easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

cuittikin

guadal

cabalic

egging

haverly

camelina

divitiae

centrobaric

postvenereal

capysque

myriopod

schertz

sesta

jaseyed

malinowski

unstifled

respiro

barganier


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: dentelle
cipher variations:
efoufmmf fgpvgnng ghqwhooh hirxippi ijsyjqqj
jktzkrrk klualssl lmvbmttm mnwcnuun noxdovvo
opyepwwp pqzfqxxq qragryyr rsbhszzs stcitaat
tudjubbu uvekvccv vwflwddw wxgmxeex xyhnyffy
yziozggz zajpahha abkqbiib bclrcjjc cdmsdkkd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: dentelle
Cipher: wvmgvoov

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: dentelle
Cipher: AAABB AABAA ABBAA BAABA AABAA ABABA ABABA AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: dentelle
cipher variations:
efoufmmfknogniinqvosveevwdoedaadcloqlwwlitoctsstujoajkkjaromrggr
gzoyzcczmhokhyyhspowpuupyxoixqqxfgpvgnnglophojjorwptwffwxepfebbe
dmprmxxmjupduttuvkpbkllkbspnshhshapzaddaniplizzitqpxqvvqzypjyrry
ghqwhoohmpqipkkpsxquxggxyfqgfccfenqsnyynkvqevuuvwlqclmmlctqotiit
ibqabeebojqmjaajurqyrwwrazqkzsszhirxippinqrjqllqtyrvyhhyzgrhgddg
fortozzolwrfwvvwxmrdmnnmdurpujjujcrbcffcpkrnkbbkvsrzsxxsbarlatta
ijsyjqqjorskrmmruzswziizahsiheehgpsupaapmxsgxwwxynsenoonevsqvkkv
kdscdggdqlsolcclwtsatyytcbsmbuubjktzkrrkpstlsnnsvatxajjabitjiffi
hqtvqbbqnythyxxyzotfoppofwtrwllwletdehhermtpmddmxutbuzzudctncvvc
klualsslqtumtootwbuybkkbcjukjggjiruwrccrozuizyyzapugpqqpgxusxmmx
mfuefiifsnuqneenyvucvaaveduodwwdlmvbmttmruvnuppuxcvzcllcdkvlkhhk
jsvxsddspavjazzabqvhqrrqhyvtynnyngvfgjjgtovroffozwvdwbbwfevpexxe
mnwcnuunsvwovqqvydwadmmdelwmliilktwyteetqbwkbaabcrwirssrizwuzooz
ohwghkkhupwspggpaxwexccxgfwqfyyfnoxdovvotwxpwrrwzexbennefmxnmjjm
luxzuffurcxlcbbcdsxjsttsjaxvappapixhillivqxtqhhqbyxfyddyhgxrgzzg
opyepwwpuxyqxssxafycfoofgnyonkknmvyavggvsdymdccdetyktuutkbywbqqb
qjyijmmjwryuriirczygzeezihyshaahpqzfqxxqvyzryttybgzdgppghozpollo
nwzbwhhwtezneddefuzluvvulczxcrrcrkzjknnkxszvsjjsdazhaffajiztibbi
qragryyrwzaszuuzchaehqqhipaqpmmpoxacxiixufaofeefgvamvwwvmdaydssd
slakloolytawtkktebaibggbkjaujccjrsbhszzsxabtavvadibfirrijqbrqnnq
pybdyjjyvgbpgffghwbnwxxwnebzettetmblmppmzubxullufcbjchhclkbvkddk
stcitaatybcubwwbejcgjssjkrcsroorqzcezkkzwhcqhgghixcoxyyxofcafuuf
uncmnqqnavcyvmmvgdckdiidmlcwleeltudjubbuzcdvcxxcfkdhkttklsdtspps
radfallaxidrihhijydpyzzypgdbgvvgvodnorrobwdzwnnwhedlejjenmdxmffm
uvekvccvadewdyydgleiluulmteutqqtsbegbmmbyjesjiijkzeqzaazqhechwwh
wpeopsspcxeaxooxifemfkkfoneynggnvwflwddwbefxezzehmfjmvvmnufvurru
tcfhcnnczkftkjjklafrabbarifdixxixqfpqttqdyfbyppyjgfngllgpofzohho
wxgmxeexcfgyfaafingknwwnovgwvssvudgidoodalgulkklmbgsbccbsjgejyyj
yrgqruurezgczqqzkhgohmmhqpgapiipxyhnyffydghzgbbgjohloxxopwhxwttw
vehjeppebmhvmllmnchtcddctkhfkzzkzshrsvvsfahdarralihpinnirqhbqjjq
yziozggzehiahcchkpimpyypqxiyxuuxwfikfqqfcniwnmmnodiudeeduliglaal
atistwwtgbiebssbmjiqjoojsricrkkrzajpahhafijbiddilqjnqzzqryjzyvvy
xgjlgrrgdojxonnopejveffevmjhmbbmbujtuxxuhcjfcttcnkjrkppktsjdslls
abkqbiibgjkcjeejmrkoraarszkazwwzyhkmhsshepkypoopqfkwfggfwnkinccn
cvkuvyyvidkgduudolkslqqlutketmmtbclrcjjchkldkffknslpsbbstalbaxxa
zilnittifqlzqppqrglxghhgxoljoddodwlvwzzwjelhevvepmltmrrmvulfunnu
cdmsdkkdilmelgglotmqtcctubmcbyybajmojuujgrmarqqrshmyhiihypmkpeep
exmwxaaxkfmifwwfqnmunssnwvmgvoovdentellejmnfmhhmpunrudduvcndczzc
bknpkvvkhsnbsrrstinzijjizqnlqffqfynxybbylgnjgxxgronvottoxwnhwppw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: dentelle
Cipher: qragryyr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: dentelle
Cipher: 4151334451131351

