BAABA AAAAA BAAAA AAAAA BAAAB AABBB BAABA BAAAA AAAAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: dhritarashtra
cipher variations:
eisjubsbtiusbkwazgbabdwgabqkipsbibnksibwyqfebqbxyeqbcmyvqbybhmqybiaglcbgbracgbucwrabwblcawbaqehmbebvqmeb
gemxybmbfeymbmsunkbubpskubsgcdwbcbzgwcbyuktibkbjuikbfjtkvctcujvtclxbahcbcexhbcrljqtcjcoltjcxzrgfcrcyzfrc
dnzwrczcinrzcjbhmdchcsbdhcvdxsbcxcmdbxcbrfincfcwrnfchfnyzcncgfzncntvolcvcqtlvcthdexcdcahxdczvlujclckvjlc
gkulwdudvkwudmycbidcdfyicdsmkrudkdpmukdyashgdsdzagsdeoaxsdadjosadkcinedidtceidweytcdydnecydcsgjodgdxsogd
igozadodhgaodouwpmdwdrumwduiefydedbiyedawmvkdmdlwkmdhlvmxevewlxvenzdcjedegzjdetnlsveleqnvlezbtiheteabhte
fpbytebekptbeldjofejeudfjexfzudezeofdzedthkpeheytphejhpabepeihbpepvxqnexesvnxevjfgzefecjzfebxnwlenemxlne
imwnyfwfxmywfoaedkfefhakefuomtwfmfrowmfacujifufbciufgqczufcflqucfmekpgfkfvegkfygavefafpgeafeuilqfifzuqif
kiqbcfqfjicqfqwyrofyftwoyfwkghafgfdkagfcyoxmfofnymofjnxozgxgynzxgpbfelgfgiblfgvpnuxgngspxngbdvkjgvgcdjvg
hrdavgdgmrvdgnflqhglgwfhlgzhbwfgbgqhfbgfvjmrgjgavrjgljrcdgrgkjdrgrxzspgzguxpzgxlhibghgelbhgdzpyngpgoznpg
koypahyhzoayhqcgfmhghjcmghwqovyhohtqyohcewlkhwhdekwhisebwhehnswehogmrihmhxgimhaicxghchrigchgwknshkhbwskh
mksdehshlkeshsyatqhahvyqahymijchihfmciheaqzohqhpaoqhlpzqbiziapbzirdhgnihikdnhixrpwzipiurzpidfxmlixieflxi
jtfcxifiotxfiphnsjiniyhjnibjdyhidisjhdihxlotilicxtlinltefitimlftitzburibiwzrbiznjkdijigndjifbrapiriqbpri
mqarcjajbqcajseihojijleoijysqxajqjvsaqjegynmjyjfgmyjkugdyjgjpuygjqiotkjojzikojckezijejtkiejiympujmjdyumj
omufgjujnmgujuacvsjcjxascjaoklejkjhoekjgcsbqjsjrcqsjnrbsdkbkcrdbktfjipkjkmfpjkztrybkrkwtbrkfhzonkzkghnzk
lvhezkhkqvzhkrjpulkpkajlpkdlfajkfkuljfkjznqvknkezvnkpnvghkvkonhvkvbdwtkdkybtdkbplmfklkipflkhdtcrktksdrtk
osctelcldseclugkjqlklngqklauszclslxucslgiapolalhioalmwifalilrwailskqvmlqlbkmqlemgbklglvmkglkaorwlolfawol
qowhilwlpoiwlwcexulelzcuelcqmnglmljqgmlieudslultesulptdufmdmetfdmvhlkrmlmohrlmbvtadmtmyvdtmhjbqpmbmijpbm
nxjgbmjmsxbjmtlrwnmrmclnrmfnhclmhmwnlhmlbpsxmpmgbxpmrpxijmxmqpjxmxdfyvmfmadvfmdrnohmnmkrhnmjfvetmvmuftvm
quevgnenfugenwimlsnmnpismncwubenunzweunikcrqncnjkqcnoykhcnkntycknumsxonsndmosngoidmninxominmcqtynqnhcyqn
sqyjknynrqkynyegzwngnbewgnesopinonlsionkgwfunwnvguwnrvfwhofogvhfoxjnmtonoqjtnodxvcfovoaxfvojldsrodoklrdo
pzlidolouzdlovntypotoenptohpjenojoypnjondruzoroidzrotrzklozosrlzozfhaxohocfxhoftpqjopomtjpolhxgvoxowhvxo
swgxipgphwigpykonupoprkuopeywdgpwpbygwpkmetspeplmsepqamjepmpvaempwouzqpupfoqupiqkfopkpzqokpoesvapspjeasp
usalmpaptsmapagibypipdgyipguqrkpqpnukqpmiyhwpypxiwyptxhyjqhqixjhqzlpovqpqslvpqfzxehqxqczhxqlnfutqfqmntfq
rbnkfqnqwbfnqxpvarqvqgprvqjrlgpqlqarplqpftwbqtqkfbtqvtbmnqbqutnbqbhjczqjqehzjqhvrslqrqovlrqnjzixqzqyjxzq
uyizkrirjykiramqpwrqrtmwqrgayfiryrdaiyrmogvurgrnougrscolgrorxcgoryqwbsrwrhqswrksmhqrmrbsqmrqguxcrurlgcur
wucnorcrvuocrcikdarkrfiakriwstmrsrpwmsrokajyrarzkyarvzjalsjskzljsbnrqxsrsunxrshbzgjszsebjzsnphwvshsopvhs
tdpmhspsydhpszrxctsxsirtxsltnirsnsctrnsrhvydsvsmhdvsxvdopsdswvpdsdjlebslsgjblsjxtunstsqxntsplbkzsbsalzbs
wakbmtktlamktcosrytstvoysticahktatfckatoqixwtitpqwitueqnitqtzeiqtasydutytjsuytmuojstotdusotsiwzetwtniewt
ywepqtetxwqetekmfctmthkcmtkyuvotutryoutqmclatctbmactxblcnulumbnludptszutuwpztujdbilubugdlbuprjyxujuqrxju
vfrojuruafjrubtzevuzuktvzunvpktupuevtputjxafuxuojfxuzxfqrufuyxrfuflngdunuildnulzvwpuvuszpvurndmbuducnbdu
ycmdovmvncomvequtavuvxqauvkecjmvcvhemcvqskzyvkvrsykvwgspkvsvbgksvcuafwvavluwavowqluvqvfwuqvukybgvyvpkgyv
aygrsvgvzysgvgmohevovjmeovmawxqvwvtaqwvsoencvevdocevzdnepwnwodpnwfrvubwvwyrbvwlfdknwdwifndwrtlazwlwstzlw
xhtqlwtwchltwdvbgxwbwmvxbwpxrmvwrwgxvrwvlzchwzwqlhzwbzhstwhwazthwhnpifwpwknfpwnbxyrwxwubrxwtpfodwfwepdfw
aeofqxoxpeqoxgswvcxwxzscwxmgeloxexjgoexsumbaxmxtuamxyiurmxuxdimuxewchyxcxnwycxqysnwxsxhywsxwmadixaxrmiax
caituxixbauixioqjgxqxlogqxocyzsxyxvcsyxuqgpexgxfqegxbfpgrypyqfrpyhtxwdyxyatdxynhfmpyfykhpfytvncbynyuvbny
zjvsnyvyejnvyfxdizydyoxzdyrztoxytyizxtyxnbejybysnjbydbjuvyjycbvjyjprkhyrymphrypdzatyzywdtzyvrhqfyhygrfhy
cgqhszqzrgsqziuyxezyzbueyzoignqzgzliqgzuwodczozvwcozakwtozwzfkowzgyejazezpyaezsaupyzuzjayuzyocfkzcztokcz
eckvwzkzdcwkzkqslizsznqiszqeabuzazxeuazwsirgzizhsgizdhritarashtrajvzyfazacvfzapjhorahamjrhavxpedapawxdpa
blxupaxaglpxahzfkbafaqzbfatbvqzavakbzvazpdgladaupldafdlwxalaedxlalrtmjataorjtarfbcvabayfvbaxtjshajaithja

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: dhritarashtra
Cipher: quevgnenfugen

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: dhritarashtra
Cipher: 41322442441124113432442411

Extended Methods:
Method #1

Plaintext: dhritarashtra
method variations:
inwoyfwfxnywfosbtdlblcsdbltxgyiqgqhxigqycmdovmvncomv

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
d h r i t a r a s h t r a 
4 3 2 4 4 1 2 1 3 3 4 2 1 
1 2 4 2 4 1 4 1 4 2 4 4 1 
They are then read out in rows:
43244121334211242414142441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: dhritarashtra
Cipher: ordbniarrqqrd

Read more ...
Method #3

Plaintext: dhritarashtra
method variations:
lgtrdfdloridq gtrdfdloridql trdfdloridqlg
rdfdloridqlgt dfdloridqlgtr fdloridqlgtrd
dloridqlgtrdf loridqlgtrdfd oridqlgtrdfdl
ridqlgtrdfdlo idqlgtrdfdlor dqlgtrdfdlori
qlgtrdfdlorid

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: dhritarashtra

first 5040 cipher variations(6187239489 total)
dhritarashtra dhritarashtar dhritarashrta dhritarashrat dhritarashart dhritarashatr dhritarasthra dhritarasthar dhritarastrha
dhritarastrah dhritarastarh dhritarastahr dhritarasrtha dhritarasrtah dhritarasrhta dhritarasrhat dhritarasraht dhritarasrath
dhritarasatrh dhritarasathr dhritarasarth dhritarasarht dhritarasahrt dhritarasahtr dhritarahstra dhritarahstar dhritarahsrta
dhritarahsrat dhritarahsart dhritarahsatr dhritarahtsra dhritarahtsar dhritarahtrsa dhritarahtras dhritarahtars dhritarahtasr
dhritarahrtsa dhritarahrtas dhritarahrsta dhritarahrsat dhritarahrast dhritarahrats dhritarahatrs dhritarahatsr dhritaraharts
dhritaraharst dhritarahasrt dhritarahastr dhritarathsra dhritarathsar dhritarathrsa dhritarathras dhritarathars dhritarathasr
dhritaratshra dhritaratshar dhritaratsrha dhritaratsrah dhritaratsarh dhritaratsahr dhritaratrsha dhritaratrsah dhritaratrhsa
dhritaratrhas dhritaratrahs dhritaratrash dhritaratasrh dhritaratashr dhritaratarsh dhritaratarhs dhritaratahrs dhritaratahsr
dhritararhtsa dhritararhtas dhritararhsta dhritararhsat dhritararhast dhritararhats dhritararthsa dhritararthas dhritarartsha
dhritarartsah dhritarartash dhritarartahs dhritararstha dhritararstah dhritararshta dhritararshat dhritararsaht dhritararsath
dhritararatsh dhritararaths dhritararasth dhritararasht dhritararahst dhritararahts dhritaraahtrs dhritaraahtsr dhritaraahrts
dhritaraahrst dhritaraahsrt dhritaraahstr dhritaraathrs dhritaraathsr dhritaraatrhs dhritaraatrsh dhritaraatsrh dhritaraatshr
dhritaraarths dhritaraartsh dhritaraarhts dhritaraarhst dhritaraarsht dhritaraarsth dhritaraastrh dhritaraasthr dhritaraasrth
dhritaraasrht dhritaraashrt dhritaraashtr dhritarsahtra dhritarsahtar dhritarsahrta dhritarsahrat dhritarsahart dhritarsahatr
dhritarsathra dhritarsathar dhritarsatrha dhritarsatrah dhritarsatarh dhritarsatahr dhritarsartha dhritarsartah dhritarsarhta
dhritarsarhat dhritarsaraht dhritarsarath dhritarsaatrh dhritarsaathr dhritarsaarth dhritarsaarht dhritarsaahrt dhritarsaahtr
dhritarshatra dhritarshatar dhritarsharta dhritarsharat dhritarshaart dhritarshaatr dhritarshtara dhritarshtaar dhritarshtraa
dhritarshtraa dhritarshtara dhritarshtaar dhritarshrtaa dhritarshrtaa dhritarshrata dhritarshraat dhritarshraat dhritarshrata
dhritarshatra dhritarshatar dhritarsharta dhritarsharat dhritarshaart dhritarshaatr dhritarsthara dhritarsthaar dhritarsthraa
dhritarsthraa dhritarsthara dhritarsthaar dhritarstahra dhritarstahar dhritarstarha dhritarstarah dhritarstaarh dhritarstaahr
dhritarstraha dhritarstraah dhritarstrhaa dhritarstrhaa dhritarstraha dhritarstraah dhritarstaarh dhritarstaahr dhritarstarah
dhritarstarha dhritarstahra dhritarstahar dhritarsrhtaa dhritarsrhtaa dhritarsrhata dhritarsrhaat dhritarsrhaat dhritarsrhata
dhritarsrthaa dhritarsrthaa dhritarsrtaha dhritarsrtaah dhritarsrtaah dhritarsrtaha dhritarsratha dhritarsratah dhritarsrahta
dhritarsrahat dhritarsraaht dhritarsraath dhritarsratah dhritarsratha dhritarsraath dhritarsraaht dhritarsrahat dhritarsrahta
dhritarsahtra dhritarsahtar dhritarsahrta dhritarsahrat dhritarsahart dhritarsahatr dhritarsathra dhritarsathar dhritarsatrha
dhritarsatrah dhritarsatarh dhritarsatahr dhritarsartha dhritarsartah dhritarsarhta dhritarsarhat dhritarsaraht dhritarsarath
dhritarsaatrh dhritarsaathr dhritarsaarth dhritarsaarht dhritarsaahrt dhritarsaahtr dhritarhsatra dhritarhsatar dhritarhsarta
dhritarhsarat dhritarhsaart dhritarhsaatr dhritarhstara dhritarhstaar dhritarhstraa dhritarhstraa dhritarhstara dhritarhstaar
dhritarhsrtaa dhritarhsrtaa dhritarhsrata dhritarhsraat dhritarhsraat dhritarhsrata dhritarhsatra dhritarhsatar dhritarhsarta
dhritarhsarat dhritarhsaart dhritarhsaatr dhritarhastra dhritarhastar dhritarhasrta dhritarhasrat dhritarhasart dhritarhasatr
dhritarhatsra dhritarhatsar dhritarhatrsa dhritarhatras dhritarhatars dhritarhatasr dhritarhartsa dhritarhartas dhritarharsta
dhritarharsat dhritarharast dhritarharats dhritarhaatrs dhritarhaatsr dhritarhaarts dhritarhaarst dhritarhaasrt dhritarhaastr
dhritarhtasra dhritarhtasar dhritarhtarsa dhritarhtaras dhritarhtaars dhritarhtaasr dhritarhtsara dhritarhtsaar dhritarhtsraa
dhritarhtsraa dhritarhtsara dhritarhtsaar dhritarhtrsaa dhritarhtrsaa dhritarhtrasa dhritarhtraas dhritarhtraas dhritarhtrasa
