easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

homomorphosis

peregrin

prospicientibusque

nuttier

unconflictingness

pseudopolitical

lamumba

encantadas

potability

ensenaste

cedant

depreciable

tellinidae

uncleft

charlesmac

ortstein

dixissetisque

vendidas


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: deroche
cipher variations:
efspdif fgtqejg ghurfkh hivsgli ijwthmj
jkxuink klyvjol lmzwkpm mnaxlqn nobymro
opcznsp pqdaotq qrebpur rsfcqvs stgdrwt
tuhesxu uviftyv vwjguzw wxkhvax xyliwby
yzmjxcz zankyda abolzeb bcpmafc cdqnbgd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: deroche
Cipher: wvilxsv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: deroche
Cipher: AAABB AABAA BAAAA ABBAB AAABA AABBB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: deroche
cipher variations:
efspdifknarhwnqvitlkvwdqvpydclyxtmlitgzxatujwdfcjarefjqr
gzmhnezmhujrshspclvgpyxknzuxfgtqejglobsixorwjumlwxerwqze
dmzyunmjuhaybuvkxegdkbsfgkrshaniofanivkstitqdmwhqzyloavy
ghurfkhmpctjypsxkvnmxyfsxrafenazvonkvibzcvwlyfhelctghlst
ibojpgbojwltujurenxirazmpbwzhivsglinqdukzqtylwonyzgtysbg
fobawpolwjcadwxmzgifmduhimtujcpkqhcpkxmuvkvsfoyjsbanqcxa
ijwthmjorevlaruzmxpozahuztchgpcbxqpmxkdbexynahjgnevijnuv
kdqlridqlynvwlwtgpzktcbordybjkxuinkpsfwmbsvanyqpabivaudi
hqdcyrqnylecfyzobikhofwjkovwlermsjermzowxmxuhqaludcpsezc
klyvjolqtgxnctwbozrqbcjwbvejiredzsrozmfdgzapcjlipgxklpwx
mfsntkfsnapxynyvirbmvedqtfadlmzwkpmruhyoduxcpasrcdkxcwfk
jsfeatspangehabqdkmjqhylmqxyngtoulgtobqyzozwjscnwferugbe
mnaxlqnsvizpevydqbtsdelydxglktgfbutqbohfibcrelnkrizmnryz
ohupvmhupcrzapaxktdoxgfsvhcfnobymrotwjaqfwzercutefmzeyhm
luhgcvurcpigjcdsfmolsjanoszapivqwnivqdsabqbyluepyhgtwidg
opcznspuxkbrgxafsdvufgnafzinmvihdwvsdqjhkdetgnpmtkboptab
qjwrxojwretbcrczmvfqzihuxjehpqdaotqvylcshybgtewvghobgajo
nwjiexwterkilefuhoqnulcpqubcrkxsypkxsfucdsdanwgrajivykfi
qrebpurwzmdtizchufxwhipchbkpoxkjfyxufsljmfgviprovmdqrvcd
slytzqlytgvdeteboxhsbkjwzlgjrsfcqvsxaneujadivgyxijqdiclq
pylkgzyvgtmknghwjqspwnerswdetmzuarmzuhwefufcpyitclkxamhk
stgdrwtybofvkbejwhzyjkrejdmrqzmlhazwhunlohixkrtqxofstxef
unavbsnavixfgvgdqzjudmlybniltuhesxuzcpgwlcfkxiazklsfkens
ranmibaxivompijylsurypgtuyfgvobwctobwjyghwherakvenmzcojm
uviftyvadqhxmdglyjbalmtglfotsbonjcbyjwpnqjkzmtvszqhuvzgh
wpcxdupcxkzhixifsblwfonadpknvwjguzwberiynehmzkcbmnuhmgpu
tcpokdczkxqorklanuwtarivwahixqdyevqdylaijyjgtcmxgpobeqlo
wxkhvaxcfsjzofinaldcnovinhqvudqpledalyrpslmbovxubsjwxbij
yrezfwrezmbjkzkhudnyhqpcfrmpxyliwbydgtkapgjobmedopwjoirw
verqmfebmzsqtmncpwyvctkxycjkzsfagxsfancklaliveozirqdgsnq
yzmjxczehulbqhkpcnfepqxkpjsxwfsrngfcnatrunodqxzwdulyzdkl
atgbhytgbodlmbmjwfpajsrehtorzankydafivmcrilqdogfqrylqkty
xgtsohgdobusvoperyaxevmzaelmbuhcizuhcpemncnkxgqbktsfiups
abolzebgjwndsjmrephgrszmrluzyhutpihepcvtwpqfszbyfwnabfmn
cvidjavidqfnodolyhrclutgjvqtbcpmafchkxoetknsfqihstansmva
zivuqjifqdwuxqrgtaczgxobcgnodwjekbwjergopepmzisdmvuhkwru
cdqnbgdilypfulotgrjitubotnwbajwvrkjgrexvyrshubdahypcdhop
exkflcxkfshpqfqnajtenwvilxsvderochejmzqgvmpuhskjuvcpuoxc
bkxwslkhsfywzstivcebizqdeipqfylgmdylgtiqrgrobkufoxwjmytw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: deroche
Cipher: qrebpur

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: deroche
Cipher: 41512443313251

Extended Methods:
Method #1

Plaintext: deroche
method variations:
ikwthnkopbynsptugdsxuyzmixcz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
d e r o c h e 
4 5 2 4 3 3 5 
1 1 4 3 1 2 1 
They are then read out in rows:
45243351143121
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: deroche
Cipher: yrneqcb

Read more ...
Method #3

Plaintext: deroche
method variations:
vftnlwq ftnlwqv tnlwqvf
nlwqvft lwqvftn wqvftnl
qvftnlw