Extended Methods:
Method #1

Plaintext: dentelle
method variations:
iksykqqkopxdpvvptuciuaauyzhozffz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
d e n t e l l e 
4 5 3 4 5 1 1 5 
1 1 3 4 1 3 3 1 
They are then read out in rows:
4534511511341331
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: dentelle
Cipher: ysevaslc

Read more ...
Method #3

Plaintext: dentelle
method variations:
vlsyacxq lsyacxqv syacxqvl
yacxqvls acxqvlsy cxqvlsya
xqvlsyac qvlsyacx

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: dentelle

first 5040 cipher variations(40320 total)
dentelle dentelel dentelle dentelel denteell denteell dentlele dentleel dentllee dentllee dentlele
dentleel dentllee dentllee dentlele dentleel dentleel dentlele dentelle dentelel dentelle dentelel
denteell denteell denetlle denetlel denetlle denetlel denetell denetell deneltle deneltel denellte
denellet denelelt deneletl denellte denellet deneltle deneltel deneletl denelelt deneellt deneeltl
deneellt deneeltl deneetll deneetll denletle denletel denlelte denlelet denleelt denleetl denltele
denlteel denltlee denltlee denltele denlteel denlltee denlltee denllete denlleet denlleet denllete
denletle denletel denlelte denlelet denleelt denleetl denlelte denlelet denletle denletel denleetl
denleelt denllete denlleet denlltee denlltee denllete denlleet denltlee denltlee denltele denlteel
denlteel denltele denlelte denlelet denletle denletel denleetl denleelt deneellt deneeltl deneellt
deneeltl deneetll deneetll denelelt deneletl denellet denellte deneltle deneltel denellet denellte
denelelt deneletl deneltel deneltle denetlle denetlel denetlle denetlel denetell denetell detnelle
detnelel detnelle detnelel detneell detneell detnlele detnleel detnllee detnllee detnlele detnleel
detnllee detnllee detnlele detnleel detnleel detnlele detnelle detnelel detnelle detnelel detneell
detneell detenlle detenlel detenlle detenlel detenell detenell detelnle detelnel detellne detellen
deteleln detelenl detellne detellen detelnle detelnel detelenl deteleln deteelln deteelnl deteelln
deteelnl deteenll deteenll detlenle detlenel detlelne detlelen detleeln detleenl detlnele detlneel
detlnlee detlnlee detlnele detlneel detllnee detllnee detllene detlleen detlleen detllene detlenle
detlenel detlelne detlelen detleeln detleenl detlelne detlelen detlenle detlenel detleenl detleeln
detllene detlleen detllnee detllnee detllene detlleen detlnlee detlnlee detlnele detlneel detlneel
detlnele detlelne detlelen detlenle detlenel detleenl detleeln deteelln deteelnl deteelln deteelnl
deteenll deteenll deteleln detelenl detellen detellne detelnle detelnel detellen detellne deteleln
detelenl detelnel detelnle detenlle detenlel detenlle detenlel detenell detenell deetnlle deetnlel
deetnlle deetnlel deetnell deetnell deetlnle deetlnel deetllne deetllen deetleln deetlenl deetllne
deetllen deetlnle deetlnel deetlenl deetleln deetelln deetelnl deetelln deetelnl deetenll deetenll
deentlle deentlel deentlle deentlel deentell deentell deenltle deenltel deenllte deenllet deenlelt
deenletl deenllte deenllet deenltle deenltel deenletl deenlelt deenellt deeneltl deenellt deeneltl