dhritarhtasra dhritarhtasar dhritarhtarsa dhritarhtaras dhritarhtaars dhritarhtaasr dhritarhratsa dhritarhratas dhritarhrasta
dhritarhrasat dhritarhraast dhritarhraats dhritarhrtasa dhritarhrtaas dhritarhrtsaa dhritarhrtsaa dhritarhrtasa dhritarhrtaas
dhritarhrstaa dhritarhrstaa dhritarhrsata dhritarhrsaat dhritarhrsaat dhritarhrsata dhritarhratsa dhritarhratas dhritarhrasta
dhritarhrasat dhritarhraast dhritarhraats dhritarhaatrs dhritarhaatsr dhritarhaarts dhritarhaarst dhritarhaasrt dhritarhaastr
dhritarhatars dhritarhatasr dhritarhatras dhritarhatrsa dhritarhatsra dhritarhatsar dhritarhartas dhritarhartsa dhritarharats
dhritarharast dhritarharsat dhritarharsta dhritarhastra dhritarhastar dhritarhasrta dhritarhasrat dhritarhasart dhritarhasatr
dhritartshara dhritartshaar dhritartshraa dhritartshraa dhritartshara dhritartshaar dhritartsahra dhritartsahar dhritartsarha
dhritartsarah dhritartsaarh dhritartsaahr dhritartsraha dhritartsraah dhritartsrhaa dhritartsrhaa dhritartsraha dhritartsraah
dhritartsaarh dhritartsaahr dhritartsarah dhritartsarha dhritartsahra dhritartsahar dhritarthsara dhritarthsaar dhritarthsraa
dhritarthsraa dhritarthsara dhritarthsaar dhritarthasra dhritarthasar dhritartharsa dhritartharas dhritarthaars dhritarthaasr
dhritarthrasa dhritarthraas dhritarthrsaa dhritarthrsaa dhritarthrasa dhritarthraas dhritarthaars dhritarthaasr dhritartharas
dhritartharsa dhritarthasra dhritarthasar dhritartahsra dhritartahsar dhritartahrsa dhritartahras dhritartahars dhritartahasr
dhritartashra dhritartashar dhritartasrha dhritartasrah dhritartasarh dhritartasahr dhritartarsha dhritartarsah dhritartarhsa
dhritartarhas dhritartarahs dhritartarash dhritartaasrh dhritartaashr dhritartaarsh dhritartaarhs dhritartaahrs dhritartaahsr
dhritartrhasa dhritartrhaas dhritartrhsaa dhritartrhsaa dhritartrhasa dhritartrhaas dhritartrahsa dhritartrahas dhritartrasha
dhritartrasah dhritartraash dhritartraahs dhritartrsaha dhritartrsaah dhritartrshaa dhritartrshaa dhritartrsaha dhritartrsaah
dhritartraash dhritartraahs dhritartrasah dhritartrasha dhritartrahsa dhritartrahas dhritartahars dhritartahasr dhritartahras
dhritartahrsa dhritartahsra dhritartahsar dhritartaahrs dhritartaahsr dhritartaarhs dhritartaarsh dhritartaasrh dhritartaashr
dhritartarahs dhritartarash dhritartarhas dhritartarhsa dhritartarsha dhritartarsah dhritartasarh dhritartasahr dhritartasrah
dhritartasrha dhritartashra dhritartashar dhritarrshtaa dhritarrshtaa dhritarrshata dhritarrshaat dhritarrshaat dhritarrshata
dhritarrsthaa dhritarrsthaa dhritarrstaha dhritarrstaah dhritarrstaah dhritarrstaha dhritarrsatha dhritarrsatah dhritarrsahta
dhritarrsahat dhritarrsaaht dhritarrsaath dhritarrsatah dhritarrsatha dhritarrsaath dhritarrsaaht dhritarrsahat dhritarrsahta
dhritarrhstaa dhritarrhstaa dhritarrhsata dhritarrhsaat dhritarrhsaat dhritarrhsata dhritarrhtsaa dhritarrhtsaa dhritarrhtasa
dhritarrhtaas dhritarrhtaas dhritarrhtasa dhritarrhatsa dhritarrhatas dhritarrhasta dhritarrhasat dhritarrhaast dhritarrhaats
dhritarrhatas dhritarrhatsa dhritarrhaats dhritarrhaast dhritarrhasat dhritarrhasta dhritarrthsaa dhritarrthsaa dhritarrthasa
dhritarrthaas dhritarrthaas dhritarrthasa dhritarrtshaa dhritarrtshaa dhritarrtsaha dhritarrtsaah dhritarrtsaah dhritarrtsaha
dhritarrtasha dhritarrtasah dhritarrtahsa dhritarrtahas dhritarrtaahs dhritarrtaash dhritarrtasah dhritarrtasha dhritarrtaash
dhritarrtaahs dhritarrtahas dhritarrtahsa dhritarrahtsa dhritarrahtas dhritarrahsta dhritarrahsat dhritarrahast dhritarrahats
dhritarrathsa dhritarrathas dhritarratsha dhritarratsah dhritarratash dhritarratahs dhritarrastha dhritarrastah dhritarrashta
dhritarrashat dhritarrasaht dhritarrasath dhritarraatsh dhritarraaths dhritarraasth dhritarraasht dhritarraahst dhritarraahts
dhritarrahtas dhritarrahtsa dhritarrahats dhritarrahast dhritarrahsat dhritarrahsta dhritarrathas dhritarrathsa dhritarratahs
dhritarratash dhritarratsah dhritarratsha dhritarraaths dhritarraatsh dhritarraahts dhritarraahst dhritarraasht dhritarraasth
dhritarrastah dhritarrastha dhritarrasath dhritarrasaht dhritarrashat dhritarrashta dhritarashtra dhritarashtar dhritarashrta
dhritarashrat dhritarashart dhritarashatr dhritarasthra dhritarasthar dhritarastrha dhritarastrah dhritarastarh dhritarastahr
dhritarasrtha dhritarasrtah dhritarasrhta dhritarasrhat dhritarasraht dhritarasrath dhritarasatrh dhritarasathr dhritarasarth
dhritarasarht dhritarasahrt dhritarasahtr dhritarahstra dhritarahstar dhritarahsrta dhritarahsrat dhritarahsart dhritarahsatr
dhritarahtsra dhritarahtsar dhritarahtrsa dhritarahtras dhritarahtars dhritarahtasr dhritarahrtsa dhritarahrtas dhritarahrsta
dhritarahrsat dhritarahrast dhritarahrats dhritarahatrs dhritarahatsr dhritaraharts dhritaraharst dhritarahasrt dhritarahastr
dhritarathsra dhritarathsar dhritarathrsa dhritarathras dhritarathars dhritarathasr dhritaratshra dhritaratshar dhritaratsrha
dhritaratsrah dhritaratsarh dhritaratsahr dhritaratrsha dhritaratrsah dhritaratrhsa dhritaratrhas dhritaratrahs dhritaratrash
dhritaratasrh dhritaratashr dhritaratarsh dhritaratarhs dhritaratahrs dhritaratahsr dhritararhtsa dhritararhtas dhritararhsta
dhritararhsat dhritararhast dhritararhats dhritararthsa dhritararthas dhritarartsha dhritarartsah dhritarartash dhritarartahs
dhritararstha dhritararstah dhritararshta dhritararshat dhritararsaht dhritararsath dhritararatsh dhritararaths dhritararasth
dhritararasht dhritararahst dhritararahts dhritaraahtrs dhritaraahtsr dhritaraahrts dhritaraahrst dhritaraahsrt dhritaraahstr
dhritaraathrs dhritaraathsr dhritaraatrhs dhritaraatrsh dhritaraatsrh dhritaraatshr dhritaraarths dhritaraartsh dhritaraarhts
dhritaraarhst dhritaraarsht dhritaraarsth dhritaraastrh dhritaraasthr dhritaraasrth dhritaraasrht dhritaraashrt dhritaraashtr
dhritaarshtra dhritaarshtar dhritaarshrta dhritaarshrat dhritaarshart dhritaarshatr dhritaarsthra dhritaarsthar dhritaarstrha
dhritaarstrah dhritaarstarh dhritaarstahr dhritaarsrtha dhritaarsrtah dhritaarsrhta dhritaarsrhat dhritaarsraht dhritaarsrath
dhritaarsatrh dhritaarsathr dhritaarsarth dhritaarsarht dhritaarsahrt dhritaarsahtr dhritaarhstra dhritaarhstar dhritaarhsrta
dhritaarhsrat dhritaarhsart dhritaarhsatr dhritaarhtsra dhritaarhtsar dhritaarhtrsa dhritaarhtras dhritaarhtars dhritaarhtasr
dhritaarhrtsa dhritaarhrtas dhritaarhrsta dhritaarhrsat dhritaarhrast dhritaarhrats dhritaarhatrs dhritaarhatsr dhritaarharts
dhritaarharst dhritaarhasrt dhritaarhastr dhritaarthsra dhritaarthsar dhritaarthrsa dhritaarthras dhritaarthars dhritaarthasr
dhritaartshra dhritaartshar dhritaartsrha dhritaartsrah dhritaartsarh dhritaartsahr dhritaartrsha dhritaartrsah dhritaartrhsa
dhritaartrhas dhritaartrahs dhritaartrash dhritaartasrh dhritaartashr dhritaartarsh dhritaartarhs dhritaartahrs dhritaartahsr
dhritaarrhtsa dhritaarrhtas dhritaarrhsta dhritaarrhsat dhritaarrhast dhritaarrhats dhritaarrthsa dhritaarrthas dhritaarrtsha
dhritaarrtsah dhritaarrtash dhritaarrtahs dhritaarrstha dhritaarrstah dhritaarrshta dhritaarrshat dhritaarrsaht dhritaarrsath
dhritaarratsh dhritaarraths dhritaarrasth dhritaarrasht dhritaarrahst dhritaarrahts dhritaarahtrs dhritaarahtsr dhritaarahrts
dhritaarahrst dhritaarahsrt dhritaarahstr dhritaarathrs dhritaarathsr dhritaaratrhs dhritaaratrsh dhritaaratsrh dhritaaratshr
dhritaararths dhritaarartsh dhritaararhts dhritaararhst dhritaararsht dhritaararsth dhritaarastrh dhritaarasthr dhritaarasrth
dhritaarasrht dhritaarashrt dhritaarashtr dhritaasrhtra dhritaasrhtar dhritaasrhrta dhritaasrhrat dhritaasrhart dhritaasrhatr
dhritaasrthra dhritaasrthar dhritaasrtrha dhritaasrtrah dhritaasrtarh dhritaasrtahr dhritaasrrtha dhritaasrrtah dhritaasrrhta
dhritaasrrhat dhritaasrraht dhritaasrrath dhritaasratrh dhritaasrathr dhritaasrarth dhritaasrarht dhritaasrahrt dhritaasrahtr
dhritaashrtra dhritaashrtar dhritaashrrta dhritaashrrat dhritaashrart dhritaashratr dhritaashtrra dhritaashtrar dhritaashtrra
dhritaashtrar dhritaashtarr dhritaashtarr dhritaashrtra dhritaashrtar dhritaashrrta dhritaashrrat dhritaashrart dhritaashratr
dhritaashatrr dhritaashatrr dhritaashartr dhritaasharrt dhritaasharrt dhritaashartr dhritaasthrra dhritaasthrar dhritaasthrra
dhritaasthrar dhritaastharr dhritaastharr dhritaastrhra dhritaastrhar dhritaastrrha dhritaastrrah dhritaastrarh dhritaastrahr
dhritaastrrha dhritaastrrah dhritaastrhra dhritaastrhar dhritaastrahr dhritaastrarh dhritaastarrh dhritaastarhr dhritaastarrh
dhritaastarhr dhritaastahrr dhritaastahrr dhritaasrhtra dhritaasrhtar dhritaasrhrta dhritaasrhrat dhritaasrhart dhritaasrhatr
dhritaasrthra dhritaasrthar dhritaasrtrha dhritaasrtrah dhritaasrtarh dhritaasrtahr dhritaasrrtha dhritaasrrtah dhritaasrrhta
dhritaasrrhat dhritaasrraht dhritaasrrath dhritaasratrh dhritaasrathr dhritaasrarth dhritaasrarht dhritaasrahrt dhritaasrahtr
dhritaasahtrr dhritaasahtrr dhritaasahrtr dhritaasahrrt dhritaasahrrt dhritaasahrtr dhritaasathrr dhritaasathrr dhritaasatrhr
dhritaasatrrh dhritaasatrrh dhritaasatrhr dhritaasarthr dhritaasartrh dhritaasarhtr dhritaasarhrt dhritaasarrht dhritaasarrth
dhritaasartrh dhritaasarthr dhritaasarrth dhritaasarrht dhritaasarhrt dhritaasarhtr dhritaahsrtra dhritaahsrtar dhritaahsrrta
dhritaahsrrat dhritaahsrart dhritaahsratr dhritaahstrra dhritaahstrar dhritaahstrra dhritaahstrar dhritaahstarr dhritaahstarr
dhritaahsrtra dhritaahsrtar dhritaahsrrta dhritaahsrrat dhritaahsrart dhritaahsratr dhritaahsatrr dhritaahsatrr dhritaahsartr