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: deroche

all 5040 cipher variations:
deroche deroceh derohce derohec deroehc deroech dercohe dercoeh derchoe dercheo derceho
derceoh derhcoe derhceo derhoce derhoec derheoc derheco derecho derecoh derehco derehoc
dereohc dereoch deorche deorceh deorhce deorhec deorehc deorech deocrhe deocreh deochre
deocher deocehr deocerh deohcre deohcer deohrce deohrec deoherc deohecr deoechr deoecrh
deoehcr deoehrc deoerhc deoerch decorhe decoreh decohre decoher decoehr decoerh decrohe
decroeh decrhoe decrheo decreho decreoh dechroe dechreo dechore dechoer decheor dechero
decerho deceroh decehro decehor deceohr deceorh dehocre dehocer dehorce dehorec dehoerc
dehoecr dehcore dehcoer dehcroe dehcreo dehcero dehceor dehrcoe dehrceo dehroce dehroec
dehreoc dehreco dehecro dehecor deherco deheroc deheorc deheocr deeochr deeocrh deeohcr
deeohrc deeorhc deeorch deecohr deecorh deechor deechro deecrho deecroh deehcor deehcro
deehocr deehorc deehroc deehrco deercho deercoh deerhco deerhoc deerohc deeroch dreoche
dreoceh dreohce dreohec dreoehc dreoech drecohe drecoeh drechoe drecheo dreceho dreceoh
drehcoe drehceo drehoce drehoec dreheoc dreheco dreecho dreecoh dreehco dreehoc dreeohc
dreeoch droeche droeceh droehce droehec droeehc droeech drocehe droceeh drochee drochee
drocehe droceeh drohcee drohcee drohece droheec droheec drohece droeche droeceh droehce
droehec droeehc droeech drcoehe drcoeeh drcohee drcohee drcoehe drcoeeh drceohe drceoeh
drcehoe drceheo drceeho drceeoh drcheoe drcheeo drchoee drchoee drcheoe drcheeo drceeho
drceeoh drceheo drcehoe drceohe drceoeh drhocee drhocee drhoece drhoeec drhoeec drhoece
drhcoee drhcoee drhceoe drhceeo drhceeo drhceoe drhecoe drheceo drheoce drheoec drheeoc
drheeco drheceo drhecoe drheeco drheeoc drheoec drheoce dreoche dreoceh dreohce dreohec
dreoehc dreoech drecohe drecoeh drechoe drecheo dreceho dreceoh drehcoe drehceo drehoce
drehoec dreheoc dreheco dreecho dreecoh dreehco dreehoc dreeohc dreeoch doreche doreceh
dorehce dorehec doreehc doreech dorcehe dorceeh dorchee dorchee dorcehe dorceeh dorhcee
dorhcee dorhece dorheec dorheec dorhece doreche doreceh dorehce dorehec doreehc doreech
doerche doerceh doerhce doerhec doerehc doerech doecrhe doecreh doechre doecher doecehr
doecerh doehcre doehcer doehrce doehrec doeherc doehecr doeechr doeecrh doeehcr doeehrc
doeerhc doeerch docerhe docereh docehre doceher doceehr doceerh docrehe docreeh docrhee
docrhee docrehe docreeh dochree dochree dochere docheer docheer dochere docerhe docereh
docehre doceher doceehr doceerh dohecre dohecer doherce doherec doheerc doheecr dohcere
dohceer dohcree dohcree dohcere dohceer dohrcee dohrcee dohrece dohreec dohreec dohrece
dohecre dohecer doherce doherec doheerc doheecr doeechr doeecrh doeehcr doeehrc doeerhc
doeerch doecehr doecerh doecher doechre doecrhe doecreh doehcer doehcre doehecr doeherc
doehrec doehrce doerche doerceh doerhce doerhec doerehc doerech dcroehe dcroeeh dcrohee
dcrohee dcroehe dcroeeh dcreohe dcreoeh dcrehoe dcreheo dcreeho dcreeoh dcrheoe dcrheeo
dcrhoee dcrhoee dcrheoe dcrheeo dcreeho dcreeoh dcreheo dcrehoe dcreohe dcreoeh dcorehe
dcoreeh dcorhee dcorhee dcorehe dcoreeh dcoerhe dcoereh dcoehre dcoeher dcoeehr dcoeerh
dcohere dcoheer dcohree dcohree dcohere dcoheer dcoeehr dcoeerh dcoeher dcoehre dcoerhe
dcoereh dceorhe dceoreh dceohre dceoher dceoehr dceoerh dcerohe dceroeh dcerhoe dcerheo
dcereho dcereoh dcehroe dcehreo dcehore dcehoer dceheor dcehero dceerho dceeroh dceehro
dceehor dceeohr dceeorh dchoere dchoeer dchoree dchoree dchoere dchoeer dcheore dcheoer
dcheroe dchereo dcheero dcheeor dchreoe dchreeo dchroee dchroee dchreoe dchreeo dcheero
dcheeor dchereo dcheroe dcheore dcheoer dceoehr dceoerh dceoher dceohre dceorhe dceoreh
dceeohr dceeorh dceehor dceehro dceerho dceeroh dceheor dcehero dcehoer dcehore dcehroe
dcehreo dcereho dcereoh dcerheo dcerhoe dcerohe dceroeh dhrocee dhrocee dhroece dhroeec
dhroeec dhroece dhrcoee dhrcoee dhrceoe dhrceeo dhrceeo dhrceoe dhrecoe dhreceo dhreoce
dhreoec dhreeoc dhreeco dhreceo dhrecoe dhreeco dhreeoc dhreoec dhreoce dhorcee dhorcee
dhorece dhoreec dhoreec dhorece dhocree dhocree dhocere dhoceer dhoceer dhocere dhoecre
dhoecer dhoerce dhoerec dhoeerc dhoeecr dhoecer dhoecre dhoeecr dhoeerc dhoerec dhoerce
dhcoree dhcoree dhcoere dhcoeer dhcoeer dhcoere dhcroee dhcroee dhcreoe dhcreeo dhcreeo
dhcreoe dhceroe dhcereo dhceore dhceoer dhceeor dhceero dhcereo dhceroe dhceero dhceeor
dhceoer dhceore dheocre dheocer dheorce dheorec dheoerc dheoecr dhecore dhecoer dhecroe
dhecreo dhecero dheceor dhercoe dherceo dheroce dheroec dhereoc dhereco dheecro dheecor
dheerco dheeroc dheeorc dheeocr dheocer dheocre dheoecr dheoerc dheorec dheorce dhecoer
dhecore dheceor dhecero dhecreo dhecroe dheecor dheecro dheeocr dheeorc dheeroc dheerco
dherceo dhercoe dhereco dhereoc dheroec dheroce deroche deroceh derohce derohec deroehc
deroech dercohe dercoeh derchoe dercheo derceho derceoh derhcoe derhceo derhoce derhoec
derheoc derheco derecho derecoh derehco derehoc dereohc dereoch deorche deorceh deorhce
deorhec deorehc deorech deocrhe deocreh deochre deocher deocehr deocerh deohcre deohcer
deohrce deohrec deoherc deohecr deoechr deoecrh deoehcr deoehrc deoerhc deoerch decorhe
decoreh decohre decoher decoehr decoerh decrohe decroeh decrhoe decrheo decreho decreoh
dechroe dechreo dechore dechoer decheor dechero decerho deceroh decehro decehor deceohr
deceorh dehocre dehocer dehorce dehorec dehoerc dehoecr dehcore dehcoer dehcroe dehcreo
dehcero dehceor dehrcoe dehrceo dehroce dehroec dehreoc dehreco dehecro dehecor deherco
deheroc deheorc deheocr deeochr deeocrh deeohcr deeohrc deeorhc deeorch deecohr deecorh
deechor deechro deecrho deecroh deehcor deehcro deehocr deehorc deehroc deehrco deercho