deenetll deenetll deelntle deelntel deelnlte deelnlet deelnelt deelnetl deeltnle deeltnel deeltlne
deeltlen deelteln deeltenl deelltne deellten deellnte deellnet deellent deelletn deeletln deeletnl
deeleltn deelelnt deelenlt deelentl deelnlte deelnlet deelntle deelntel deelnetl deelnelt deellnte
deellnet deelltne deellten deelletn deellent deeltlne deeltlen deeltnle deeltnel deeltenl deelteln
deeleltn deelelnt deeletln deeletnl deelentl deelenlt deeenllt deeenltl deeenllt deeenltl deeentll
deeentll deeelnlt deeelntl deeellnt deeelltn deeeltln deeeltnl deeellnt deeelltn deeelnlt deeelntl
deeeltnl deeeltln deeetlln deeetlnl deeetlln deeetlnl deeetnll deeetnll deltenle deltenel deltelne
deltelen delteeln delteenl deltnele deltneel deltnlee deltnlee deltnele deltneel deltlnee deltlnee
deltlene deltleen deltleen deltlene deltenle deltenel deltelne deltelen delteeln delteenl deletnle
deletnel deletlne deletlen deleteln deletenl delentle delentel delenlte delenlet delenelt delenetl
delelnte delelnet deleltne delelten deleletn delelent deleenlt deleentl deleelnt deleeltn deleetln
deleetnl delnetle delnetel delnelte delnelet delneelt delneetl delntele delnteel delntlee delntlee
delntele delnteel delnltee delnltee delnlete delnleet delnleet delnlete delnetle delnetel delnelte
delnelet delneelt delneetl dellente dellenet delletne delleten delleetn delleent dellnete dellneet
dellntee dellntee dellnete dellneet delltnee delltnee delltene dellteen dellteen delltene dellente
dellenet delletne delleten delleetn delleent deleenlt deleentl deleelnt deleeltn deleetln deleetnl
delenelt delenetl delenlet delenlte delentle delentel delelnet delelnte delelent deleletn delelten
deleltne deletnle deletnel deletlne deletlen deleteln deletenl deltelne deltelen deltenle deltenel
delteenl delteeln deltlene deltleen deltlnee deltlnee deltlene deltleen deltnlee deltnlee deltnele
deltneel deltneel deltnele deltelne deltelen deltenle deltenel delteenl delteeln deletlne deletlen
deletnle deletnel deletenl deleteln deleltne delelten delelnte delelnet delelent deleletn delenlte
delenlet delentle delentel delenetl delenelt deleelnt deleeltn deleenlt deleentl deleetnl deleetln
delletne delleten dellente dellenet delleent delleetn delltene dellteen delltnee delltnee delltene
dellteen dellntee dellntee dellnete dellneet dellneet dellnete delletne delleten dellente dellenet
delleent delleetn delnelte delnelet delnetle delnetel delneetl delneelt delnlete delnleet delnltee
delnltee delnlete delnleet delntlee delntlee delntele delnteel delnteel delntele delnelte delnelet
delnetle delnetel delneetl delneelt deleelnt deleeltn deleenlt deleentl deleetnl deleetln delelent
deleletn delelnet delelnte deleltne delelten delenlet delenlte delenelt delenetl delentel delentle
deletlne deletlen deletnle deletnel deletenl deleteln deetelln deetelnl deetelln deetelnl deetenll
deetenll deetleln deetlenl deetllen deetllne deetlnle deetlnel deetllen deetllne deetleln deetlenl
deetlnel deetlnle deetnlle deetnlel deetnlle deetnlel deetnell deetnell deeetlln deeetlnl deeetlln
deeetlnl deeetnll deeetnll deeeltln deeeltnl deeelltn deeellnt deeelnlt deeelntl deeelltn deeellnt
deeeltln deeeltnl deeelntl deeelnlt deeenllt deeenltl deeenllt deeenltl deeentll deeentll deeletln