dhritaahsarrt dhritaahsarrt dhritaahsartr dhritaahrstra dhritaahrstar dhritaahrsrta dhritaahrsrat dhritaahrsart dhritaahrsatr
dhritaahrtsra dhritaahrtsar dhritaahrtrsa dhritaahrtras dhritaahrtars dhritaahrtasr dhritaahrrtsa dhritaahrrtas dhritaahrrsta
dhritaahrrsat dhritaahrrast dhritaahrrats dhritaahratrs dhritaahratsr dhritaahrarts dhritaahrarst dhritaahrasrt dhritaahrastr
dhritaahtrsra dhritaahtrsar dhritaahtrrsa dhritaahtrras dhritaahtrars dhritaahtrasr dhritaahtsrra dhritaahtsrar dhritaahtsrra
dhritaahtsrar dhritaahtsarr dhritaahtsarr dhritaahtrsra dhritaahtrsar dhritaahtrrsa dhritaahtrras dhritaahtrars dhritaahtrasr
dhritaahtasrr dhritaahtasrr dhritaahtarsr dhritaahtarrs dhritaahtarrs dhritaahtarsr dhritaahrrtsa dhritaahrrtas dhritaahrrsta
dhritaahrrsat dhritaahrrast dhritaahrrats dhritaahrtrsa dhritaahrtras dhritaahrtsra dhritaahrtsar dhritaahrtasr dhritaahrtars
dhritaahrstra dhritaahrstar dhritaahrsrta dhritaahrsrat dhritaahrsart dhritaahrsatr dhritaahratsr dhritaahratrs dhritaahrastr
dhritaahrasrt dhritaahrarst dhritaahrarts dhritaahartrs dhritaahartsr dhritaaharrts dhritaaharrst dhritaaharsrt dhritaaharstr
dhritaahatrrs dhritaahatrsr dhritaahatrrs dhritaahatrsr dhritaahatsrr dhritaahatsrr dhritaahartrs dhritaahartsr dhritaaharrts
dhritaaharrst dhritaaharsrt dhritaaharstr dhritaahastrr dhritaahastrr dhritaahasrtr dhritaahasrrt dhritaahasrrt dhritaahasrtr
dhritaatshrra dhritaatshrar dhritaatshrra dhritaatshrar dhritaatsharr dhritaatsharr dhritaatsrhra dhritaatsrhar dhritaatsrrha
dhritaatsrrah dhritaatsrarh dhritaatsrahr dhritaatsrrha dhritaatsrrah dhritaatsrhra dhritaatsrhar dhritaatsrahr dhritaatsrarh
dhritaatsarrh dhritaatsarhr dhritaatsarrh dhritaatsarhr dhritaatsahrr dhritaatsahrr dhritaathsrra dhritaathsrar dhritaathsrra
dhritaathsrar dhritaathsarr dhritaathsarr dhritaathrsra dhritaathrsar dhritaathrrsa dhritaathrras dhritaathrars dhritaathrasr
dhritaathrrsa dhritaathrras dhritaathrsra dhritaathrsar dhritaathrasr dhritaathrars dhritaatharrs dhritaatharsr dhritaatharrs
dhritaatharsr dhritaathasrr dhritaathasrr dhritaatrhsra dhritaatrhsar dhritaatrhrsa dhritaatrhras dhritaatrhars dhritaatrhasr
dhritaatrshra dhritaatrshar dhritaatrsrha dhritaatrsrah dhritaatrsarh dhritaatrsahr dhritaatrrsha dhritaatrrsah dhritaatrrhsa
dhritaatrrhas dhritaatrrahs dhritaatrrash dhritaatrasrh dhritaatrashr dhritaatrarsh dhritaatrarhs dhritaatrahrs dhritaatrahsr
dhritaatrhrsa dhritaatrhras dhritaatrhsra dhritaatrhsar dhritaatrhasr dhritaatrhars dhritaatrrhsa dhritaatrrhas dhritaatrrsha
dhritaatrrsah dhritaatrrash dhritaatrrahs dhritaatrsrha dhritaatrsrah dhritaatrshra dhritaatrshar dhritaatrsahr dhritaatrsarh
dhritaatrarsh dhritaatrarhs dhritaatrasrh dhritaatrashr dhritaatrahsr dhritaatrahrs dhritaatahrrs dhritaatahrsr dhritaatahrrs
dhritaatahrsr dhritaatahsrr dhritaatahsrr dhritaatarhrs dhritaatarhsr dhritaatarrhs dhritaatarrsh dhritaatarsrh dhritaatarshr
dhritaatarrhs dhritaatarrsh dhritaatarhrs dhritaatarhsr dhritaatarshr dhritaatarsrh dhritaatasrrh dhritaatasrhr dhritaatasrrh
dhritaatasrhr dhritaatashrr dhritaatashrr dhritaarshtra dhritaarshtar dhritaarshrta dhritaarshrat dhritaarshart dhritaarshatr
dhritaarsthra dhritaarsthar dhritaarstrha dhritaarstrah dhritaarstarh dhritaarstahr dhritaarsrtha dhritaarsrtah dhritaarsrhta
dhritaarsrhat dhritaarsraht dhritaarsrath dhritaarsatrh dhritaarsathr dhritaarsarth dhritaarsarht dhritaarsahrt dhritaarsahtr
dhritaarhstra dhritaarhstar dhritaarhsrta dhritaarhsrat dhritaarhsart dhritaarhsatr dhritaarhtsra dhritaarhtsar dhritaarhtrsa
dhritaarhtras dhritaarhtars dhritaarhtasr dhritaarhrtsa dhritaarhrtas dhritaarhrsta dhritaarhrsat dhritaarhrast dhritaarhrats
dhritaarhatrs dhritaarhatsr dhritaarharts dhritaarharst dhritaarhasrt dhritaarhastr dhritaarthsra dhritaarthsar dhritaarthrsa
dhritaarthras dhritaarthars dhritaarthasr dhritaartshra dhritaartshar dhritaartsrha dhritaartsrah dhritaartsarh dhritaartsahr
dhritaartrsha dhritaartrsah dhritaartrhsa dhritaartrhas dhritaartrahs dhritaartrash dhritaartasrh dhritaartashr dhritaartarsh
dhritaartarhs dhritaartahrs dhritaartahsr dhritaarrhtsa dhritaarrhtas dhritaarrhsta dhritaarrhsat dhritaarrhast dhritaarrhats
dhritaarrthsa dhritaarrthas dhritaarrtsha dhritaarrtsah dhritaarrtash dhritaarrtahs dhritaarrstha dhritaarrstah dhritaarrshta
dhritaarrshat dhritaarrsaht dhritaarrsath dhritaarratsh dhritaarraths dhritaarrasth dhritaarrasht dhritaarrahst dhritaarrahts
dhritaarahtrs dhritaarahtsr dhritaarahrts dhritaarahrst dhritaarahsrt dhritaarahstr dhritaarathrs dhritaarathsr dhritaaratrhs
dhritaaratrsh dhritaaratsrh dhritaaratshr dhritaararths dhritaarartsh dhritaararhts dhritaararhst dhritaararsht dhritaararsth
dhritaarastrh dhritaarasthr dhritaarasrth dhritaarasrht dhritaarashrt dhritaarashtr dhritaaashtrr dhritaaashtrr dhritaaashrtr
dhritaaashrrt dhritaaashrrt dhritaaashrtr dhritaaasthrr dhritaaasthrr dhritaaastrhr dhritaaastrrh dhritaaastrrh dhritaaastrhr
dhritaaasrthr dhritaaasrtrh dhritaaasrhtr dhritaaasrhrt dhritaaasrrht dhritaaasrrth dhritaaasrtrh dhritaaasrthr dhritaaasrrth
dhritaaasrrht dhritaaasrhrt dhritaaasrhtr dhritaaahstrr dhritaaahstrr dhritaaahsrtr dhritaaahsrrt dhritaaahsrrt dhritaaahsrtr
dhritaaahtsrr dhritaaahtsrr dhritaaahtrsr dhritaaahtrrs dhritaaahtrrs dhritaaahtrsr dhritaaahrtsr dhritaaahrtrs dhritaaahrstr
dhritaaahrsrt dhritaaahrrst dhritaaahrrts dhritaaahrtrs dhritaaahrtsr dhritaaahrrts dhritaaahrrst dhritaaahrsrt dhritaaahrstr
dhritaaathsrr dhritaaathsrr dhritaaathrsr dhritaaathrrs dhritaaathrrs dhritaaathrsr dhritaaatshrr dhritaaatshrr dhritaaatsrhr
dhritaaatsrrh dhritaaatsrrh dhritaaatsrhr dhritaaatrshr dhritaaatrsrh dhritaaatrhsr dhritaaatrhrs dhritaaatrrhs dhritaaatrrsh
dhritaaatrsrh dhritaaatrshr dhritaaatrrsh dhritaaatrrhs dhritaaatrhrs dhritaaatrhsr dhritaaarhtsr dhritaaarhtrs dhritaaarhstr
dhritaaarhsrt dhritaaarhrst dhritaaarhrts dhritaaarthsr dhritaaarthrs dhritaaartshr dhritaaartsrh dhritaaartrsh dhritaaartrhs
dhritaaarsthr dhritaaarstrh dhritaaarshtr dhritaaarshrt dhritaaarsrht dhritaaarsrth dhritaaarrtsh dhritaaarrths dhritaaarrsth
dhritaaarrsht dhritaaarrhst dhritaaarrhts dhritaaarhtrs dhritaaarhtsr dhritaaarhrts dhritaaarhrst dhritaaarhsrt dhritaaarhstr
dhritaaarthrs dhritaaarthsr dhritaaartrhs dhritaaartrsh dhritaaartsrh dhritaaartshr dhritaaarrths dhritaaarrtsh dhritaaarrhts
dhritaaarrhst dhritaaarrsht dhritaaarrsth dhritaaarstrh dhritaaarsthr dhritaaarsrth dhritaaarsrht dhritaaarshrt dhritaaarshtr
dhritasarhtra dhritasarhtar dhritasarhrta dhritasarhrat dhritasarhart dhritasarhatr dhritasarthra dhritasarthar dhritasartrha
dhritasartrah dhritasartarh dhritasartahr dhritasarrtha dhritasarrtah dhritasarrhta dhritasarrhat dhritasarraht dhritasarrath
dhritasaratrh dhritasarathr dhritasararth dhritasararht dhritasarahrt dhritasarahtr dhritasahrtra dhritasahrtar dhritasahrrta
dhritasahrrat dhritasahrart dhritasahratr dhritasahtrra dhritasahtrar dhritasahtrra dhritasahtrar dhritasahtarr dhritasahtarr
dhritasahrtra dhritasahrtar dhritasahrrta dhritasahrrat dhritasahrart dhritasahratr dhritasahatrr dhritasahatrr dhritasahartr
dhritasaharrt dhritasaharrt dhritasahartr dhritasathrra dhritasathrar dhritasathrra dhritasathrar dhritasatharr dhritasatharr
dhritasatrhra dhritasatrhar dhritasatrrha dhritasatrrah dhritasatrarh dhritasatrahr dhritasatrrha dhritasatrrah dhritasatrhra
dhritasatrhar dhritasatrahr dhritasatrarh dhritasatarrh dhritasatarhr dhritasatarrh dhritasatarhr dhritasatahrr dhritasatahrr
dhritasarhtra dhritasarhtar dhritasarhrta dhritasarhrat dhritasarhart dhritasarhatr dhritasarthra dhritasarthar dhritasartrha
dhritasartrah dhritasartarh dhritasartahr dhritasarrtha dhritasarrtah dhritasarrhta dhritasarrhat dhritasarraht dhritasarrath
dhritasaratrh dhritasarathr dhritasararth dhritasararht dhritasarahrt dhritasarahtr dhritasaahtrr dhritasaahtrr dhritasaahrtr
dhritasaahrrt dhritasaahrrt dhritasaahrtr dhritasaathrr dhritasaathrr dhritasaatrhr dhritasaatrrh dhritasaatrrh dhritasaatrhr
dhritasaarthr dhritasaartrh dhritasaarhtr dhritasaarhrt dhritasaarrht dhritasaarrth dhritasaartrh dhritasaarthr dhritasaarrth
dhritasaarrht dhritasaarhrt dhritasaarhtr dhritasrahtra dhritasrahtar dhritasrahrta dhritasrahrat dhritasrahart dhritasrahatr
dhritasrathra dhritasrathar dhritasratrha dhritasratrah dhritasratarh dhritasratahr dhritasrartha dhritasrartah dhritasrarhta
dhritasrarhat dhritasraraht dhritasrarath dhritasraatrh dhritasraathr dhritasraarth dhritasraarht dhritasraahrt dhritasraahtr
dhritasrhatra dhritasrhatar dhritasrharta dhritasrharat dhritasrhaart dhritasrhaatr dhritasrhtara dhritasrhtaar dhritasrhtraa
dhritasrhtraa dhritasrhtara dhritasrhtaar dhritasrhrtaa dhritasrhrtaa dhritasrhrata dhritasrhraat dhritasrhraat dhritasrhrata
dhritasrhatra dhritasrhatar dhritasrharta dhritasrharat dhritasrhaart dhritasrhaatr dhritasrthara dhritasrthaar dhritasrthraa
dhritasrthraa dhritasrthara dhritasrthaar dhritasrtahra dhritasrtahar dhritasrtarha dhritasrtarah dhritasrtaarh dhritasrtaahr
dhritasrtraha dhritasrtraah dhritasrtrhaa dhritasrtrhaa dhritasrtraha dhritasrtraah dhritasrtaarh dhritasrtaahr dhritasrtarah
dhritasrtarha dhritasrtahra dhritasrtahar dhritasrrhtaa dhritasrrhtaa dhritasrrhata dhritasrrhaat dhritasrrhaat dhritasrrhata
dhritasrrthaa dhritasrrthaa dhritasrrtaha dhritasrrtaah dhritasrrtaah dhritasrrtaha dhritasrratha dhritasrratah dhritasrrahta
dhritasrrahat dhritasrraaht dhritasrraath dhritasrratah dhritasrratha dhritasrraath dhritasrraaht dhritasrrahat dhritasrrahta