deercoh deerhco deerhoc deerohc deeroch edroche edroceh edrohce edrohec edroehc edroech
edrcohe edrcoeh edrchoe edrcheo edrceho edrceoh edrhcoe edrhceo edrhoce edrhoec edrheoc
edrheco edrecho edrecoh edrehco edrehoc edreohc edreoch edorche edorceh edorhce edorhec
edorehc edorech edocrhe edocreh edochre edocher edocehr edocerh edohcre edohcer edohrce
edohrec edoherc edohecr edoechr edoecrh edoehcr edoehrc edoerhc edoerch edcorhe edcoreh
edcohre edcoher edcoehr edcoerh edcrohe edcroeh edcrhoe edcrheo edcreho edcreoh edchroe
edchreo edchore edchoer edcheor edchero edcerho edceroh edcehro edcehor edceohr edceorh
edhocre edhocer edhorce edhorec edhoerc edhoecr edhcore edhcoer edhcroe edhcreo edhcero
edhceor edhrcoe edhrceo edhroce edhroec edhreoc edhreco edhecro edhecor edherco edheroc
edheorc edheocr edeochr edeocrh edeohcr edeohrc edeorhc edeorch edecohr edecorh edechor
edechro edecrho edecroh edehcor edehcro edehocr edehorc edehroc edehrco edercho edercoh
ederhco ederhoc ederohc ederoch erdoche erdoceh erdohce erdohec erdoehc erdoech erdcohe
erdcoeh erdchoe erdcheo erdceho erdceoh erdhcoe erdhceo erdhoce erdhoec erdheoc erdheco
erdecho erdecoh erdehco erdehoc erdeohc erdeoch erodche erodceh erodhce erodhec erodehc
erodech erocdhe erocdeh erochde eroched erocehd erocedh erohcde erohced erohdce erohdec
erohedc erohecd eroechd eroecdh eroehcd eroehdc eroedhc eroedch ercodhe ercodeh ercohde
ercohed ercoehd ercoedh ercdohe ercdoeh ercdhoe ercdheo ercdeho ercdeoh erchdoe erchdeo
erchode erchoed ercheod erchedo ercedho ercedoh ercehdo ercehod erceohd erceodh erhocde
erhoced erhodce erhodec erhoedc erhoecd erhcode erhcoed erhcdoe erhcdeo erhcedo erhceod
erhdcoe erhdceo erhdoce erhdoec erhdeoc erhdeco erhecdo erhecod erhedco erhedoc erheodc
erheocd ereochd ereocdh ereohcd ereohdc ereodhc ereodch erecohd erecodh erechod erechdo
erecdho erecdoh erehcod erehcdo erehocd erehodc erehdoc erehdco eredcho eredcoh eredhco
eredhoc eredohc eredoch eordche eordceh eordhce eordhec eordehc eordech eorcdhe eorcdeh
eorchde eorched eorcehd eorcedh eorhcde eorhced eorhdce eorhdec eorhedc eorhecd eorechd
eorecdh eorehcd eorehdc eoredhc eoredch eodrche eodrceh eodrhce eodrhec eodrehc eodrech
eodcrhe eodcreh eodchre eodcher eodcehr eodcerh eodhcre eodhcer eodhrce eodhrec eodherc
eodhecr eodechr eodecrh eodehcr eodehrc eoderhc eoderch eocdrhe eocdreh eocdhre eocdher
eocdehr eocderh eocrdhe eocrdeh eocrhde eocrhed eocrehd eocredh eochrde eochred eochdre
eochder eochedr eocherd eocerhd eocerdh eocehrd eocehdr eocedhr eocedrh eohdcre eohdcer
eohdrce eohdrec eohderc eohdecr eohcdre eohcder eohcrde eohcred eohcerd eohcedr eohrcde
eohrced eohrdce eohrdec eohredc eohrecd eohecrd eohecdr eohercd eoherdc eohedrc eohedcr
eoedchr eoedcrh eoedhcr eoedhrc eoedrhc eoedrch eoecdhr eoecdrh eoechdr eoechrd eoecrhd
eoecrdh eoehcdr eoehcrd eoehdcr eoehdrc eoehrdc eoehrcd eoerchd eoercdh eoerhcd eoerhdc
eoerdhc eoerdch ecrodhe ecrodeh ecrohde ecrohed ecroehd ecroedh ecrdohe ecrdoeh ecrdhoe
ecrdheo ecrdeho ecrdeoh ecrhdoe ecrhdeo ecrhode ecrhoed ecrheod ecrhedo ecredho ecredoh
ecrehdo ecrehod ecreohd ecreodh ecordhe ecordeh ecorhde ecorhed ecorehd ecoredh ecodrhe
ecodreh ecodhre ecodher ecodehr ecoderh ecohdre ecohder ecohrde ecohred ecoherd ecohedr
ecoedhr ecoedrh ecoehdr ecoehrd ecoerhd ecoerdh ecdorhe ecdoreh ecdohre ecdoher ecdoehr
ecdoerh ecdrohe ecdroeh ecdrhoe ecdrheo ecdreho ecdreoh ecdhroe ecdhreo ecdhore ecdhoer
ecdheor ecdhero ecderho ecderoh ecdehro ecdehor ecdeohr ecdeorh echodre echoder echorde
echored echoerd echoedr echdore echdoer echdroe echdreo echdero echdeor echrdoe echrdeo
echrode echroed echreod echredo echedro echedor echerdo echerod echeord echeodr eceodhr
eceodrh eceohdr eceohrd eceorhd eceordh ecedohr ecedorh ecedhor ecedhro ecedrho ecedroh
ecehdor ecehdro ecehodr ecehord ecehrod ecehrdo ecerdho ecerdoh ecerhdo ecerhod ecerohd
ecerodh ehrocde ehroced ehrodce ehrodec ehroedc ehroecd ehrcode ehrcoed ehrcdoe ehrcdeo
ehrcedo ehrceod ehrdcoe ehrdceo ehrdoce ehrdoec ehrdeoc ehrdeco ehrecdo ehrecod ehredco
ehredoc ehreodc ehreocd ehorcde ehorced ehordce ehordec ehoredc ehorecd ehocrde ehocred
ehocdre ehocder ehocedr ehocerd ehodcre ehodcer ehodrce ehodrec ehoderc ehodecr ehoecdr
ehoecrd ehoedcr ehoedrc ehoerdc ehoercd ehcorde ehcored ehcodre ehcoder ehcoedr ehcoerd
ehcrode ehcroed ehcrdoe ehcrdeo ehcredo ehcreod ehcdroe ehcdreo ehcdore ehcdoer ehcdeor
ehcdero ehcerdo ehcerod ehcedro ehcedor ehceodr ehceord ehdocre ehdocer ehdorce ehdorec
ehdoerc ehdoecr ehdcore ehdcoer ehdcroe ehdcreo ehdcero ehdceor ehdrcoe ehdrceo ehdroce
ehdroec ehdreoc ehdreco ehdecro ehdecor ehderco ehderoc ehdeorc ehdeocr eheocdr eheocrd
eheodcr eheodrc eheordc eheorcd ehecodr ehecord ehecdor ehecdro ehecrdo ehecrod ehedcor
ehedcro ehedocr ehedorc ehedroc ehedrco ehercdo ehercod eherdco eherdoc eherodc eherocd
eerochd eerocdh eerohcd eerohdc eerodhc eerodch eercohd eercodh eerchod eerchdo eercdho
eercdoh eerhcod eerhcdo eerhocd eerhodc eerhdoc eerhdco eerdcho eerdcoh eerdhco eerdhoc
eerdohc eerdoch eeorchd eeorcdh eeorhcd eeorhdc eeordhc eeordch eeocrhd eeocrdh eeochrd
eeochdr eeocdhr eeocdrh eeohcrd eeohcdr eeohrcd eeohrdc eeohdrc eeohdcr eeodchr eeodcrh
eeodhcr eeodhrc eeodrhc eeodrch eecorhd eecordh eecohrd eecohdr eecodhr eecodrh eecrohd
eecrodh eecrhod eecrhdo eecrdho eecrdoh eechrod eechrdo eechord eechodr eechdor eechdro
eecdrho eecdroh eecdhro eecdhor eecdohr eecdorh eehocrd eehocdr eehorcd eehordc eehodrc
eehodcr eehcord eehcodr eehcrod eehcrdo eehcdro eehcdor eehrcod eehrcdo eehrocd eehrodc
eehrdoc eehrdco eehdcro eehdcor eehdrco eehdroc eehdorc eehdocr eedochr eedocrh eedohcr
eedohrc eedorhc eedorch eedcohr eedcorh eedchor eedchro eedcrho eedcroh eedhcor eedhcro