deeletnl deeleltn deelelnt deelenlt deelentl deelteln deeltenl deeltlen deeltlne deeltnle deeltnel
deellten deelltne deelletn deellent deellnet deellnte deelntle deelntel deelnlte deelnlet deelnelt
deelnetl deeleltn deelelnt deeletln deeletnl deelentl deelenlt deelletn deellent deellten deelltne
deellnte deellnet deeltlen deeltlne deelteln deeltenl deeltnel deeltnle deelnlte deelnlet deelntle
deelntel deelnetl deelnelt deenellt deeneltl deenellt deeneltl deenetll deenetll deenlelt deenletl
deenllet deenllte deenltle deenltel deenllet deenllte deenlelt deenletl deenltel deenltle deentlle
deentlel deentlle deentlel deentell deentell dnetelle dnetelel dnetelle dnetelel dneteell dneteell
dnetlele dnetleel dnetllee dnetllee dnetlele dnetleel dnetllee dnetllee dnetlele dnetleel dnetleel
dnetlele dnetelle dnetelel dnetelle dnetelel dneteell dneteell dneetlle dneetlel dneetlle dneetlel
dneetell dneetell dneeltle dneeltel dneellte dneellet dneelelt dneeletl dneellte dneellet dneeltle
dneeltel dneeletl dneelelt dneeellt dneeeltl dneeellt dneeeltl dneeetll dneeetll dneletle dneletel
dnelelte dnelelet dneleelt dneleetl dneltele dnelteel dneltlee dneltlee dneltele dnelteel dnelltee
dnelltee dnellete dnelleet dnelleet dnellete dneletle dneletel dnelelte dnelelet dneleelt dneleetl
dnelelte dnelelet dneletle dneletel dneleetl dneleelt dnellete dnelleet dnelltee dnelltee dnellete
dnelleet dneltlee dneltlee dneltele dnelteel dnelteel dneltele dnelelte dnelelet dneletle dneletel
dneleetl dneleelt dneeellt dneeeltl dneeellt dneeeltl dneeetll dneeetll dneelelt dneeletl dneellet
dneellte dneeltle dneeltel dneellet dneellte dneelelt dneeletl dneeltel dneeltle dneetlle dneetlel
dneetlle dneetlel dneetell dneetell dnteelle dnteelel dnteelle dnteelel dnteeell dnteeell dntelele
dnteleel dntellee dntellee dntelele dnteleel dntellee dntellee dntelele dnteleel dnteleel dntelele
dnteelle dnteelel dnteelle dnteelel dnteeell dnteeell dnteelle dnteelel dnteelle dnteelel dnteeell
dnteeell dntelele dnteleel dntellee dntellee dntelele dnteleel dntellee dntellee dntelele dnteleel
dnteleel dntelele dnteelle dnteelel dnteelle dnteelel dnteeell dnteeell dntleele dntleeel dntlelee
dntlelee dntleele dntleeel dntleele dntleeel dntlelee dntlelee dntleele dntleeel dntlleee dntlleee
dntlleee dntlleee dntlleee dntlleee dntleele dntleeel dntlelee dntlelee dntleele dntleeel dntlelee
dntlelee dntleele dntleeel dntleeel dntleele dntlleee dntlleee dntlleee dntlleee dntlleee dntlleee
dntlelee dntlelee dntleele dntleeel dntleeel dntleele dntlelee dntlelee dntleele dntleeel dntleeel
dntleele dnteelle dnteelel dnteelle dnteelel dnteeell dnteeell dntelele dnteleel dntellee dntellee
dntelele dnteleel dntellee dntellee dntelele dnteleel dnteleel dntelele dnteelle dnteelel dnteelle
dnteelel dnteeell dnteeell dnetelle dnetelel dnetelle dnetelel dneteell dneteell dnetlele dnetleel
dnetllee dnetllee dnetlele dnetleel dnetllee dnetllee dnetlele dnetleel dnetleel dnetlele dnetelle
dnetelel dnetelle dnetelel dneteell dneteell dneetlle dneetlel dneetlle dneetlel dneetell dneetell
dneeltle dneeltel dneellte dneellet dneelelt dneeletl dneellte dneellet dneeltle dneeltel dneeletl