dhritasrahtra dhritasrahtar dhritasrahrta dhritasrahrat dhritasrahart dhritasrahatr dhritasrathra dhritasrathar dhritasratrha
dhritasratrah dhritasratarh dhritasratahr dhritasrartha dhritasrartah dhritasrarhta dhritasrarhat dhritasraraht dhritasrarath
dhritasraatrh dhritasraathr dhritasraarth dhritasraarht dhritasraahrt dhritasraahtr dhritashratra dhritashratar dhritashrarta
dhritashrarat dhritashraart dhritashraatr dhritashrtara dhritashrtaar dhritashrtraa dhritashrtraa dhritashrtara dhritashrtaar
dhritashrrtaa dhritashrrtaa dhritashrrata dhritashrraat dhritashrraat dhritashrrata dhritashratra dhritashratar dhritashrarta
dhritashrarat dhritashraart dhritashraatr dhritashartra dhritashartar dhritasharrta dhritasharrat dhritasharart dhritasharatr
dhritashatrra dhritashatrar dhritashatrra dhritashatrar dhritashatarr dhritashatarr dhritashartra dhritashartar dhritasharrta
dhritasharrat dhritasharart dhritasharatr dhritashaatrr dhritashaatrr dhritashaartr dhritashaarrt dhritashaarrt dhritashaartr
dhritashtarra dhritashtarar dhritashtarra dhritashtarar dhritashtaarr dhritashtaarr dhritashtrara dhritashtraar dhritashtrraa
dhritashtrraa dhritashtrara dhritashtraar dhritashtrraa dhritashtrraa dhritashtrara dhritashtraar dhritashtraar dhritashtrara
dhritashtarra dhritashtarar dhritashtarra dhritashtarar dhritashtaarr dhritashtaarr dhritashratra dhritashratar dhritashrarta
dhritashrarat dhritashraart dhritashraatr dhritashrtara dhritashrtaar dhritashrtraa dhritashrtraa dhritashrtara dhritashrtaar
dhritashrrtaa dhritashrrtaa dhritashrrata dhritashrraat dhritashrraat dhritashrrata dhritashratra dhritashratar dhritashrarta
dhritashrarat dhritashraart dhritashraatr dhritashaatrr dhritashaatrr dhritashaartr dhritashaarrt dhritashaarrt dhritashaartr
dhritashatarr dhritashatarr dhritashatrar dhritashatrra dhritashatrra dhritashatrar dhritashartar dhritashartra dhritasharatr
dhritasharart dhritasharrat dhritasharrta dhritashartra dhritashartar dhritasharrta dhritasharrat dhritasharart dhritasharatr
dhritastrhara dhritastrhaar dhritastrhraa dhritastrhraa dhritastrhara dhritastrhaar dhritastrahra dhritastrahar dhritastrarha
dhritastrarah dhritastraarh dhritastraahr dhritastrraha dhritastrraah dhritastrrhaa dhritastrrhaa dhritastrraha dhritastrraah
dhritastraarh dhritastraahr dhritastrarah dhritastrarha dhritastrahra dhritastrahar dhritasthrara dhritasthraar dhritasthrraa
dhritasthrraa dhritasthrara dhritasthraar dhritastharra dhritastharar dhritastharra dhritastharar dhritasthaarr dhritasthaarr
dhritasthrara dhritasthraar dhritasthrraa dhritasthrraa dhritasthrara dhritasthraar dhritasthaarr dhritasthaarr dhritastharar
dhritastharra dhritastharra dhritastharar dhritastahrra dhritastahrar dhritastahrra dhritastahrar dhritastaharr dhritastaharr
dhritastarhra dhritastarhar dhritastarrha dhritastarrah dhritastararh dhritastarahr dhritastarrha dhritastarrah dhritastarhra
dhritastarhar dhritastarahr dhritastararh dhritastaarrh dhritastaarhr dhritastaarrh dhritastaarhr dhritastaahrr dhritastaahrr
dhritastrhara dhritastrhaar dhritastrhraa dhritastrhraa dhritastrhara dhritastrhaar dhritastrahra dhritastrahar dhritastrarha
dhritastrarah dhritastraarh dhritastraahr dhritastrraha dhritastrraah dhritastrrhaa dhritastrrhaa dhritastrraha dhritastrraah
dhritastraarh dhritastraahr dhritastrarah dhritastrarha dhritastrahra dhritastrahar dhritastaharr dhritastaharr dhritastahrar
dhritastahrra dhritastahrra dhritastahrar dhritastaahrr dhritastaahrr dhritastaarhr dhritastaarrh dhritastaarrh dhritastaarhr
dhritastarahr dhritastararh dhritastarhar dhritastarhra dhritastarrha dhritastarrah dhritastararh dhritastarahr dhritastarrah
dhritastarrha dhritastarhra dhritastarhar dhritasrrhtaa dhritasrrhtaa dhritasrrhata dhritasrrhaat dhritasrrhaat dhritasrrhata
dhritasrrthaa dhritasrrthaa dhritasrrtaha dhritasrrtaah dhritasrrtaah dhritasrrtaha dhritasrratha dhritasrratah dhritasrrahta
dhritasrrahat dhritasrraaht dhritasrraath dhritasrratah dhritasrratha dhritasrraath dhritasrraaht dhritasrrahat dhritasrrahta
dhritasrhrtaa dhritasrhrtaa dhritasrhrata dhritasrhraat dhritasrhraat dhritasrhrata dhritasrhtraa dhritasrhtraa dhritasrhtara
dhritasrhtaar dhritasrhtaar dhritasrhtara dhritasrhatra dhritasrhatar dhritasrharta dhritasrharat dhritasrhaart dhritasrhaatr
dhritasrhatar dhritasrhatra dhritasrhaatr dhritasrhaart dhritasrharat dhritasrharta dhritasrthraa dhritasrthraa dhritasrthara
dhritasrthaar dhritasrthaar dhritasrthara dhritasrtrhaa dhritasrtrhaa dhritasrtraha dhritasrtraah dhritasrtraah dhritasrtraha
dhritasrtarha dhritasrtarah dhritasrtahra dhritasrtahar dhritasrtaahr dhritasrtaarh dhritasrtarah dhritasrtarha dhritasrtaarh
dhritasrtaahr dhritasrtahar dhritasrtahra dhritasrahtra dhritasrahtar dhritasrahrta dhritasrahrat dhritasrahart dhritasrahatr
dhritasrathra dhritasrathar dhritasratrha dhritasratrah dhritasratarh dhritasratahr dhritasrartha dhritasrartah dhritasrarhta
dhritasrarhat dhritasraraht dhritasrarath dhritasraatrh dhritasraathr dhritasraarth dhritasraarht dhritasraahrt dhritasraahtr
dhritasrahtar dhritasrahtra dhritasrahatr dhritasrahart dhritasrahrat dhritasrahrta dhritasrathar dhritasrathra dhritasratahr
dhritasratarh dhritasratrah dhritasratrha dhritasraathr dhritasraatrh dhritasraahtr dhritasraahrt dhritasraarht dhritasraarth
dhritasrartah dhritasrartha dhritasrarath dhritasraraht dhritasrarhat dhritasrarhta dhritasarhtra dhritasarhtar dhritasarhrta
dhritasarhrat dhritasarhart dhritasarhatr dhritasarthra dhritasarthar dhritasartrha dhritasartrah dhritasartarh dhritasartahr
dhritasarrtha dhritasarrtah dhritasarrhta dhritasarrhat dhritasarraht dhritasarrath dhritasaratrh dhritasarathr dhritasararth
dhritasararht dhritasarahrt dhritasarahtr dhritasahrtra dhritasahrtar dhritasahrrta dhritasahrrat dhritasahrart dhritasahratr
dhritasahtrra dhritasahtrar dhritasahtrra dhritasahtrar dhritasahtarr dhritasahtarr dhritasahrtra dhritasahrtar dhritasahrrta
dhritasahrrat dhritasahrart dhritasahratr dhritasahatrr dhritasahatrr dhritasahartr dhritasaharrt dhritasaharrt dhritasahartr
dhritasathrra dhritasathrar dhritasathrra dhritasathrar dhritasatharr dhritasatharr dhritasatrhra dhritasatrhar dhritasatrrha
dhritasatrrah dhritasatrarh dhritasatrahr dhritasatrrha dhritasatrrah dhritasatrhra dhritasatrhar dhritasatrahr dhritasatrarh
dhritasatarrh dhritasatarhr dhritasatarrh dhritasatarhr dhritasatahrr dhritasatahrr dhritasarhtra dhritasarhtar dhritasarhrta
dhritasarhrat dhritasarhart dhritasarhatr dhritasarthra dhritasarthar dhritasartrha dhritasartrah dhritasartarh dhritasartahr
dhritasarrtha dhritasarrtah dhritasarrhta dhritasarrhat dhritasarraht dhritasarrath dhritasaratrh dhritasarathr dhritasararth
dhritasararht dhritasarahrt dhritasarahtr dhritasaahtrr dhritasaahtrr dhritasaahrtr dhritasaahrrt dhritasaahrrt dhritasaahrtr
dhritasaathrr dhritasaathrr dhritasaatrhr dhritasaatrrh dhritasaatrrh dhritasaatrhr dhritasaarthr dhritasaartrh dhritasaarhtr
dhritasaarhrt dhritasaarrht dhritasaarrth dhritasaartrh dhritasaarthr dhritasaarrth dhritasaarrht dhritasaarhrt dhritasaarhtr
dhritahasrtra dhritahasrtar dhritahasrrta dhritahasrrat dhritahasrart dhritahasratr dhritahastrra dhritahastrar dhritahastrra
dhritahastrar dhritahastarr dhritahastarr dhritahasrtra dhritahasrtar dhritahasrrta dhritahasrrat dhritahasrart dhritahasratr
dhritahasatrr dhritahasatrr dhritahasartr dhritahasarrt dhritahasarrt dhritahasartr dhritaharstra dhritaharstar dhritaharsrta
dhritaharsrat dhritaharsart dhritaharsatr dhritahartsra dhritahartsar dhritahartrsa dhritahartras dhritahartars dhritahartasr
dhritaharrtsa dhritaharrtas dhritaharrsta dhritaharrsat dhritaharrast dhritaharrats dhritaharatrs dhritaharatsr dhritahararts
dhritahararst dhritaharasrt dhritaharastr dhritahatrsra dhritahatrsar dhritahatrrsa dhritahatrras dhritahatrars dhritahatrasr
dhritahatsrra dhritahatsrar dhritahatsrra dhritahatsrar dhritahatsarr dhritahatsarr dhritahatrsra dhritahatrsar dhritahatrrsa
dhritahatrras dhritahatrars dhritahatrasr dhritahatasrr dhritahatasrr dhritahatarsr dhritahatarrs dhritahatarrs dhritahatarsr
dhritaharrtsa dhritaharrtas dhritaharrsta dhritaharrsat dhritaharrast dhritaharrats dhritahartrsa dhritahartras dhritahartsra
dhritahartsar dhritahartasr dhritahartars dhritaharstra dhritaharstar dhritaharsrta dhritaharsrat dhritaharsart dhritaharsatr
dhritaharatsr dhritaharatrs dhritaharastr dhritaharasrt dhritahararst dhritahararts dhritahaartrs dhritahaartsr dhritahaarrts
dhritahaarrst dhritahaarsrt dhritahaarstr dhritahaatrrs dhritahaatrsr dhritahaatrrs dhritahaatrsr dhritahaatsrr dhritahaatsrr
dhritahaartrs dhritahaartsr dhritahaarrts dhritahaarrst dhritahaarsrt dhritahaarstr dhritahaastrr dhritahaastrr dhritahaasrtr
dhritahaasrrt dhritahaasrrt dhritahaasrtr dhritahsartra dhritahsartar dhritahsarrta dhritahsarrat dhritahsarart dhritahsaratr
dhritahsatrra dhritahsatrar dhritahsatrra dhritahsatrar dhritahsatarr dhritahsatarr dhritahsartra dhritahsartar dhritahsarrta
dhritahsarrat dhritahsarart dhritahsaratr dhritahsaatrr dhritahsaatrr dhritahsaartr dhritahsaarrt dhritahsaarrt dhritahsaartr
dhritahsratra dhritahsratar dhritahsrarta dhritahsrarat dhritahsraart dhritahsraatr dhritahsrtara dhritahsrtaar dhritahsrtraa
dhritahsrtraa dhritahsrtara dhritahsrtaar dhritahsrrtaa dhritahsrrtaa dhritahsrrata dhritahsrraat dhritahsrraat dhritahsrrata
dhritahsratra dhritahsratar dhritahsrarta dhritahsrarat dhritahsraart dhritahsraatr dhritahstrara dhritahstraar dhritahstrraa
dhritahstrraa dhritahstrara dhritahstraar dhritahstarra dhritahstarar dhritahstarra dhritahstarar dhritahstaarr dhritahstaarr