eedhocr eedhorc eedhroc eedhrco eedrcho eedrcoh eedrhco eedrhoc eedrohc eedroch redoche
redoceh redohce redohec redoehc redoech redcohe redcoeh redchoe redcheo redceho redceoh
redhcoe redhceo redhoce redhoec redheoc redheco redecho redecoh redehco redehoc redeohc
redeoch reodche reodceh reodhce reodhec reodehc reodech reocdhe reocdeh reochde reoched
reocehd reocedh reohcde reohced reohdce reohdec reohedc reohecd reoechd reoecdh reoehcd
reoehdc reoedhc reoedch recodhe recodeh recohde recohed recoehd recoedh recdohe recdoeh
recdhoe recdheo recdeho recdeoh rechdoe rechdeo rechode rechoed recheod rechedo recedho
recedoh recehdo recehod receohd receodh rehocde rehoced rehodce rehodec rehoedc rehoecd
rehcode rehcoed rehcdoe rehcdeo rehcedo rehceod rehdcoe rehdceo rehdoce rehdoec rehdeoc
rehdeco rehecdo rehecod rehedco rehedoc reheodc reheocd reeochd reeocdh reeohcd reeohdc
reeodhc reeodch reecohd reecodh reechod reechdo reecdho reecdoh reehcod reehcdo reehocd
reehodc reehdoc reehdco reedcho reedcoh reedhco reedhoc reedohc reedoch rdeoche rdeoceh
rdeohce rdeohec rdeoehc rdeoech rdecohe rdecoeh rdechoe rdecheo rdeceho rdeceoh rdehcoe
rdehceo rdehoce rdehoec rdeheoc rdeheco rdeecho rdeecoh rdeehco rdeehoc rdeeohc rdeeoch
rdoeche rdoeceh rdoehce rdoehec rdoeehc rdoeech rdocehe rdoceeh rdochee rdochee rdocehe
rdoceeh rdohcee rdohcee rdohece rdoheec rdoheec rdohece rdoeche rdoeceh rdoehce rdoehec
rdoeehc rdoeech rdcoehe rdcoeeh rdcohee rdcohee rdcoehe rdcoeeh rdceohe rdceoeh rdcehoe
rdceheo rdceeho rdceeoh rdcheoe rdcheeo rdchoee rdchoee rdcheoe rdcheeo rdceeho rdceeoh
rdceheo rdcehoe rdceohe rdceoeh rdhocee rdhocee rdhoece rdhoeec rdhoeec rdhoece rdhcoee
rdhcoee rdhceoe rdhceeo rdhceeo rdhceoe rdhecoe rdheceo rdheoce rdheoec rdheeoc rdheeco
rdheceo rdhecoe rdheeco rdheeoc rdheoec rdheoce rdeoche rdeoceh rdeohce rdeohec rdeoehc
rdeoech rdecohe rdecoeh rdechoe rdecheo rdeceho rdeceoh rdehcoe rdehceo rdehoce rdehoec
rdeheoc rdeheco rdeecho rdeecoh rdeehco rdeehoc rdeeohc rdeeoch rodeche rodeceh rodehce
rodehec rodeehc rodeech rodcehe rodceeh rodchee rodchee rodcehe rodceeh rodhcee rodhcee
rodhece rodheec rodheec rodhece rodeche rodeceh rodehce rodehec rodeehc rodeech roedche
roedceh roedhce roedhec roedehc roedech roecdhe roecdeh roechde roeched roecehd roecedh
roehcde roehced roehdce roehdec roehedc roehecd roeechd roeecdh roeehcd roeehdc roeedhc
roeedch rocedhe rocedeh rocehde rocehed roceehd roceedh rocdehe rocdeeh rocdhee rocdhee
rocdehe rocdeeh rochdee rochdee rochede rocheed rocheed rochede rocedhe rocedeh rocehde
rocehed roceehd roceedh rohecde roheced rohedce rohedec roheedc roheecd rohcede rohceed
rohcdee rohcdee rohcede rohceed rohdcee rohdcee rohdece rohdeec rohdeec rohdece rohecde
roheced rohedce rohedec roheedc roheecd roeechd roeecdh roeehcd roeehdc roeedhc roeedch
roecehd roecedh roeched roechde roecdhe roecdeh roehced roehcde roehecd roehedc roehdec
roehdce roedche roedceh roedhce roedhec roedehc roedech rcdoehe rcdoeeh rcdohee rcdohee
rcdoehe rcdoeeh rcdeohe rcdeoeh rcdehoe rcdeheo rcdeeho rcdeeoh rcdheoe rcdheeo rcdhoee
rcdhoee rcdheoe rcdheeo rcdeeho rcdeeoh rcdeheo rcdehoe rcdeohe rcdeoeh rcodehe rcodeeh
rcodhee rcodhee rcodehe rcodeeh rcoedhe rcoedeh rcoehde rcoehed rcoeehd rcoeedh rcohede
rcoheed rcohdee rcohdee rcohede rcoheed rcoeehd rcoeedh rcoehed rcoehde rcoedhe rcoedeh
rceodhe rceodeh rceohde rceohed rceoehd rceoedh rcedohe rcedoeh rcedhoe rcedheo rcedeho
rcedeoh rcehdoe rcehdeo rcehode rcehoed rceheod rcehedo rceedho rceedoh rceehdo rceehod
rceeohd rceeodh rchoede rchoeed rchodee rchodee rchoede rchoeed rcheode rcheoed rchedoe
rchedeo rcheedo rcheeod rchdeoe rchdeeo rchdoee rchdoee rchdeoe rchdeeo rcheedo rcheeod
rchedeo rchedoe rcheode rcheoed rceoehd rceoedh rceohed rceohde rceodhe rceodeh rceeohd
rceeodh rceehod rceehdo rceedho rceedoh rceheod rcehedo rcehoed rcehode rcehdoe rcehdeo
rcedeho rcedeoh rcedheo rcedhoe rcedohe rcedoeh rhdocee rhdocee rhdoece rhdoeec rhdoeec
rhdoece rhdcoee rhdcoee rhdceoe rhdceeo rhdceeo rhdceoe rhdecoe rhdeceo rhdeoce rhdeoec
rhdeeoc rhdeeco rhdeceo rhdecoe rhdeeco rhdeeoc rhdeoec rhdeoce rhodcee rhodcee rhodece
rhodeec rhodeec rhodece rhocdee rhocdee rhocede rhoceed rhoceed rhocede rhoecde rhoeced
rhoedce rhoedec rhoeedc rhoeecd rhoeced rhoecde rhoeecd rhoeedc rhoedec rhoedce rhcodee
rhcodee rhcoede rhcoeed rhcoeed rhcoede rhcdoee rhcdoee rhcdeoe rhcdeeo rhcdeeo rhcdeoe
rhcedoe rhcedeo rhceode rhceoed rhceeod rhceedo rhcedeo rhcedoe rhceedo rhceeod rhceoed
rhceode rheocde rheoced rheodce rheodec rheoedc rheoecd rhecode rhecoed rhecdoe rhecdeo
rhecedo rheceod rhedcoe rhedceo rhedoce rhedoec rhedeoc rhedeco rheecdo rheecod rheedco
rheedoc rheeodc rheeocd rheoced rheocde rheoecd rheoedc rheodec rheodce rhecoed rhecode
rheceod rhecedo rhecdeo rhecdoe rheecod rheecdo rheeocd rheeodc rheedoc rheedco rhedceo
rhedcoe rhedeco rhedeoc rhedoec rhedoce redoche redoceh redohce redohec redoehc redoech
redcohe redcoeh redchoe redcheo redceho redceoh redhcoe redhceo redhoce redhoec redheoc
redheco redecho redecoh redehco redehoc redeohc redeoch reodche reodceh reodhce reodhec
reodehc reodech reocdhe reocdeh reochde reoched reocehd reocedh reohcde reohced reohdce
reohdec reohedc reohecd reoechd reoecdh reoehcd reoehdc reoedhc reoedch recodhe recodeh
recohde recohed recoehd recoedh recdohe recdoeh recdhoe recdheo recdeho recdeoh rechdoe
rechdeo rechode rechoed recheod rechedo recedho recedoh recehdo recehod receohd receodh
rehocde rehoced rehodce rehodec rehoedc rehoecd rehcode rehcoed rehcdoe rehcdeo rehcedo
rehceod rehdcoe rehdceo rehdoce rehdoec rehdeoc rehdeco rehecdo rehecod rehedco rehedoc
reheodc reheocd reeochd reeocdh reeohcd reeohdc reeodhc reeodch reecohd reecodh reechod
reechdo reecdho reecdoh reehcod reehcdo reehocd reehodc reehdoc reehdco reedcho reedcoh