dneelelt dneeellt dneeeltl dneeellt dneeeltl dneeetll dneeetll dneletle dneletel dnelelte dnelelet
dneleelt dneleetl dneltele dnelteel dneltlee dneltlee dneltele dnelteel dnelltee dnelltee dnellete
dnelleet dnelleet dnellete dneletle dneletel dnelelte dnelelet dneleelt dneleetl dnelelte dnelelet
dneletle dneletel dneleetl dneleelt dnellete dnelleet dnelltee dnelltee dnellete dnelleet dneltlee
dneltlee dneltele dnelteel dnelteel dneltele dnelelte dnelelet dneletle dneletel dneleetl dneleelt
dneeellt dneeeltl dneeellt dneeeltl dneeetll dneeetll dneelelt dneeletl dneellet dneellte dneeltle
dneeltel dneellet dneellte dneelelt dneeletl dneeltel dneeltle dneetlle dneetlel dneetlle dneetlel
dneetell dneetell dnlteele dnlteeel dnltelee dnltelee dnlteele dnlteeel dnlteele dnlteeel dnltelee
dnltelee dnlteele dnlteeel dnltleee dnltleee dnltleee dnltleee dnltleee dnltleee dnlteele dnlteeel
dnltelee dnltelee dnlteele dnlteeel dnletele dnleteel dnletlee dnletlee dnletele dnleteel dnleetle
dnleetel dnleelte dnleelet dnleeelt dnleeetl dnlelete dnleleet dnleltee dnleltee dnlelete dnleleet
dnleeelt dnleeetl dnleelet dnleelte dnleetle dnleetel dnleetle dnleetel dnleelte dnleelet dnleeelt
dnleeetl dnletele dnleteel dnletlee dnletlee dnletele dnleteel dnleltee dnleltee dnlelete dnleleet
dnleleet dnlelete dnleetle dnleetel dnleelte dnleelet dnleeelt dnleeetl dnlleete dnlleeet dnlletee
dnlletee dnlleete dnlleeet dnlleete dnlleeet dnlletee dnlletee dnlleete dnlleeet dnllteee dnllteee
dnllteee dnllteee dnllteee dnllteee dnlleete dnlleeet dnlletee dnlletee dnlleete dnlleeet dnleeelt
dnleeetl dnleelet dnleelte dnleetle dnleetel dnleeelt dnleeetl dnleelet dnleelte dnleetle dnleetel
dnleleet dnlelete dnleleet dnlelete dnleltee dnleltee dnletele dnleteel dnletlee dnletlee dnletele
dnleteel dnltelee dnltelee dnlteele dnlteeel dnlteeel dnlteele dnltleee dnltleee dnltleee dnltleee
dnltleee dnltleee dnltelee dnltelee dnlteele dnlteeel dnlteeel dnlteele dnltelee dnltelee dnlteele
dnlteeel dnlteeel dnlteele dnletlee dnletlee dnletele dnleteel dnleteel dnletele dnleltee dnleltee
dnlelete dnleleet dnleleet dnlelete dnleelte dnleelet dnleetle dnleetel dnleeetl dnleeelt dnleelet
dnleelte dnleeelt dnleeetl dnleetel dnleetle dnlletee dnlletee dnlleete dnlleeet dnlleeet dnlleete
dnllteee dnllteee dnllteee dnllteee dnllteee dnllteee dnlletee dnlletee dnlleete dnlleeet dnlleeet
dnlleete dnlletee dnlletee dnlleete dnlleeet dnlleeet dnlleete dnleelte dnleelet dnleetle dnleetel
dnleeetl dnleeelt dnlelete dnleleet dnleltee dnleltee dnlelete dnleleet dnletlee dnletlee dnletele
dnleteel dnleteel dnletele dnleelte dnleelet dnleetle dnleetel dnleeetl dnleeelt dnleelet dnleelte
dnleeelt dnleeetl dnleetel dnleetle dnleleet dnlelete dnleleet dnlelete dnleltee dnleltee dnleelet
dnleelte dnleeelt dnleeetl dnleetel dnleetle dnletlee dnletlee dnletele dnleteel dnleteel dnletele
dnetelle dnetelel dnetelle dnetelel dneteell dneteell dnetlele dnetleel dnetllee dnetllee dnetlele
dnetleel dnetllee dnetllee dnetlele dnetleel dnetleel dnetlele dnetelle dnetelel dnetelle dnetelel
dneteell dneteell dneetlle dneetlel dneetlle dneetlel dneetell dneetell dneeltle dneeltel dneellte