dhritahstrara dhritahstraar dhritahstrraa dhritahstrraa dhritahstrara dhritahstraar dhritahstaarr dhritahstaarr dhritahstarar
dhritahstarra dhritahstarra dhritahstarar dhritahsrrtaa dhritahsrrtaa dhritahsrrata dhritahsrraat dhritahsrraat dhritahsrrata
dhritahsrtraa dhritahsrtraa dhritahsrtara dhritahsrtaar dhritahsrtaar dhritahsrtara dhritahsratra dhritahsratar dhritahsrarta
dhritahsrarat dhritahsraart dhritahsraatr dhritahsratar dhritahsratra dhritahsraatr dhritahsraart dhritahsrarat dhritahsrarta
dhritahsartra dhritahsartar dhritahsarrta dhritahsarrat dhritahsarart dhritahsaratr dhritahsatrra dhritahsatrar dhritahsatrra
dhritahsatrar dhritahsatarr dhritahsatarr dhritahsartra dhritahsartar dhritahsarrta dhritahsarrat dhritahsarart dhritahsaratr
dhritahsaatrr dhritahsaatrr dhritahsaartr dhritahsaarrt dhritahsaarrt dhritahsaartr dhritahrsatra dhritahrsatar dhritahrsarta
dhritahrsarat dhritahrsaart dhritahrsaatr dhritahrstara dhritahrstaar dhritahrstraa dhritahrstraa dhritahrstara dhritahrstaar
dhritahrsrtaa dhritahrsrtaa dhritahrsrata dhritahrsraat dhritahrsraat dhritahrsrata dhritahrsatra dhritahrsatar dhritahrsarta
dhritahrsarat dhritahrsaart dhritahrsaatr dhritahrastra dhritahrastar dhritahrasrta dhritahrasrat dhritahrasart dhritahrasatr
dhritahratsra dhritahratsar dhritahratrsa dhritahratras dhritahratars dhritahratasr dhritahrartsa dhritahrartas dhritahrarsta
dhritahrarsat dhritahrarast dhritahrarats dhritahraatrs dhritahraatsr dhritahraarts dhritahraarst dhritahraasrt dhritahraastr
dhritahrtasra dhritahrtasar dhritahrtarsa dhritahrtaras dhritahrtaars dhritahrtaasr dhritahrtsara dhritahrtsaar dhritahrtsraa
dhritahrtsraa dhritahrtsara dhritahrtsaar dhritahrtrsaa dhritahrtrsaa dhritahrtrasa dhritahrtraas dhritahrtraas dhritahrtrasa
dhritahrtasra dhritahrtasar dhritahrtarsa dhritahrtaras dhritahrtaars dhritahrtaasr dhritahrratsa dhritahrratas dhritahrrasta
dhritahrrasat dhritahrraast dhritahrraats dhritahrrtasa dhritahrrtaas dhritahrrtsaa dhritahrrtsaa dhritahrrtasa dhritahrrtaas
dhritahrrstaa dhritahrrstaa dhritahrrsata dhritahrrsaat dhritahrrsaat dhritahrrsata dhritahrratsa dhritahrratas dhritahrrasta
dhritahrrasat dhritahrraast dhritahrraats dhritahraatrs dhritahraatsr dhritahraarts dhritahraarst dhritahraasrt dhritahraastr
dhritahratars dhritahratasr dhritahratras dhritahratrsa dhritahratsra dhritahratsar dhritahrartas dhritahrartsa dhritahrarats
dhritahrarast dhritahrarsat dhritahrarsta dhritahrastra dhritahrastar dhritahrasrta dhritahrasrat dhritahrasart dhritahrasatr
dhritahtsrara dhritahtsraar dhritahtsrraa dhritahtsrraa dhritahtsrara dhritahtsraar dhritahtsarra dhritahtsarar dhritahtsarra
dhritahtsarar dhritahtsaarr dhritahtsaarr dhritahtsrara dhritahtsraar dhritahtsrraa dhritahtsrraa dhritahtsrara dhritahtsraar
dhritahtsaarr dhritahtsaarr dhritahtsarar dhritahtsarra dhritahtsarra dhritahtsarar dhritahtrsara dhritahtrsaar dhritahtrsraa
dhritahtrsraa dhritahtrsara dhritahtrsaar dhritahtrasra dhritahtrasar dhritahtrarsa dhritahtraras dhritahtraars dhritahtraasr
dhritahtrrasa dhritahtrraas dhritahtrrsaa dhritahtrrsaa dhritahtrrasa dhritahtrraas dhritahtraars dhritahtraasr dhritahtraras
dhritahtrarsa dhritahtrasra dhritahtrasar dhritahtarsra dhritahtarsar dhritahtarrsa dhritahtarras dhritahtarars dhritahtarasr
dhritahtasrra dhritahtasrar dhritahtasrra dhritahtasrar dhritahtasarr dhritahtasarr dhritahtarsra dhritahtarsar dhritahtarrsa
dhritahtarras dhritahtarars dhritahtarasr dhritahtaasrr dhritahtaasrr dhritahtaarsr dhritahtaarrs dhritahtaarrs dhritahtaarsr
dhritahtrrasa dhritahtrraas dhritahtrrsaa dhritahtrrsaa dhritahtrrasa dhritahtrraas dhritahtrarsa dhritahtraras dhritahtrasra
dhritahtrasar dhritahtraasr dhritahtraars dhritahtrsara dhritahtrsaar dhritahtrsraa dhritahtrsraa dhritahtrsara dhritahtrsaar
dhritahtraasr dhritahtraars dhritahtrasar dhritahtrasra dhritahtrarsa dhritahtraras dhritahtarars dhritahtarasr dhritahtarras
dhritahtarrsa dhritahtarsra dhritahtarsar dhritahtaarrs dhritahtaarsr dhritahtaarrs dhritahtaarsr dhritahtaasrr dhritahtaasrr
dhritahtarars dhritahtarasr dhritahtarras dhritahtarrsa dhritahtarsra dhritahtarsar dhritahtasarr dhritahtasarr dhritahtasrar
dhritahtasrra dhritahtasrra dhritahtasrar dhritahrsrtaa dhritahrsrtaa dhritahrsrata dhritahrsraat dhritahrsraat dhritahrsrata
dhritahrstraa dhritahrstraa dhritahrstara dhritahrstaar dhritahrstaar dhritahrstara dhritahrsatra dhritahrsatar dhritahrsarta
dhritahrsarat dhritahrsaart dhritahrsaatr dhritahrsatar dhritahrsatra dhritahrsaatr dhritahrsaart dhritahrsarat dhritahrsarta
dhritahrrstaa dhritahrrstaa dhritahrrsata dhritahrrsaat dhritahrrsaat dhritahrrsata dhritahrrtsaa dhritahrrtsaa dhritahrrtasa
dhritahrrtaas dhritahrrtaas dhritahrrtasa dhritahrratsa dhritahrratas dhritahrrasta dhritahrrasat dhritahrraast dhritahrraats
dhritahrratas dhritahrratsa dhritahrraats dhritahrraast dhritahrrasat dhritahrrasta dhritahrtrsaa dhritahrtrsaa dhritahrtrasa
dhritahrtraas dhritahrtraas dhritahrtrasa dhritahrtsraa dhritahrtsraa dhritahrtsara dhritahrtsaar dhritahrtsaar dhritahrtsara
dhritahrtasra dhritahrtasar dhritahrtarsa dhritahrtaras dhritahrtaars dhritahrtaasr dhritahrtasar dhritahrtasra dhritahrtaasr
dhritahrtaars dhritahrtaras dhritahrtarsa dhritahrartsa dhritahrartas dhritahrarsta dhritahrarsat dhritahrarast dhritahrarats
dhritahratrsa dhritahratras dhritahratsra dhritahratsar dhritahratasr dhritahratars dhritahrastra dhritahrastar dhritahrasrta
dhritahrasrat dhritahrasart dhritahrasatr dhritahraatsr dhritahraatrs dhritahraastr dhritahraasrt dhritahraarst dhritahraarts
dhritahrartas dhritahrartsa dhritahrarats dhritahrarast dhritahrarsat dhritahrarsta dhritahratras dhritahratrsa dhritahratars
dhritahratasr dhritahratsar dhritahratsra dhritahraatrs dhritahraatsr dhritahraarts dhritahraarst dhritahraasrt dhritahraastr
dhritahrastar dhritahrastra dhritahrasatr dhritahrasart dhritahrasrat dhritahrasrta dhritahasrtra dhritahasrtar dhritahasrrta
dhritahasrrat dhritahasrart dhritahasratr dhritahastrra dhritahastrar dhritahastrra dhritahastrar dhritahastarr dhritahastarr
dhritahasrtra dhritahasrtar dhritahasrrta dhritahasrrat dhritahasrart dhritahasratr dhritahasatrr dhritahasatrr dhritahasartr
dhritahasarrt dhritahasarrt dhritahasartr dhritaharstra dhritaharstar dhritaharsrta dhritaharsrat dhritaharsart dhritaharsatr
dhritahartsra dhritahartsar dhritahartrsa dhritahartras dhritahartars dhritahartasr dhritaharrtsa dhritaharrtas dhritaharrsta
dhritaharrsat dhritaharrast dhritaharrats dhritaharatrs dhritaharatsr dhritahararts dhritahararst dhritaharasrt dhritaharastr
dhritahatrsra dhritahatrsar dhritahatrrsa dhritahatrras dhritahatrars dhritahatrasr dhritahatsrra dhritahatsrar dhritahatsrra
dhritahatsrar dhritahatsarr dhritahatsarr dhritahatrsra dhritahatrsar dhritahatrrsa dhritahatrras dhritahatrars dhritahatrasr
dhritahatasrr dhritahatasrr dhritahatarsr dhritahatarrs dhritahatarrs dhritahatarsr dhritaharrtsa dhritaharrtas dhritaharrsta
dhritaharrsat dhritaharrast dhritaharrats dhritahartrsa dhritahartras dhritahartsra dhritahartsar dhritahartasr dhritahartars
dhritaharstra dhritaharstar dhritaharsrta dhritaharsrat dhritaharsart dhritaharsatr dhritaharatsr dhritaharatrs dhritaharastr
dhritaharasrt dhritahararst dhritahararts dhritahaartrs dhritahaartsr dhritahaarrts dhritahaarrst dhritahaarsrt dhritahaarstr
dhritahaatrrs dhritahaatrsr dhritahaatrrs dhritahaatrsr dhritahaatsrr dhritahaatsrr dhritahaartrs dhritahaartsr dhritahaarrts
dhritahaarrst dhritahaarsrt dhritahaarstr dhritahaastrr dhritahaastrr dhritahaasrtr dhritahaasrrt dhritahaasrrt dhritahaasrtr
dhritatashrra dhritatashrar dhritatashrra dhritatashrar dhritatasharr dhritatasharr dhritatasrhra dhritatasrhar dhritatasrrha
dhritatasrrah dhritatasrarh dhritatasrahr dhritatasrrha dhritatasrrah dhritatasrhra dhritatasrhar dhritatasrahr dhritatasrarh
dhritatasarrh dhritatasarhr dhritatasarrh dhritatasarhr dhritatasahrr dhritatasahrr dhritatahsrra dhritatahsrar dhritatahsrra
dhritatahsrar dhritatahsarr dhritatahsarr dhritatahrsra dhritatahrsar dhritatahrrsa dhritatahrras dhritatahrars dhritatahrasr
dhritatahrrsa dhritatahrras dhritatahrsra dhritatahrsar dhritatahrasr dhritatahrars dhritataharrs dhritataharsr dhritataharrs
dhritataharsr dhritatahasrr dhritatahasrr dhritatarhsra dhritatarhsar dhritatarhrsa dhritatarhras dhritatarhars dhritatarhasr
dhritatarshra dhritatarshar dhritatarsrha dhritatarsrah dhritatarsarh dhritatarsahr dhritatarrsha dhritatarrsah dhritatarrhsa
dhritatarrhas dhritatarrahs dhritatarrash dhritatarasrh dhritatarashr dhritatararsh dhritatararhs dhritatarahrs dhritatarahsr
dhritatarhrsa dhritatarhras dhritatarhsra dhritatarhsar dhritatarhasr dhritatarhars dhritatarrhsa dhritatarrhas dhritatarrsha
dhritatarrsah dhritatarrash dhritatarrahs dhritatarsrha dhritatarsrah dhritatarshra dhritatarshar dhritatarsahr dhritatarsarh
dhritatararsh dhritatararhs dhritatarasrh dhritatarashr dhritatarahsr dhritatarahrs dhritataahrrs dhritataahrsr dhritataahrrs
dhritataahrsr dhritataahsrr dhritataahsrr dhritataarhrs dhritataarhsr dhritataarrhs dhritataarrsh dhritataarsrh dhritataarshr
dhritataarrhs dhritataarrsh dhritataarhrs dhritataarhsr dhritataarshr dhritataarsrh dhritataasrrh dhritataasrhr dhritataasrrh
dhritataasrhr dhritataashrr dhritataashrr dhritatsahrra dhritatsahrar dhritatsahrra dhritatsahrar dhritatsaharr dhritatsaharr
dhritatsarhra dhritatsarhar dhritatsarrha dhritatsarrah dhritatsararh dhritatsarahr dhritatsarrha dhritatsarrah dhritatsarhra