reedhco reedhoc reedohc reedoch oerdche oerdceh oerdhce oerdhec oerdehc oerdech oercdhe
oercdeh oerchde oerched oercehd oercedh oerhcde oerhced oerhdce oerhdec oerhedc oerhecd
oerechd oerecdh oerehcd oerehdc oeredhc oeredch oedrche oedrceh oedrhce oedrhec oedrehc
oedrech oedcrhe oedcreh oedchre oedcher oedcehr oedcerh oedhcre oedhcer oedhrce oedhrec
oedherc oedhecr oedechr oedecrh oedehcr oedehrc oederhc oederch oecdrhe oecdreh oecdhre
oecdher oecdehr oecderh oecrdhe oecrdeh oecrhde oecrhed oecrehd oecredh oechrde oechred
oechdre oechder oechedr oecherd oecerhd oecerdh oecehrd oecehdr oecedhr oecedrh oehdcre
oehdcer oehdrce oehdrec oehderc oehdecr oehcdre oehcder oehcrde oehcred oehcerd oehcedr
oehrcde oehrced oehrdce oehrdec oehredc oehrecd oehecrd oehecdr oehercd oeherdc oehedrc
oehedcr oeedchr oeedcrh oeedhcr oeedhrc oeedrhc oeedrch oeecdhr oeecdrh oeechdr oeechrd
oeecrhd oeecrdh oeehcdr oeehcrd oeehdcr oeehdrc oeehrdc oeehrcd oeerchd oeercdh oeerhcd
oeerhdc oeerdhc oeerdch oredche oredceh oredhce oredhec oredehc oredech orecdhe orecdeh
orechde oreched orecehd orecedh orehcde orehced orehdce orehdec orehedc orehecd oreechd
oreecdh oreehcd oreehdc oreedhc oreedch ordeche ordeceh ordehce ordehec ordeehc ordeech
ordcehe ordceeh ordchee ordchee ordcehe ordceeh ordhcee ordhcee ordhece ordheec ordheec
ordhece ordeche ordeceh ordehce ordehec ordeehc ordeech orcdehe orcdeeh orcdhee orcdhee
orcdehe orcdeeh orcedhe orcedeh orcehde orcehed orceehd orceedh orchede orcheed orchdee
orchdee orchede orcheed orceehd orceedh orcehed orcehde orcedhe orcedeh orhdcee orhdcee
orhdece orhdeec orhdeec orhdece orhcdee orhcdee orhcede orhceed orhceed orhcede orhecde
orheced orhedce orhedec orheedc orheecd orheced orhecde orheecd orheedc orhedec orhedce
oredche oredceh oredhce oredhec oredehc oredech orecdhe orecdeh orechde oreched orecehd
orecedh orehcde orehced orehdce orehdec orehedc orehecd oreechd oreecdh oreehcd oreehdc
oreedhc oreedch odreche odreceh odrehce odrehec odreehc odreech odrcehe odrceeh odrchee
odrchee odrcehe odrceeh odrhcee odrhcee odrhece odrheec odrheec odrhece odreche odreceh
odrehce odrehec odreehc odreech oderche oderceh oderhce oderhec oderehc oderech odecrhe
odecreh odechre odecher odecehr odecerh odehcre odehcer odehrce odehrec odeherc odehecr
odeechr odeecrh odeehcr odeehrc odeerhc odeerch odcerhe odcereh odcehre odceher odceehr
odceerh odcrehe odcreeh odcrhee odcrhee odcrehe odcreeh odchree odchree odchere odcheer
odcheer odchere odcerhe odcereh odcehre odceher odceehr odceerh odhecre odhecer odherce
odherec odheerc odheecr odhcere odhceer odhcree odhcree odhcere odhceer odhrcee odhrcee
odhrece odhreec odhreec odhrece odhecre odhecer odherce odherec odheerc odheecr odeechr
odeecrh odeehcr odeehrc odeerhc odeerch odecehr odecerh odecher odechre odecrhe odecreh
odehcer odehcre odehecr odeherc odehrec odehrce oderche oderceh oderhce oderhec oderehc
oderech ocrdehe ocrdeeh ocrdhee ocrdhee ocrdehe ocrdeeh ocredhe ocredeh ocrehde ocrehed
ocreehd ocreedh ocrhede ocrheed ocrhdee ocrhdee ocrhede ocrheed ocreehd ocreedh ocrehed
ocrehde ocredhe ocredeh ocdrehe ocdreeh ocdrhee ocdrhee ocdrehe ocdreeh ocderhe ocdereh
ocdehre ocdeher ocdeehr ocdeerh ocdhere ocdheer ocdhree ocdhree ocdhere ocdheer ocdeehr
ocdeerh ocdeher ocdehre ocderhe ocdereh ocedrhe ocedreh ocedhre ocedher ocedehr ocederh
ocerdhe ocerdeh ocerhde ocerhed ocerehd oceredh ocehrde ocehred ocehdre ocehder ocehedr
oceherd oceerhd oceerdh oceehrd oceehdr oceedhr oceedrh ochdere ochdeer ochdree ochdree
ochdere ochdeer ochedre ocheder ocherde ochered ocheerd ocheedr ochrede ochreed ochrdee
ochrdee ochrede ochreed ocheerd ocheedr ochered ocherde ochedre ocheder ocedehr ocederh
ocedher ocedhre ocedrhe ocedreh oceedhr oceedrh oceehdr oceehrd oceerhd oceerdh ocehedr
oceherd ocehder ocehdre ocehrde ocehred ocerehd oceredh ocerhed ocerhde ocerdhe ocerdeh
ohrdcee ohrdcee ohrdece ohrdeec ohrdeec ohrdece ohrcdee ohrcdee ohrcede ohrceed ohrceed
ohrcede ohrecde ohreced ohredce ohredec ohreedc ohreecd ohreced ohrecde ohreecd ohreedc
ohredec ohredce ohdrcee ohdrcee ohdrece ohdreec ohdreec ohdrece ohdcree ohdcree ohdcere
ohdceer ohdceer ohdcere ohdecre ohdecer ohderce ohderec ohdeerc ohdeecr ohdecer ohdecre
ohdeecr ohdeerc ohderec ohderce ohcdree ohcdree ohcdere ohcdeer ohcdeer ohcdere ohcrdee
ohcrdee ohcrede ohcreed ohcreed ohcrede ohcerde ohcered ohcedre ohceder ohceedr ohceerd
ohcered ohcerde ohceerd ohceedr ohceder ohcedre ohedcre ohedcer ohedrce ohedrec ohederc
ohedecr ohecdre ohecder ohecrde ohecred ohecerd ohecedr ohercde oherced oherdce oherdec
oheredc oherecd oheecrd oheecdr oheercd oheerdc oheedrc oheedcr ohedcer ohedcre ohedecr
ohederc ohedrec ohedrce ohecder ohecdre ohecedr ohecerd ohecred ohecrde oheecdr oheecrd
oheedcr oheedrc oheerdc oheercd oherced ohercde oherecd oheredc oherdec oherdce oerdche
oerdceh oerdhce oerdhec oerdehc oerdech oercdhe oercdeh oerchde oerched oercehd oercedh
oerhcde oerhced oerhdce oerhdec oerhedc oerhecd oerechd oerecdh oerehcd oerehdc oeredhc
oeredch oedrche oedrceh oedrhce oedrhec oedrehc oedrech oedcrhe oedcreh oedchre oedcher
oedcehr oedcerh oedhcre oedhcer oedhrce oedhrec oedherc oedhecr oedechr oedecrh oedehcr
oedehrc oederhc oederch oecdrhe oecdreh oecdhre oecdher oecdehr oecderh oecrdhe oecrdeh
oecrhde oecrhed oecrehd oecredh oechrde oechred oechdre oechder oechedr oecherd oecerhd
oecerdh oecehrd oecehdr oecedhr oecedrh oehdcre oehdcer oehdrce oehdrec oehderc oehdecr
oehcdre oehcder oehcrde oehcred oehcerd oehcedr oehrcde oehrced oehrdce oehrdec oehredc
oehrecd oehecrd oehecdr oehercd oeherdc oehedrc oehedcr oeedchr oeedcrh oeedhcr oeedhrc
oeedrhc oeedrch oeecdhr oeecdrh oeechdr oeechrd oeecrhd oeecrdh oeehcdr oeehcrd oeehdcr
oeehdrc oeehrdc oeehrcd oeerchd oeercdh oeerhcd oeerhdc oeerdhc oeerdch cerodhe cerodeh