dhritatsarhar dhritatsarahr dhritatsararh dhritatsaarrh dhritatsaarhr dhritatsaarrh dhritatsaarhr dhritatsaahrr dhritatsaahrr
dhritatsharra dhritatsharar dhritatsharra dhritatsharar dhritatshaarr dhritatshaarr dhritatshrara dhritatshraar dhritatshrraa
dhritatshrraa dhritatshrara dhritatshraar dhritatshrraa dhritatshrraa dhritatshrara dhritatshraar dhritatshraar dhritatshrara
dhritatsharra dhritatsharar dhritatsharra dhritatsharar dhritatshaarr dhritatshaarr dhritatsrhara dhritatsrhaar dhritatsrhraa
dhritatsrhraa dhritatsrhara dhritatsrhaar dhritatsrahra dhritatsrahar dhritatsrarha dhritatsrarah dhritatsraarh dhritatsraahr
dhritatsrraha dhritatsrraah dhritatsrrhaa dhritatsrrhaa dhritatsrraha dhritatsrraah dhritatsraarh dhritatsraahr dhritatsrarah
dhritatsrarha dhritatsrahra dhritatsrahar dhritatsrhraa dhritatsrhraa dhritatsrhara dhritatsrhaar dhritatsrhaar dhritatsrhara
dhritatsrrhaa dhritatsrrhaa dhritatsrraha dhritatsrraah dhritatsrraah dhritatsrraha dhritatsrarha dhritatsrarah dhritatsrahra
dhritatsrahar dhritatsraahr dhritatsraarh dhritatsrarah dhritatsrarha dhritatsraarh dhritatsraahr dhritatsrahar dhritatsrahra
dhritatsahrra dhritatsahrar dhritatsahrra dhritatsahrar dhritatsaharr dhritatsaharr dhritatsarhra dhritatsarhar dhritatsarrha
dhritatsarrah dhritatsararh dhritatsarahr dhritatsarrha dhritatsarrah dhritatsarhra dhritatsarhar dhritatsarahr dhritatsararh
dhritatsaarrh dhritatsaarhr dhritatsaarrh dhritatsaarhr dhritatsaahrr dhritatsaahrr dhritathsarra dhritathsarar dhritathsarra
dhritathsarar dhritathsaarr dhritathsaarr dhritathsrara dhritathsraar dhritathsrraa dhritathsrraa dhritathsrara dhritathsraar
dhritathsrraa dhritathsrraa dhritathsrara dhritathsraar dhritathsraar dhritathsrara dhritathsarra dhritathsarar dhritathsarra
dhritathsarar dhritathsaarr dhritathsaarr dhritathasrra dhritathasrar dhritathasrra dhritathasrar dhritathasarr dhritathasarr
dhritatharsra dhritatharsar dhritatharrsa dhritatharras dhritatharars dhritatharasr dhritatharrsa dhritatharras dhritatharsra
dhritatharsar dhritatharasr dhritatharars dhritathaarrs dhritathaarsr dhritathaarrs dhritathaarsr dhritathaasrr dhritathaasrr
dhritathrasra dhritathrasar dhritathrarsa dhritathraras dhritathraars dhritathraasr dhritathrsara dhritathrsaar dhritathrsraa
dhritathrsraa dhritathrsara dhritathrsaar dhritathrrsaa dhritathrrsaa dhritathrrasa dhritathrraas dhritathrraas dhritathrrasa
dhritathrasra dhritathrasar dhritathrarsa dhritathraras dhritathraars dhritathraasr dhritathrarsa dhritathraras dhritathrasra
dhritathrasar dhritathraasr dhritathraars dhritathrrasa dhritathrraas dhritathrrsaa dhritathrrsaa dhritathrrasa dhritathrraas
dhritathrsraa dhritathrsraa dhritathrsara dhritathrsaar dhritathrsaar dhritathrsara dhritathrarsa dhritathraras dhritathrasra
dhritathrasar dhritathraasr dhritathraars dhritathaarrs dhritathaarsr dhritathaarrs dhritathaarsr dhritathaasrr dhritathaasrr
dhritatharars dhritatharasr dhritatharras dhritatharrsa dhritatharsra dhritatharsar dhritatharras dhritatharrsa dhritatharars
dhritatharasr dhritatharsar dhritatharsra dhritathasrra dhritathasrar dhritathasrra dhritathasrar dhritathasarr dhritathasarr
dhritatrshara dhritatrshaar dhritatrshraa dhritatrshraa dhritatrshara dhritatrshaar dhritatrsahra dhritatrsahar dhritatrsarha
dhritatrsarah dhritatrsaarh dhritatrsaahr dhritatrsraha dhritatrsraah dhritatrsrhaa dhritatrsrhaa dhritatrsraha dhritatrsraah
dhritatrsaarh dhritatrsaahr dhritatrsarah dhritatrsarha dhritatrsahra dhritatrsahar dhritatrhsara dhritatrhsaar dhritatrhsraa
dhritatrhsraa dhritatrhsara dhritatrhsaar dhritatrhasra dhritatrhasar dhritatrharsa dhritatrharas dhritatrhaars dhritatrhaasr
dhritatrhrasa dhritatrhraas dhritatrhrsaa dhritatrhrsaa dhritatrhrasa dhritatrhraas dhritatrhaars dhritatrhaasr dhritatrharas
dhritatrharsa dhritatrhasra dhritatrhasar dhritatrahsra dhritatrahsar dhritatrahrsa dhritatrahras dhritatrahars dhritatrahasr
dhritatrashra dhritatrashar dhritatrasrha dhritatrasrah dhritatrasarh dhritatrasahr dhritatrarsha dhritatrarsah dhritatrarhsa
dhritatrarhas dhritatrarahs dhritatrarash dhritatraasrh dhritatraashr dhritatraarsh dhritatraarhs dhritatraahrs dhritatraahsr
dhritatrrhasa dhritatrrhaas dhritatrrhsaa dhritatrrhsaa dhritatrrhasa dhritatrrhaas dhritatrrahsa dhritatrrahas dhritatrrasha
dhritatrrasah dhritatrraash dhritatrraahs dhritatrrsaha dhritatrrsaah dhritatrrshaa dhritatrrshaa dhritatrrsaha dhritatrrsaah
dhritatrraash dhritatrraahs dhritatrrasah dhritatrrasha dhritatrrahsa dhritatrrahas dhritatrahars dhritatrahasr dhritatrahras
dhritatrahrsa dhritatrahsra dhritatrahsar dhritatraahrs dhritatraahsr dhritatraarhs dhritatraarsh dhritatraasrh dhritatraashr
dhritatrarahs dhritatrarash dhritatrarhas dhritatrarhsa dhritatrarsha dhritatrarsah dhritatrasarh dhritatrasahr dhritatrasrah
dhritatrasrha dhritatrashra dhritatrashar dhritatrshraa dhritatrshraa dhritatrshara dhritatrshaar dhritatrshaar dhritatrshara
dhritatrsrhaa dhritatrsrhaa dhritatrsraha dhritatrsraah dhritatrsraah dhritatrsraha dhritatrsarha dhritatrsarah dhritatrsahra
dhritatrsahar dhritatrsaahr dhritatrsaarh dhritatrsarah dhritatrsarha dhritatrsaarh dhritatrsaahr dhritatrsahar dhritatrsahra
dhritatrhsraa dhritatrhsraa dhritatrhsara dhritatrhsaar dhritatrhsaar dhritatrhsara dhritatrhrsaa dhritatrhrsaa dhritatrhrasa
dhritatrhraas dhritatrhraas dhritatrhrasa dhritatrharsa dhritatrharas dhritatrhasra dhritatrhasar dhritatrhaasr dhritatrhaars
dhritatrharas dhritatrharsa dhritatrhaars dhritatrhaasr dhritatrhasar dhritatrhasra dhritatrrhsaa dhritatrrhsaa dhritatrrhasa
dhritatrrhaas dhritatrrhaas dhritatrrhasa dhritatrrshaa dhritatrrshaa dhritatrrsaha dhritatrrsaah dhritatrrsaah dhritatrrsaha
dhritatrrasha dhritatrrasah dhritatrrahsa dhritatrrahas dhritatrraahs dhritatrraash dhritatrrasah dhritatrrasha dhritatrraash
dhritatrraahs dhritatrrahas dhritatrrahsa dhritatrahrsa dhritatrahras dhritatrahsra dhritatrahsar dhritatrahasr dhritatrahars
dhritatrarhsa dhritatrarhas dhritatrarsha dhritatrarsah dhritatrarash dhritatrarahs dhritatrasrha dhritatrasrah dhritatrashra
dhritatrashar dhritatrasahr dhritatrasarh dhritatraarsh dhritatraarhs dhritatraasrh dhritatraashr dhritatraahsr dhritatraahrs
dhritatrahras dhritatrahrsa dhritatrahars dhritatrahasr dhritatrahsar dhritatrahsra dhritatrarhas dhritatrarhsa dhritatrarahs
dhritatrarash dhritatrarsah dhritatrarsha dhritatraarhs dhritatraarsh dhritatraahrs dhritatraahsr dhritatraashr dhritatraasrh
dhritatrasrah dhritatrasrha dhritatrasarh dhritatrasahr dhritatrashar dhritatrashra dhritatashrra dhritatashrar dhritatashrra
dhritatashrar dhritatasharr dhritatasharr dhritatasrhra dhritatasrhar dhritatasrrha dhritatasrrah dhritatasrarh dhritatasrahr
dhritatasrrha dhritatasrrah dhritatasrhra dhritatasrhar dhritatasrahr dhritatasrarh dhritatasarrh dhritatasarhr dhritatasarrh
dhritatasarhr dhritatasahrr dhritatasahrr dhritatahsrra dhritatahsrar dhritatahsrra dhritatahsrar dhritatahsarr dhritatahsarr
dhritatahrsra dhritatahrsar dhritatahrrsa dhritatahrras dhritatahrars dhritatahrasr dhritatahrrsa dhritatahrras dhritatahrsra
dhritatahrsar dhritatahrasr dhritatahrars dhritataharrs dhritataharsr dhritataharrs dhritataharsr dhritatahasrr dhritatahasrr
dhritatarhsra dhritatarhsar dhritatarhrsa dhritatarhras dhritatarhars dhritatarhasr dhritatarshra dhritatarshar dhritatarsrha
dhritatarsrah dhritatarsarh dhritatarsahr dhritatarrsha dhritatarrsah dhritatarrhsa dhritatarrhas dhritatarrahs dhritatarrash
dhritatarasrh dhritatarashr dhritatararsh dhritatararhs dhritatarahrs dhritatarahsr dhritatarhrsa dhritatarhras dhritatarhsra
dhritatarhsar dhritatarhasr dhritatarhars dhritatarrhsa dhritatarrhas dhritatarrsha dhritatarrsah dhritatarrash dhritatarrahs
dhritatarsrha dhritatarsrah dhritatarshra dhritatarshar dhritatarsahr dhritatarsarh dhritatararsh dhritatararhs dhritatarasrh
dhritatarashr dhritatarahsr dhritatarahrs dhritataahrrs dhritataahrsr dhritataahrrs dhritataahrsr dhritataahsrr dhritataahsrr
dhritataarhrs dhritataarhsr dhritataarrhs dhritataarrsh dhritataarsrh dhritataarshr dhritataarrhs dhritataarrsh dhritataarhrs
dhritataarhsr dhritataarshr dhritataarsrh dhritataasrrh dhritataasrhr dhritataasrrh dhritataasrhr dhritataashrr dhritataashrr
dhritarashtra dhritarashtar dhritarashrta dhritarashrat dhritarashart dhritarashatr dhritarasthra dhritarasthar dhritarastrha
dhritarastrah dhritarastarh dhritarastahr dhritarasrtha dhritarasrtah dhritarasrhta dhritarasrhat dhritarasraht dhritarasrath
dhritarasatrh dhritarasathr dhritarasarth dhritarasarht dhritarasahrt dhritarasahtr dhritarahstra dhritarahstar dhritarahsrta
dhritarahsrat dhritarahsart dhritarahsatr dhritarahtsra dhritarahtsar dhritarahtrsa dhritarahtras dhritarahtars dhritarahtasr
dhritarahrtsa dhritarahrtas dhritarahrsta dhritarahrsat dhritarahrast dhritarahrats dhritarahatrs dhritarahatsr dhritaraharts
dhritaraharst dhritarahasrt dhritarahastr dhritarathsra dhritarathsar dhritarathrsa dhritarathras dhritarathars dhritarathasr
dhritaratshra dhritaratshar dhritaratsrha dhritaratsrah dhritaratsarh dhritaratsahr dhritaratrsha dhritaratrsah dhritaratrhsa
dhritaratrhas dhritaratrahs dhritaratrash dhritaratasrh dhritaratashr dhritaratarsh dhritaratarhs dhritaratahrs dhritaratahsr
dhritararhtsa dhritararhtas dhritararhsta dhritararhsat dhritararhast dhritararhats dhritararthsa dhritararthas dhritarartsha
dhritarartsah dhritarartash dhritarartahs dhritararstha dhritararstah dhritararshta dhritararshat dhritararsaht dhritararsath