cerohde cerohed ceroehd ceroedh cerdohe cerdoeh cerdhoe cerdheo cerdeho cerdeoh cerhdoe
cerhdeo cerhode cerhoed cerheod cerhedo ceredho ceredoh cerehdo cerehod cereohd cereodh
ceordhe ceordeh ceorhde ceorhed ceorehd ceoredh ceodrhe ceodreh ceodhre ceodher ceodehr
ceoderh ceohdre ceohder ceohrde ceohred ceoherd ceohedr ceoedhr ceoedrh ceoehdr ceoehrd
ceoerhd ceoerdh cedorhe cedoreh cedohre cedoher cedoehr cedoerh cedrohe cedroeh cedrhoe
cedrheo cedreho cedreoh cedhroe cedhreo cedhore cedhoer cedheor cedhero cederho cederoh
cedehro cedehor cedeohr cedeorh cehodre cehoder cehorde cehored cehoerd cehoedr cehdore
cehdoer cehdroe cehdreo cehdero cehdeor cehrdoe cehrdeo cehrode cehroed cehreod cehredo
cehedro cehedor ceherdo ceherod ceheord ceheodr ceeodhr ceeodrh ceeohdr ceeohrd ceeorhd
ceeordh ceedohr ceedorh ceedhor ceedhro ceedrho ceedroh ceehdor ceehdro ceehodr ceehord
ceehrod ceehrdo ceerdho ceerdoh ceerhdo ceerhod ceerohd ceerodh creodhe creodeh creohde
creohed creoehd creoedh credohe credoeh credhoe credheo credeho credeoh crehdoe crehdeo
crehode crehoed creheod crehedo creedho creedoh creehdo creehod creeohd creeodh croedhe
croedeh croehde croehed croeehd croeedh crodehe crodeeh crodhee crodhee crodehe crodeeh
crohdee crohdee crohede croheed croheed crohede croedhe croedeh croehde croehed croeehd
croeedh crdoehe crdoeeh crdohee crdohee crdoehe crdoeeh crdeohe crdeoeh crdehoe crdeheo
crdeeho crdeeoh crdheoe crdheeo crdhoee crdhoee crdheoe crdheeo crdeeho crdeeoh crdeheo
crdehoe crdeohe crdeoeh crhodee crhodee crhoede crhoeed crhoeed crhoede crhdoee crhdoee
crhdeoe crhdeeo crhdeeo crhdeoe crhedoe crhedeo crheode crheoed crheeod crheedo crhedeo
crhedoe crheedo crheeod crheoed crheode creodhe creodeh creohde creohed creoehd creoedh
credohe credoeh credhoe credheo credeho credeoh crehdoe crehdeo crehode crehoed creheod
crehedo creedho creedoh creehdo creehod creeohd creeodh coredhe coredeh corehde corehed
coreehd coreedh cordehe cordeeh cordhee cordhee cordehe cordeeh corhdee corhdee corhede
corheed corheed corhede coredhe coredeh corehde corehed coreehd coreedh coerdhe coerdeh
coerhde coerhed coerehd coeredh coedrhe coedreh coedhre coedher coedehr coederh coehdre
coehder coehrde coehred coeherd coehedr coeedhr coeedrh coeehdr coeehrd coeerhd coeerdh
coderhe codereh codehre codeher codeehr codeerh codrehe codreeh codrhee codrhee codrehe
codreeh codhree codhree codhere codheer codheer codhere coderhe codereh codehre codeher
codeehr codeerh cohedre coheder coherde cohered coheerd coheedr cohdere cohdeer cohdree
cohdree cohdere cohdeer cohrdee cohrdee cohrede cohreed cohreed cohrede cohedre coheder
coherde cohered coheerd coheedr coeedhr coeedrh coeehdr coeehrd coeerhd coeerdh coedehr
coederh coedher coedhre coedrhe coedreh coehder coehdre coehedr coeherd coehred coehrde
coerdhe coerdeh coerhde coerhed coerehd coeredh cdroehe cdroeeh cdrohee cdrohee cdroehe
cdroeeh cdreohe cdreoeh cdrehoe cdreheo cdreeho cdreeoh cdrheoe cdrheeo cdrhoee cdrhoee
cdrheoe cdrheeo cdreeho cdreeoh cdreheo cdrehoe cdreohe cdreoeh cdorehe cdoreeh cdorhee
cdorhee cdorehe cdoreeh cdoerhe cdoereh cdoehre cdoeher cdoeehr cdoeerh cdohere cdoheer
cdohree cdohree cdohere cdoheer cdoeehr cdoeerh cdoeher cdoehre cdoerhe cdoereh cdeorhe
cdeoreh cdeohre cdeoher cdeoehr cdeoerh cderohe cderoeh cderhoe cderheo cdereho cdereoh
cdehroe cdehreo cdehore cdehoer cdeheor cdehero cdeerho cdeeroh cdeehro cdeehor cdeeohr
cdeeorh cdhoere cdhoeer cdhoree cdhoree cdhoere cdhoeer cdheore cdheoer cdheroe cdhereo
cdheero cdheeor cdhreoe cdhreeo cdhroee cdhroee cdhreoe cdhreeo cdheero cdheeor cdhereo
cdheroe cdheore cdheoer cdeoehr cdeoerh cdeoher cdeohre cdeorhe cdeoreh cdeeohr cdeeorh
cdeehor cdeehro cdeerho cdeeroh cdeheor cdehero cdehoer cdehore cdehroe cdehreo cdereho
cdereoh cderheo cderhoe cderohe cderoeh chrodee chrodee chroede chroeed chroeed chroede
chrdoee chrdoee chrdeoe chrdeeo chrdeeo chrdeoe chredoe chredeo chreode chreoed chreeod
chreedo chredeo chredoe chreedo chreeod chreoed chreode chordee chordee chorede choreed
choreed chorede chodree chodree chodere chodeer chodeer chodere choedre choeder choerde
choered choeerd choeedr choeder choedre choeedr choeerd choered choerde chdoree chdoree
chdoere chdoeer chdoeer chdoere chdroee chdroee chdreoe chdreeo chdreeo chdreoe chderoe
chdereo chdeore chdeoer chdeeor chdeero chdereo chderoe chdeero chdeeor chdeoer chdeore
cheodre cheoder cheorde cheored cheoerd cheoedr chedore chedoer chedroe chedreo chedero
chedeor cherdoe cherdeo cherode cheroed chereod cheredo cheedro cheedor cheerdo cheerod
cheeord cheeodr cheoder cheodre cheoedr cheoerd cheored cheorde chedoer chedore chedeor
chedero chedreo chedroe cheedor cheedro cheeodr cheeord cheerod cheerdo cherdeo cherdoe
cheredo chereod cheroed cherode cerodhe cerodeh cerohde cerohed ceroehd ceroedh cerdohe
cerdoeh cerdhoe cerdheo cerdeho cerdeoh cerhdoe cerhdeo cerhode cerhoed cerheod cerhedo
ceredho ceredoh cerehdo cerehod cereohd cereodh ceordhe ceordeh ceorhde ceorhed ceorehd
ceoredh ceodrhe ceodreh ceodhre ceodher ceodehr ceoderh ceohdre ceohder ceohrde ceohred
ceoherd ceohedr ceoedhr ceoedrh ceoehdr ceoehrd ceoerhd ceoerdh cedorhe cedoreh cedohre
cedoher cedoehr cedoerh cedrohe cedroeh cedrhoe cedrheo cedreho cedreoh cedhroe cedhreo
cedhore cedhoer cedheor cedhero cederho cederoh cedehro cedehor cedeohr cedeorh cehodre
cehoder cehorde cehored cehoerd cehoedr cehdore cehdoer cehdroe cehdreo cehdero cehdeor
cehrdoe cehrdeo cehrode cehroed cehreod cehredo cehedro cehedor ceherdo ceherod ceheord
ceheodr ceeodhr ceeodrh ceeohdr ceeohrd ceeorhd ceeordh ceedohr ceedorh ceedhor ceedhro
ceedrho ceedroh ceehdor ceehdro ceehodr ceehord ceehrod ceehrdo ceerdho ceerdoh ceerhdo