dhritararatsh dhritararaths dhritararasth dhritararasht dhritararahst dhritararahts dhritaraahtrs dhritaraahtsr dhritaraahrts
dhritaraahrst dhritaraahsrt dhritaraahstr dhritaraathrs dhritaraathsr dhritaraatrhs dhritaraatrsh dhritaraatsrh dhritaraatshr
dhritaraarths dhritaraartsh dhritaraarhts dhritaraarhst dhritaraarsht dhritaraarsth dhritaraastrh dhritaraasthr dhritaraasrth
dhritaraasrht dhritaraashrt dhritaraashtr dhritarsahtra dhritarsahtar dhritarsahrta dhritarsahrat dhritarsahart dhritarsahatr
dhritarsathra dhritarsathar dhritarsatrha dhritarsatrah dhritarsatarh dhritarsatahr dhritarsartha dhritarsartah dhritarsarhta
dhritarsarhat dhritarsaraht dhritarsarath dhritarsaatrh dhritarsaathr dhritarsaarth dhritarsaarht dhritarsaahrt dhritarsaahtr
dhritarshatra dhritarshatar dhritarsharta dhritarsharat dhritarshaart dhritarshaatr dhritarshtara dhritarshtaar dhritarshtraa
dhritarshtraa dhritarshtara dhritarshtaar dhritarshrtaa dhritarshrtaa dhritarshrata dhritarshraat dhritarshraat dhritarshrata
dhritarshatra dhritarshatar dhritarsharta dhritarsharat dhritarshaart dhritarshaatr dhritarsthara dhritarsthaar dhritarsthraa
dhritarsthraa dhritarsthara dhritarsthaar dhritarstahra dhritarstahar dhritarstarha dhritarstarah dhritarstaarh dhritarstaahr
dhritarstraha dhritarstraah dhritarstrhaa dhritarstrhaa dhritarstraha dhritarstraah dhritarstaarh dhritarstaahr dhritarstarah
dhritarstarha dhritarstahra dhritarstahar dhritarsrhtaa dhritarsrhtaa dhritarsrhata dhritarsrhaat dhritarsrhaat dhritarsrhata
dhritarsrthaa dhritarsrthaa dhritarsrtaha dhritarsrtaah dhritarsrtaah dhritarsrtaha dhritarsratha dhritarsratah dhritarsrahta
dhritarsrahat dhritarsraaht dhritarsraath dhritarsratah dhritarsratha dhritarsraath dhritarsraaht dhritarsrahat dhritarsrahta
dhritarsahtra dhritarsahtar dhritarsahrta dhritarsahrat dhritarsahart dhritarsahatr dhritarsathra dhritarsathar dhritarsatrha
dhritarsatrah dhritarsatarh dhritarsatahr dhritarsartha dhritarsartah dhritarsarhta dhritarsarhat dhritarsaraht dhritarsarath
dhritarsaatrh dhritarsaathr dhritarsaarth dhritarsaarht dhritarsaahrt dhritarsaahtr dhritarhsatra dhritarhsatar dhritarhsarta
dhritarhsarat dhritarhsaart dhritarhsaatr dhritarhstara dhritarhstaar dhritarhstraa dhritarhstraa dhritarhstara dhritarhstaar
dhritarhsrtaa dhritarhsrtaa dhritarhsrata dhritarhsraat dhritarhsraat dhritarhsrata dhritarhsatra dhritarhsatar dhritarhsarta
dhritarhsarat dhritarhsaart dhritarhsaatr dhritarhastra dhritarhastar dhritarhasrta dhritarhasrat dhritarhasart dhritarhasatr
dhritarhatsra dhritarhatsar dhritarhatrsa dhritarhatras dhritarhatars dhritarhatasr dhritarhartsa dhritarhartas dhritarharsta
dhritarharsat dhritarharast dhritarharats dhritarhaatrs dhritarhaatsr dhritarhaarts dhritarhaarst dhritarhaasrt dhritarhaastr
dhritarhtasra dhritarhtasar dhritarhtarsa dhritarhtaras dhritarhtaars dhritarhtaasr dhritarhtsara dhritarhtsaar dhritarhtsraa
dhritarhtsraa dhritarhtsara dhritarhtsaar dhritarhtrsaa dhritarhtrsaa dhritarhtrasa dhritarhtraas dhritarhtraas dhritarhtrasa
dhritarhtasra dhritarhtasar dhritarhtarsa dhritarhtaras dhritarhtaars dhritarhtaasr dhritarhratsa dhritarhratas dhritarhrasta
dhritarhrasat dhritarhraast dhritarhraats dhritarhrtasa dhritarhrtaas dhritarhrtsaa dhritarhrtsaa dhritarhrtasa dhritarhrtaas
dhritarhrstaa dhritarhrstaa dhritarhrsata dhritarhrsaat dhritarhrsaat dhritarhrsata dhritarhratsa dhritarhratas dhritarhrasta
dhritarhrasat dhritarhraast dhritarhraats dhritarhaatrs dhritarhaatsr dhritarhaarts dhritarhaarst dhritarhaasrt dhritarhaastr
dhritarhatars dhritarhatasr dhritarhatras dhritarhatrsa dhritarhatsra dhritarhatsar dhritarhartas dhritarhartsa dhritarharats
dhritarharast dhritarharsat dhritarharsta dhritarhastra dhritarhastar dhritarhasrta dhritarhasrat dhritarhasart dhritarhasatr
dhritartshara dhritartshaar dhritartshraa dhritartshraa dhritartshara dhritartshaar dhritartsahra dhritartsahar dhritartsarha
dhritartsarah dhritartsaarh dhritartsaahr dhritartsraha dhritartsraah dhritartsrhaa dhritartsrhaa dhritartsraha dhritartsraah
dhritartsaarh dhritartsaahr dhritartsarah dhritartsarha dhritartsahra dhritartsahar dhritarthsara dhritarthsaar dhritarthsraa
dhritarthsraa dhritarthsara dhritarthsaar dhritarthasra dhritarthasar dhritartharsa dhritartharas dhritarthaars dhritarthaasr
dhritarthrasa dhritarthraas dhritarthrsaa dhritarthrsaa dhritarthrasa dhritarthraas dhritarthaars dhritarthaasr dhritartharas
dhritartharsa dhritarthasra dhritarthasar dhritartahsra dhritartahsar dhritartahrsa dhritartahras dhritartahars dhritartahasr
dhritartashra dhritartashar dhritartasrha dhritartasrah dhritartasarh dhritartasahr dhritartarsha dhritartarsah dhritartarhsa
dhritartarhas dhritartarahs dhritartarash dhritartaasrh dhritartaashr dhritartaarsh dhritartaarhs dhritartaahrs dhritartaahsr
dhritartrhasa dhritartrhaas dhritartrhsaa dhritartrhsaa dhritartrhasa dhritartrhaas dhritartrahsa dhritartrahas dhritartrasha
dhritartrasah dhritartraash dhritartraahs dhritartrsaha dhritartrsaah dhritartrshaa dhritartrshaa dhritartrsaha dhritartrsaah
dhritartraash dhritartraahs dhritartrasah dhritartrasha dhritartrahsa dhritartrahas dhritartahars dhritartahasr dhritartahras
dhritartahrsa dhritartahsra dhritartahsar dhritartaahrs dhritartaahsr dhritartaarhs dhritartaarsh dhritartaasrh dhritartaashr
dhritartarahs dhritartarash dhritartarhas dhritartarhsa dhritartarsha dhritartarsah dhritartasarh dhritartasahr dhritartasrah
dhritartasrha dhritartashra dhritartashar dhritarrshtaa dhritarrshtaa dhritarrshata dhritarrshaat dhritarrshaat dhritarrshata
dhritarrsthaa dhritarrsthaa dhritarrstaha dhritarrstaah dhritarrstaah dhritarrstaha dhritarrsatha dhritarrsatah dhritarrsahta
dhritarrsahat dhritarrsaaht dhritarrsaath dhritarrsatah dhritarrsatha dhritarrsaath dhritarrsaaht dhritarrsahat dhritarrsahta
dhritarrhstaa dhritarrhstaa dhritarrhsata dhritarrhsaat dhritarrhsaat dhritarrhsata dhritarrhtsaa dhritarrhtsaa dhritarrhtasa
dhritarrhtaas dhritarrhtaas dhritarrhtasa dhritarrhatsa dhritarrhatas dhritarrhasta dhritarrhasat dhritarrhaast dhritarrhaats
dhritarrhatas dhritarrhatsa dhritarrhaats dhritarrhaast dhritarrhasat dhritarrhasta dhritarrthsaa dhritarrthsaa dhritarrthasa
dhritarrthaas dhritarrthaas dhritarrthasa dhritarrtshaa dhritarrtshaa dhritarrtsaha dhritarrtsaah dhritarrtsaah dhritarrtsaha
dhritarrtasha dhritarrtasah dhritarrtahsa dhritarrtahas dhritarrtaahs dhritarrtaash dhritarrtasah dhritarrtasha dhritarrtaash
dhritarrtaahs dhritarrtahas dhritarrtahsa dhritarrahtsa dhritarrahtas dhritarrahsta dhritarrahsat dhritarrahast dhritarrahats
dhritarrathsa dhritarrathas dhritarratsha dhritarratsah dhritarratash dhritarratahs dhritarrastha dhritarrastah dhritarrashta
dhritarrashat dhritarrasaht dhritarrasath dhritarraatsh dhritarraaths dhritarraasth dhritarraasht dhritarraahst dhritarraahts
dhritarrahtas dhritarrahtsa dhritarrahats dhritarrahast dhritarrahsat dhritarrahsta dhritarrathas dhritarrathsa dhritarratahs
dhritarratash dhritarratsah dhritarratsha dhritarraaths dhritarraatsh dhritarraahts dhritarraahst dhritarraasht dhritarraasth
dhritarrastah dhritarrastha dhritarrasath dhritarrasaht dhritarrashat dhritarrashta dhritarashtra dhritarashtar dhritarashrta
dhritarashrat dhritarashart dhritarashatr dhritarasthra dhritarasthar dhritarastrha dhritarastrah dhritarastarh dhritarastahr
dhritarasrtha dhritarasrtah dhritarasrhta dhritarasrhat dhritarasraht dhritarasrath dhritarasatrh dhritarasathr dhritarasarth
dhritarasarht dhritarasahrt dhritarasahtr dhritarahstra dhritarahstar dhritarahsrta dhritarahsrat dhritarahsart dhritarahsatr
dhritarahtsra dhritarahtsar dhritarahtrsa dhritarahtras dhritarahtars dhritarahtasr dhritarahrtsa dhritarahrtas dhritarahrsta
dhritarahrsat dhritarahrast dhritarahrats dhritarahatrs dhritarahatsr dhritaraharts dhritaraharst dhritarahasrt dhritarahastr
dhritarathsra dhritarathsar dhritarathrsa dhritarathras dhritarathars dhritarathasr dhritaratshra dhritaratshar dhritaratsrha
dhritaratsrah dhritaratsarh dhritaratsahr dhritaratrsha dhritaratrsah dhritaratrhsa dhritaratrhas dhritaratrahs dhritaratrash
dhritaratasrh dhritaratashr dhritaratarsh dhritaratarhs dhritaratahrs dhritaratahsr dhritararhtsa dhritararhtas dhritararhsta
dhritararhsat dhritararhast dhritararhats dhritararthsa dhritararthas dhritarartsha dhritarartsah dhritarartash dhritarartahs
dhritararstha dhritararstah dhritararshta dhritararshat dhritararsaht dhritararsath dhritararatsh dhritararaths dhritararasth
dhritararasht dhritararahst dhritararahts dhritaraahtrs dhritaraahtsr dhritaraahrts dhritaraahrst dhritaraahsrt dhritaraahstr
dhritaraathrs dhritaraathsr dhritaraatrhs dhritaraatrsh dhritaraatsrh dhritaraatshr dhritaraarths dhritaraartsh dhritaraarhts
dhritaraarhst dhritaraarsht dhritaraarsth dhritaraastrh dhritaraasthr dhritaraasrth dhritaraasrht dhritaraashrt dhritaraashtr
dhritaaashtrr dhritaaashtrr dhritaaashrtr dhritaaashrrt dhritaaashrrt dhritaaashrtr dhritaaasthrr dhritaaasthrr dhritaaastrhr
dhritaaastrrh dhritaaastrrh dhritaaastrhr dhritaaasrthr dhritaaasrtrh dhritaaasrhtr dhritaaasrhrt dhritaaasrrht dhritaaasrrth
dhritaaasrtrh dhritaaasrthr dhritaaasrrth dhritaaasrrht dhritaaasrhrt dhritaaasrhtr dhritaaahstrr dhritaaahstrr dhritaaahsrtr
dhritaaahsrrt dhritaaahsrrt dhritaaahsrtr dhritaaahtsrr dhritaaahtsrr dhritaaahtrsr dhritaaahtrrs dhritaaahtrrs dhritaaahtrsr
dhritaaahrtsr dhritaaahrtrs dhritaaahrstr dhritaaahrsrt dhritaaahrrst dhritaaahrrts dhritaaahrtrs dhritaaahrtsr dhritaaahrrts
dhritaaahrrst dhritaaahrsrt dhritaaahrstr dhritaaathsrr dhritaaathsrr dhritaaathrsr dhritaaathrrs dhritaaathrrs dhritaaathrsr
dhritaaatshrr dhritaaatshrr dhritaaatsrhr dhritaaatsrrh dhritaaatsrrh dhritaaatsrhr dhritaaatrshr dhritaaatrsrh dhritaaatrhsr
dhritaaatrhrs dhritaaatrrhs dhritaaatrrsh dhritaaatrsrh dhritaaatrshr dhritaaatrrsh dhritaaatrrhs dhritaaatrhrs dhritaaatrhsr
dhritaaarhtsr dhritaaarhtrs dhritaaarhstr dhritaaarhsrt dhritaaarhrst dhritaaarhrts dhritaaarthsr dhritaaarthrs dhritaaartshr
dhritaaartsrh dhritaaartrsh dhritaaartrhs dhritaaarsthr dhritaaarstrh dhritaaarshtr dhritaaarshrt dhritaaarsrht dhritaaarsrth
dhritaaarrtsh dhritaaarrths dhritaaarrsth dhritaaarrsht dhritaaarrhst dhritaaarrhts dhritaaarhtrs dhritaaarhtsr dhritaaarhrts
dhritaaarhrst dhritaaarhsrt dhritaaarhstr dhritaaarthrs dhritaaarthsr dhritaaartrhs dhritaaartrsh dhritaaartsrh dhritaaartshr
dhritaaarrths dhritaaarrtsh dhritaaarrhts dhritaaarrhst dhritaaarrsht dhritaaarrsth dhritaaarstrh dhritaaarsthr dhritaaarsrth
dhritaaarsrht dhritaaarshrt dhritaaarshtr dhritaasahtrr dhritaasahtrr dhritaasahrtr dhritaasahrrt dhritaasahrrt dhritaasahrtr
dhritaasathrr dhritaasathrr dhritaasatrhr dhritaasatrrh dhritaasatrrh dhritaasatrhr dhritaasarthr dhritaasartrh dhritaasarhtr
dhritaasarhrt dhritaasarrht dhritaasarrth dhritaasartrh dhritaasarthr dhritaasarrth dhritaasarrht dhritaasarhrt dhritaasarhtr
dhritaashatrr dhritaashatrr dhritaashartr dhritaasharrt dhritaasharrt dhritaashartr dhritaashtarr dhritaashtarr dhritaashtrar
dhritaashtrra dhritaashtrra dhritaashtrar dhritaashrtar dhritaashrtra dhritaashratr dhritaashrart dhritaashrrat dhritaashrrta
dhritaashrtra dhritaashrtar dhritaashrrta dhritaashrrat dhritaashrart dhritaashratr dhritaastharr dhritaastharr dhritaasthrar
dhritaasthrra dhritaasthrra dhritaasthrar dhritaastahrr dhritaastahrr dhritaastarhr dhritaastarrh dhritaastarrh dhritaastarhr
dhritaastrahr dhritaastrarh dhritaastrhar dhritaastrhra dhritaastrrha dhritaastrrah dhritaastrarh dhritaastrahr dhritaastrrah
dhritaastrrha dhritaastrhra dhritaastrhar dhritaasrhtar dhritaasrhtra dhritaasrhatr dhritaasrhart dhritaasrhrat dhritaasrhrta
dhritaasrthar dhritaasrthra dhritaasrtahr dhritaasrtarh dhritaasrtrah dhritaasrtrha dhritaasrathr dhritaasratrh dhritaasrahtr
dhritaasrahrt dhritaasrarht dhritaasrarth dhritaasrrtah dhritaasrrtha dhritaasrrath dhritaasrraht dhritaasrrhat dhritaasrrhta
dhritaasrhtra dhritaasrhtar dhritaasrhrta dhritaasrhrat dhritaasrhart dhritaasrhatr dhritaasrthra dhritaasrthar dhritaasrtrha
dhritaasrtrah dhritaasrtarh dhritaasrtahr dhritaasrrtha dhritaasrrtah dhritaasrrhta dhritaasrrhat dhritaasrraht dhritaasrrath
dhritaasratrh dhritaasrathr dhritaasrarth dhritaasrarht dhritaasrahrt dhritaasrahtr dhritaahsatrr dhritaahsatrr dhritaahsartr
dhritaahsarrt dhritaahsarrt dhritaahsartr dhritaahstarr dhritaahstarr dhritaahstrar dhritaahstrra dhritaahstrra dhritaahstrar
dhritaahsrtar dhritaahsrtra dhritaahsratr dhritaahsrart dhritaahsrrat dhritaahsrrta dhritaahsrtra dhritaahsrtar dhritaahsrrta
dhritaahsrrat dhritaahsrart dhritaahsratr dhritaahastrr dhritaahastrr dhritaahasrtr dhritaahasrrt dhritaahasrrt dhritaahasrtr
dhritaahatsrr dhritaahatsrr dhritaahatrsr dhritaahatrrs dhritaahatrrs dhritaahatrsr dhritaahartsr dhritaahartrs dhritaaharstr
dhritaaharsrt dhritaaharrst dhritaaharrts dhritaahartrs dhritaahartsr dhritaaharrts dhritaaharrst dhritaaharsrt dhritaaharstr
dhritaahtasrr dhritaahtasrr dhritaahtarsr dhritaahtarrs dhritaahtarrs dhritaahtarsr dhritaahtsarr dhritaahtsarr dhritaahtsrar
dhritaahtsrra dhritaahtsrra dhritaahtsrar dhritaahtrsar dhritaahtrsra dhritaahtrasr dhritaahtrars dhritaahtrras dhritaahtrrsa
dhritaahtrsra dhritaahtrsar dhritaahtrrsa dhritaahtrras dhritaahtrars dhritaahtrasr dhritaahratsr dhritaahratrs dhritaahrastr
dhritaahrasrt dhritaahrarst dhritaahrarts dhritaahrtasr dhritaahrtars dhritaahrtsar dhritaahrtsra dhritaahrtrsa dhritaahrtras
dhritaahrstar dhritaahrstra dhritaahrsatr dhritaahrsart dhritaahrsrat dhritaahrsrta dhritaahrrtsa dhritaahrrtas dhritaahrrsta
dhritaahrrsat dhritaahrrast dhritaahrrats dhritaahratrs dhritaahratsr dhritaahrarts dhritaahrarst dhritaahrasrt dhritaahrastr
dhritaahrtars dhritaahrtasr dhritaahrtras dhritaahrtrsa dhritaahrtsra dhritaahrtsar dhritaahrrtas dhritaahrrtsa dhritaahrrats
dhritaahrrast dhritaahrrsat dhritaahrrsta dhritaahrstra dhritaahrstar dhritaahrsrta dhritaahrsrat dhritaahrsart dhritaahrsatr
dhritaatsharr dhritaatsharr dhritaatshrar dhritaatshrra dhritaatshrra dhritaatshrar dhritaatsahrr dhritaatsahrr dhritaatsarhr
dhritaatsarrh dhritaatsarrh dhritaatsarhr dhritaatsrahr dhritaatsrarh dhritaatsrhar dhritaatsrhra dhritaatsrrha dhritaatsrrah
dhritaatsrarh dhritaatsrahr dhritaatsrrah dhritaatsrrha dhritaatsrhra dhritaatsrhar dhritaathsarr dhritaathsarr dhritaathsrar
dhritaathsrra dhritaathsrra dhritaathsrar dhritaathasrr dhritaathasrr dhritaatharsr dhritaatharrs dhritaatharrs dhritaatharsr
dhritaathrasr dhritaathrars dhritaathrsar dhritaathrsra dhritaathrrsa dhritaathrras dhritaathrars dhritaathrasr dhritaathrras
dhritaathrrsa dhritaathrsra dhritaathrsar dhritaatahsrr dhritaatahsrr dhritaatahrsr dhritaatahrrs dhritaatahrrs dhritaatahrsr
dhritaatashrr dhritaatashrr dhritaatasrhr dhritaatasrrh dhritaatasrrh dhritaatasrhr dhritaatarshr dhritaatarsrh dhritaatarhsr
dhritaatarhrs dhritaatarrhs dhritaatarrsh dhritaatarsrh dhritaatarshr dhritaatarrsh dhritaatarrhs dhritaatarhrs dhritaatarhsr
dhritaatrhasr dhritaatrhars dhritaatrhsar dhritaatrhsra dhritaatrhrsa dhritaatrhras dhritaatrahsr dhritaatrahrs dhritaatrashr
dhritaatrasrh dhritaatrarsh dhritaatrarhs dhritaatrsahr dhritaatrsarh dhritaatrshar dhritaatrshra dhritaatrsrha dhritaatrsrah
dhritaatrrash dhritaatrrahs dhritaatrrsah dhritaatrrsha dhritaatrrhsa dhritaatrrhas dhritaatrhars dhritaatrhasr dhritaatrhras
dhritaatrhrsa dhritaatrhsra dhritaatrhsar dhritaatrahrs dhritaatrahsr dhritaatrarhs dhritaatrarsh dhritaatrasrh dhritaatrashr
dhritaatrrahs dhritaatrrash dhritaatrrhas dhritaatrrhsa dhritaatrrsha dhritaatrrsah dhritaatrsarh dhritaatrsahr dhritaatrsrah
dhritaatrsrha dhritaatrshra dhritaatrshar dhritaarshtar dhritaarshtra dhritaarshatr dhritaarshart dhritaarshrat dhritaarshrta
dhritaarsthar dhritaarsthra dhritaarstahr dhritaarstarh dhritaarstrah dhritaarstrha dhritaarsathr dhritaarsatrh dhritaarsahtr
dhritaarsahrt dhritaarsarht dhritaarsarth dhritaarsrtah dhritaarsrtha dhritaarsrath dhritaarsraht dhritaarsrhat dhritaarsrhta
dhritaarhstar dhritaarhstra dhritaarhsatr dhritaarhsart dhritaarhsrat dhritaarhsrta dhritaarhtsar dhritaarhtsra dhritaarhtasr
dhritaarhtars dhritaarhtras dhritaarhtrsa dhritaarhatsr dhritaarhatrs dhritaarhastr dhritaarhasrt dhritaarharst dhritaarharts
dhritaarhrtas dhritaarhrtsa dhritaarhrats dhritaarhrast dhritaarhrsat dhritaarhrsta dhritaarthsar dhritaarthsra dhritaarthasr
dhritaarthars dhritaarthras dhritaarthrsa dhritaartshar dhritaartshra dhritaartsahr dhritaartsarh dhritaartsrah dhritaartsrha
dhritaartashr dhritaartasrh dhritaartahsr dhritaartahrs dhritaartarhs dhritaartarsh dhritaartrsah dhritaartrsha dhritaartrash
dhritaartrahs dhritaartrhas dhritaartrhsa dhritaarahtsr dhritaarahtrs dhritaarahstr dhritaarahsrt dhritaarahrst dhritaarahrts
dhritaarathsr dhritaarathrs dhritaaratshr dhritaaratsrh dhritaaratrsh dhritaaratrhs dhritaarasthr dhritaarastrh dhritaarashtr
dhritaarashrt dhritaarasrht dhritaarasrth dhritaarartsh dhritaararths dhritaararsth dhritaararsht dhritaararhst dhritaararhts
dhritaarrhtas dhritaarrhtsa dhritaarrhats dhritaarrhast dhritaarrhsat dhritaarrhsta dhritaarrthas dhritaarrthsa dhritaarrtahs
dhritaarrtash dhritaarrtsah dhritaarrtsha dhritaarraths dhritaarratsh dhritaarrahts dhritaarrahst dhritaarrasht dhritaarrasth
dhritaarrstah dhritaarrstha dhritaarrsath dhritaarrsaht dhritaarrshat dhritaarrshta dhritaarshtra dhritaarshtar dhritaarshrta
dhritaarshrat dhritaarshart dhritaarshatr dhritaarsthra dhritaarsthar dhritaarstrha dhritaarstrah dhritaarstarh dhritaarstahr
dhritaarsrtha dhritaarsrtah dhritaarsrhta dhritaarsrhat dhritaarsraht dhritaarsrath dhritaarsatrh dhritaarsathr dhritaarsarth
dhritaarsarht dhritaarsahrt dhritaarsahtr dhritaarhstra dhritaarhstar dhritaarhsrta dhritaarhsrat dhritaarhsart dhritaarhsatr
dhritaarhtsra dhritaarhtsar dhritaarhtrsa dhritaarhtras dhritaarhtars dhritaarhtasr dhritaarhrtsa dhritaarhrtas dhritaarhrsta
dhritaarhrsat dhritaarhrast dhritaarhrats dhritaarhatrs dhritaarhatsr dhritaarharts dhritaarharst dhritaarhasrt dhritaarhastr
dhritaarthsra dhritaarthsar dhritaarthrsa dhritaarthras dhritaarthars dhritaarthasr dhritaartshra dhritaartshar dhritaartsrha
dhritaartsrah dhritaartsarh dhritaartsahr dhritaartrsha dhritaartrsah dhritaartrhsa dhritaartrhas dhritaartrahs dhritaartrash
dhritaartasrh dhritaartashr dhritaartarsh dhritaartarhs dhritaartahrs dhritaartahsr dhritaarrhtsa dhritaarrhtas dhritaarrhsta
dhritaarrhsat dhritaarrhast dhritaarrhats dhritaarrthsa dhritaarrthas dhritaarrtsha dhritaarrtsah dhritaarrtash dhritaarrtahs
dhritaarrstha dhritaarrstah dhritaarrshta dhritaarrshat dhritaarrsaht dhritaarrsath dhritaarratsh dhritaarraths dhritaarrasth
dhritaarrasht dhritaarrahst dhritaarrahts dhritaarahtrs dhritaarahtsr dhritaarahrts dhritaarahrst dhritaarahsrt dhritaarahstr
dhritaarathrs dhritaarathsr dhritaaratrhs dhritaaratrsh dhritaaratsrh dhritaaratshr dhritaararths dhritaarartsh dhritaararhts
dhritaararhst dhritaararsht dhritaararsth dhritaarastrh dhritaarasthr dhritaarasrth dhritaarasrht dhritaarashrt dhritaarashtr

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us