ceerhod ceerohd ceerodh herocde heroced herodce herodec heroedc heroecd hercode hercoed
hercdoe hercdeo hercedo herceod herdcoe herdceo herdoce herdoec herdeoc herdeco herecdo
herecod heredco heredoc hereodc hereocd heorcde heorced heordce heordec heoredc heorecd
heocrde heocred heocdre heocder heocedr heocerd heodcre heodcer heodrce heodrec heoderc
heodecr heoecdr heoecrd heoedcr heoedrc heoerdc heoercd hecorde hecored hecodre hecoder
hecoedr hecoerd hecrode hecroed hecrdoe hecrdeo hecredo hecreod hecdroe hecdreo hecdore
hecdoer hecdeor hecdero hecerdo hecerod hecedro hecedor heceodr heceord hedocre hedocer
hedorce hedorec hedoerc hedoecr hedcore hedcoer hedcroe hedcreo hedcero hedceor hedrcoe
hedrceo hedroce hedroec hedreoc hedreco hedecro hedecor hederco hederoc hedeorc hedeocr
heeocdr heeocrd heeodcr heeodrc heeordc heeorcd heecodr heecord heecdor heecdro heecrdo
heecrod heedcor heedcro heedocr heedorc heedroc heedrco heercdo heercod heerdco heerdoc
heerodc heerocd hreocde hreoced hreodce hreodec hreoedc hreoecd hrecode hrecoed hrecdoe
hrecdeo hrecedo hreceod hredcoe hredceo hredoce hredoec hredeoc hredeco hreecdo hreecod
hreedco hreedoc hreeodc hreeocd hroecde hroeced hroedce hroedec hroeedc hroeecd hrocede
hroceed hrocdee hrocdee hrocede hroceed hrodcee hrodcee hrodece hrodeec hrodeec hrodece
hroecde hroeced hroedce hroedec hroeedc hroeecd hrcoede hrcoeed hrcodee hrcodee hrcoede
hrcoeed hrceode hrceoed hrcedoe hrcedeo hrceedo hrceeod hrcdeoe hrcdeeo hrcdoee hrcdoee
hrcdeoe hrcdeeo hrceedo hrceeod hrcedeo hrcedoe hrceode hrceoed hrdocee hrdocee hrdoece
hrdoeec hrdoeec hrdoece hrdcoee hrdcoee hrdceoe hrdceeo hrdceeo hrdceoe hrdecoe hrdeceo
hrdeoce hrdeoec hrdeeoc hrdeeco hrdeceo hrdecoe hrdeeco hrdeeoc hrdeoec hrdeoce hreocde
hreoced hreodce hreodec hreoedc hreoecd hrecode hrecoed hrecdoe hrecdeo hrecedo hreceod
hredcoe hredceo hredoce hredoec hredeoc hredeco hreecdo hreecod hreedco hreedoc hreeodc
hreeocd horecde horeced horedce horedec horeedc horeecd horcede horceed horcdee horcdee
horcede horceed hordcee hordcee hordece hordeec hordeec hordece horecde horeced horedce
horedec horeedc horeecd hoercde hoerced hoerdce hoerdec hoeredc hoerecd hoecrde hoecred
hoecdre hoecder hoecedr hoecerd hoedcre hoedcer hoedrce hoedrec hoederc hoedecr hoeecdr
hoeecrd hoeedcr hoeedrc hoeerdc hoeercd hocerde hocered hocedre hoceder hoceedr hoceerd
hocrede hocreed hocrdee hocrdee hocrede hocreed hocdree hocdree hocdere hocdeer hocdeer
hocdere hocerde hocered hocedre hoceder hoceedr hoceerd hodecre hodecer hoderce hoderec
hodeerc hodeecr hodcere hodceer hodcree hodcree hodcere hodceer hodrcee hodrcee hodrece
hodreec hodreec hodrece hodecre hodecer hoderce hoderec hodeerc hodeecr hoeecdr hoeecrd
hoeedcr hoeedrc hoeerdc hoeercd hoecedr hoecerd hoecder hoecdre hoecrde hoecred hoedcer
hoedcre hoedecr hoederc hoedrec hoedrce hoercde hoerced hoerdce hoerdec hoeredc hoerecd
hcroede hcroeed hcrodee hcrodee hcroede hcroeed hcreode hcreoed hcredoe hcredeo hcreedo
hcreeod hcrdeoe hcrdeeo hcrdoee hcrdoee hcrdeoe hcrdeeo hcreedo hcreeod hcredeo hcredoe
hcreode hcreoed hcorede hcoreed hcordee hcordee hcorede hcoreed hcoerde hcoered hcoedre
hcoeder hcoeedr hcoeerd hcodere hcodeer hcodree hcodree hcodere hcodeer hcoeedr hcoeerd
hcoeder hcoedre hcoerde hcoered hceorde hceored hceodre hceoder hceoedr hceoerd hcerode
hceroed hcerdoe hcerdeo hceredo hcereod hcedroe hcedreo hcedore hcedoer hcedeor hcedero
hceerdo hceerod hceedro hceedor hceeodr hceeord hcdoere hcdoeer hcdoree hcdoree hcdoere
hcdoeer hcdeore hcdeoer hcderoe hcdereo hcdeero hcdeeor hcdreoe hcdreeo hcdroee hcdroee
hcdreoe hcdreeo hcdeero hcdeeor hcdereo hcderoe hcdeore hcdeoer hceoedr hceoerd hceoder
hceodre hceorde hceored hceeodr hceeord hceedor hceedro hceerdo hceerod hcedeor hcedero
hcedoer hcedore hcedroe hcedreo hceredo hcereod hcerdeo hcerdoe hcerode hceroed hdrocee
hdrocee hdroece hdroeec hdroeec hdroece hdrcoee hdrcoee hdrceoe hdrceeo hdrceeo hdrceoe
hdrecoe hdreceo hdreoce hdreoec hdreeoc hdreeco hdreceo hdrecoe hdreeco hdreeoc hdreoec
hdreoce hdorcee hdorcee hdorece hdoreec hdoreec hdorece hdocree hdocree hdocere hdoceer
hdoceer hdocere hdoecre hdoecer hdoerce hdoerec hdoeerc hdoeecr hdoecer hdoecre hdoeecr
hdoeerc hdoerec hdoerce hdcoree hdcoree hdcoere hdcoeer hdcoeer hdcoere hdcroee hdcroee
hdcreoe hdcreeo hdcreeo hdcreoe hdceroe hdcereo hdceore hdceoer hdceeor hdceero hdcereo
hdceroe hdceero hdceeor hdceoer hdceore hdeocre hdeocer hdeorce hdeorec hdeoerc hdeoecr
hdecore hdecoer hdecroe hdecreo hdecero hdeceor hdercoe hderceo hderoce hderoec hdereoc
hdereco hdeecro hdeecor hdeerco hdeeroc hdeeorc hdeeocr hdeocer hdeocre hdeoecr hdeoerc
hdeorec hdeorce hdecoer hdecore hdeceor hdecero hdecreo hdecroe hdeecor hdeecro hdeeocr
hdeeorc hdeeroc hdeerco hderceo hdercoe hdereco hdereoc hderoec hderoce herocde heroced
herodce herodec heroedc heroecd hercode hercoed hercdoe hercdeo hercedo herceod herdcoe
herdceo herdoce herdoec herdeoc herdeco herecdo herecod heredco heredoc hereodc hereocd
heorcde heorced heordce heordec heoredc heorecd heocrde heocred heocdre heocder heocedr
heocerd heodcre heodcer heodrce heodrec heoderc heodecr heoecdr heoecrd heoedcr heoedrc
heoerdc heoercd hecorde hecored hecodre hecoder hecoedr hecoerd hecrode hecroed hecrdoe
hecrdeo hecredo hecreod hecdroe hecdreo hecdore hecdoer hecdeor hecdero hecerdo hecerod
hecedro hecedor heceodr heceord hedocre hedocer hedorce hedorec hedoerc hedoecr hedcore
hedcoer hedcroe hedcreo hedcero hedceor hedrcoe hedrceo hedroce hedroec hedreoc hedreco
hedecro hedecor hederco hederoc hedeorc hedeocr heeocdr heeocrd heeodcr heeodrc heeordc
heeorcd heecodr heecord heecdor heecdro heecrdo heecrod heedcor heedcro heedocr heedorc
heedroc heedrco heercdo heercod heerdco heerdoc heerodc heerocd eerochd eerocdh eerohcd
eerohdc eerodhc eerodch eercohd eercodh eerchod eerchdo eercdho eercdoh eerhcod eerhcdo
eerhocd eerhodc eerhdoc eerhdco eerdcho eerdcoh eerdhco eerdhoc eerdohc eerdoch eeorchd
eeorcdh eeorhcd eeorhdc eeordhc eeordch eeocrhd eeocrdh eeochrd eeochdr eeocdhr eeocdrh
eeohcrd eeohcdr eeohrcd eeohrdc eeohdrc eeohdcr eeodchr eeodcrh eeodhcr eeodhrc eeodrhc
eeodrch eecorhd eecordh eecohrd eecohdr eecodhr eecodrh eecrohd eecrodh eecrhod eecrhdo
eecrdho eecrdoh eechrod eechrdo eechord eechodr eechdor eechdro eecdrho eecdroh eecdhro
eecdhor eecdohr eecdorh eehocrd eehocdr eehorcd eehordc eehodrc eehodcr eehcord eehcodr
eehcrod eehcrdo eehcdro eehcdor eehrcod eehrcdo eehrocd eehrodc eehrdoc eehrdco eehdcro
eehdcor eehdrco eehdroc eehdorc eehdocr eedochr eedocrh eedohcr eedohrc eedorhc eedorch
eedcohr eedcorh eedchor eedchro eedcrho eedcroh eedhcor eedhcro eedhocr eedhorc eedhroc
eedhrco eedrcho eedrcoh eedrhco eedrhoc eedrohc eedroch ereochd ereocdh ereohcd ereohdc
ereodhc ereodch erecohd erecodh erechod erechdo erecdho erecdoh erehcod erehcdo erehocd
erehodc erehdoc erehdco eredcho eredcoh eredhco eredhoc eredohc eredoch eroechd eroecdh
eroehcd eroehdc eroedhc eroedch erocehd erocedh eroched erochde erocdhe erocdeh erohced
erohcde erohecd erohedc erohdec erohdce erodche erodceh erodhce erodhec erodehc erodech
ercoehd ercoedh ercohed ercohde ercodhe ercodeh erceohd erceodh ercehod ercehdo ercedho
ercedoh ercheod erchedo erchoed erchode erchdoe erchdeo ercdeho ercdeoh ercdheo ercdhoe
ercdohe ercdoeh erhoced erhocde erhoecd erhoedc erhodec erhodce erhcoed erhcode erhceod
erhcedo erhcdeo erhcdoe erhecod erhecdo erheocd erheodc erhedoc erhedco erhdceo erhdcoe
erhdeco erhdeoc erhdoec erhdoce erdoche erdoceh erdohce erdohec erdoehc erdoech erdcohe
erdcoeh erdchoe erdcheo erdceho erdceoh erdhcoe erdhceo erdhoce erdhoec erdheoc erdheco
erdecho erdecoh erdehco erdehoc erdeohc erdeoch eorechd eorecdh eorehcd eorehdc eoredhc
eoredch eorcehd eorcedh eorched eorchde eorcdhe eorcdeh eorhced eorhcde eorhecd eorhedc
eorhdec eorhdce eordche eordceh eordhce eordhec eordehc eordech eoerchd eoercdh eoerhcd
eoerhdc eoerdhc eoerdch eoecrhd eoecrdh eoechrd eoechdr eoecdhr eoecdrh eoehcrd eoehcdr
eoehrcd eoehrdc eoehdrc eoehdcr eoedchr eoedcrh eoedhcr eoedhrc eoedrhc eoedrch eocerhd
eocerdh eocehrd eocehdr eocedhr eocedrh eocrehd eocredh eocrhed eocrhde eocrdhe eocrdeh
eochred eochrde eocherd eochedr eochder eochdre eocdrhe eocdreh eocdhre eocdher eocdehr
eocderh eohecrd eohecdr eohercd eoherdc eohedrc eohedcr eohcerd eohcedr eohcred eohcrde
eohcdre eohcder eohrced eohrcde eohrecd eohredc eohrdec eohrdce eohdcre eohdcer eohdrce
eohdrec eohderc eohdecr eodechr eodecrh eodehcr eodehrc eoderhc eoderch eodcehr eodcerh
eodcher eodchre eodcrhe eodcreh eodhcer eodhcre eodhecr eodherc eodhrec eodhrce eodrche
eodrceh eodrhce eodrhec eodrehc eodrech ecroehd ecroedh ecrohed ecrohde ecrodhe ecrodeh
ecreohd ecreodh ecrehod ecrehdo ecredho ecredoh ecrheod ecrhedo ecrhoed ecrhode ecrhdoe
ecrhdeo ecrdeho ecrdeoh ecrdheo ecrdhoe ecrdohe ecrdoeh ecorehd ecoredh ecorhed ecorhde
ecordhe ecordeh ecoerhd ecoerdh ecoehrd ecoehdr ecoedhr ecoedrh ecoherd ecohedr ecohred
ecohrde ecohdre ecohder ecodehr ecoderh ecodher ecodhre ecodrhe ecodreh eceorhd eceordh
eceohrd eceohdr eceodhr eceodrh ecerohd ecerodh ecerhod ecerhdo ecerdho ecerdoh ecehrod
ecehrdo ecehord ecehodr ecehdor ecehdro ecedrho ecedroh ecedhro ecedhor ecedohr ecedorh
echoerd echoedr echored echorde echodre echoder echeord echeodr echerod echerdo echedro
echedor echreod echredo echroed echrode echrdoe echrdeo echdero echdeor echdreo echdroe
echdore echdoer ecdoehr ecdoerh ecdoher ecdohre ecdorhe ecdoreh ecdeohr ecdeorh ecdehor
ecdehro ecderho ecderoh ecdheor ecdhero ecdhoer ecdhore ecdhroe ecdhreo ecdreho ecdreoh
ecdrheo ecdrhoe ecdrohe ecdroeh ehroced ehrocde ehroecd ehroedc ehrodec ehrodce ehrcoed
ehrcode ehrceod ehrcedo ehrcdeo ehrcdoe ehrecod ehrecdo ehreocd ehreodc ehredoc ehredco
ehrdceo ehrdcoe ehrdeco ehrdeoc ehrdoec ehrdoce ehorced ehorcde ehorecd ehoredc ehordec
ehordce ehocred ehocrde ehocerd ehocedr ehocder ehocdre ehoecrd ehoecdr ehoercd ehoerdc
ehoedrc ehoedcr ehodcer ehodcre ehodecr ehoderc ehodrec ehodrce ehcored ehcorde ehcoerd
ehcoedr ehcoder ehcodre ehcroed ehcrode ehcreod ehcredo ehcrdeo ehcrdoe ehcerod ehcerdo
ehceord ehceodr ehcedor ehcedro ehcdreo ehcdroe ehcdero ehcdeor ehcdoer ehcdore eheocrd
eheocdr eheorcd eheordc eheodrc eheodcr ehecord ehecodr ehecrod ehecrdo ehecdro ehecdor
ehercod ehercdo eherocd eherodc eherdoc eherdco ehedcro ehedcor ehedrco ehedroc ehedorc
ehedocr ehdocer ehdocre ehdoecr ehdoerc ehdorec ehdorce ehdcoer ehdcore ehdceor ehdcero
ehdcreo ehdcroe ehdecor ehdecro ehdeocr ehdeorc ehderoc ehderco ehdrceo ehdrcoe ehdreco
ehdreoc ehdroec ehdroce edroche edroceh edrohce edrohec edroehc edroech edrcohe edrcoeh
edrchoe edrcheo edrceho edrceoh edrhcoe edrhceo edrhoce edrhoec edrheoc edrheco edrecho
edrecoh edrehco edrehoc edreohc edreoch edorche edorceh edorhce edorhec edorehc edorech
edocrhe edocreh edochre edocher edocehr edocerh edohcre edohcer edohrce edohrec edoherc
edohecr edoechr edoecrh edoehcr edoehrc edoerhc edoerch edcorhe edcoreh edcohre edcoher
edcoehr edcoerh edcrohe edcroeh edcrhoe edcrheo edcreho edcreoh edchroe edchreo edchore
edchoer edcheor edchero edcerho edceroh edcehro edcehor edceohr edceorh edhocre edhocer
edhorce edhorec edhoerc edhoecr edhcore edhcoer edhcroe edhcreo edhcero edhceor edhrcoe
edhrceo edhroce edhroec edhreoc edhreco edhecro edhecor edherco edheroc edheorc edheocr
edeochr edeocrh edeohcr edeohrc edeorhc edeorch edecohr edecorh edechor edechro edecrho
edecroh edehcor edehcro edehocr edehorc edehroc edehrco edercho edercoh ederhco ederhoc
ederohc ederoch

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us