dneellet dneelelt dneeletl dneellte dneellet dneeltle dneeltel dneeletl dneelelt dneeellt dneeeltl
dneeellt dneeeltl dneeetll dneeetll dneletle dneletel dnelelte dnelelet dneleelt dneleetl dneltele
dnelteel dneltlee dneltlee dneltele dnelteel dnelltee dnelltee dnellete dnelleet dnelleet dnellete
dneletle dneletel dnelelte dnelelet dneleelt dneleetl dnelelte dnelelet dneletle dneletel dneleetl
dneleelt dnellete dnelleet dnelltee dnelltee dnellete dnelleet dneltlee dneltlee dneltele dnelteel
dnelteel dneltele dnelelte dnelelet dneletle dneletel dneleetl dneleelt dneeellt dneeeltl dneeellt
dneeeltl dneeetll dneeetll dneelelt dneeletl dneellet dneellte dneeltle dneeltel dneellet dneellte
dneelelt dneeletl dneeltel dneeltle dneetlle dneetlel dneetlle dneetlel dneetell dneetell dtneelle
dtneelel dtneelle dtneelel dtneeell dtneeell dtnelele dtneleel dtnellee dtnellee dtnelele dtneleel
dtnellee dtnellee dtnelele dtneleel dtneleel dtnelele dtneelle dtneelel dtneelle dtneelel dtneeell
dtneeell dtneelle dtneelel dtneelle dtneelel dtneeell dtneeell dtnelele dtneleel dtnellee dtnellee
dtnelele dtneleel dtnellee dtnellee dtnelele dtneleel dtneleel dtnelele dtneelle dtneelel dtneelle
dtneelel dtneeell dtneeell dtnleele dtnleeel dtnlelee dtnlelee dtnleele dtnleeel dtnleele dtnleeel
dtnlelee dtnlelee dtnleele dtnleeel dtnlleee dtnlleee dtnlleee dtnlleee dtnlleee dtnlleee dtnleele
dtnleeel dtnlelee dtnlelee dtnleele dtnleeel dtnlelee dtnlelee dtnleele dtnleeel dtnleeel dtnleele
dtnlleee dtnlleee dtnlleee dtnlleee dtnlleee dtnlleee dtnlelee dtnlelee dtnleele dtnleeel dtnleeel
dtnleele dtnlelee dtnlelee dtnleele dtnleeel dtnleeel dtnleele dtneelle dtneelel dtneelle dtneelel
dtneeell dtneeell dtnelele dtneleel dtnellee dtnellee dtnelele dtneleel dtnellee dtnellee dtnelele
dtneleel dtneleel dtnelele dtneelle dtneelel dtneelle dtneelel dtneeell dtneeell dtenelle dtenelel
dtenelle dtenelel dteneell dteneell dtenlele dtenleel dtenllee dtenllee dtenlele dtenleel dtenllee
dtenllee dtenlele dtenleel dtenleel dtenlele dtenelle dtenelel dtenelle dtenelel dteneell dteneell
dteenlle dteenlel dteenlle dteenlel dteenell dteenell dteelnle dteelnel dteellne dteellen dteeleln
dteelenl dteellne dteellen dteelnle dteelnel dteelenl dteeleln dteeelln dteeelnl dteeelln dteeelnl
dteeenll dteeenll dtelenle dtelenel dtelelne dtelelen dteleeln dteleenl dtelnele dtelneel dtelnlee
dtelnlee dtelnele dtelneel dtellnee dtellnee dtellene dtelleen dtelleen dtellene dtelenle dtelenel
dtelelne dtelelen dteleeln dteleenl dtelelne dtelelen dtelenle dtelenel dteleenl dteleeln dtellene
dtelleen dtellnee dtellnee dtellene dtelleen dtelnlee dtelnlee dtelnele dtelneel dtelneel dtelnele
dtelelne dtelelen dtelenle dtelenel dteleenl dteleeln dteeelln dteeelnl dteeelln dteeelnl dteeenll
dteeenll dteeleln dteelenl dteellen dteellne dteelnle dteelnel dteellen dteellne dteeleln dteelenl
dteelnel dteelnle dteenlle dteenlel dteenlle dteenlel dteenell dteenell dteenlle dteenlel dteenlle
dteenlel dteenell dteenell dteelnle dteelnel dteellne dteellen dteeleln dteelenl dteellne dteellen
dteelnle dteelnel dteelenl dteeleln dteeelln dteeelnl dteeelln dteeelnl dteeenll dteeenll dtenelle
dtenelel dtenelle dtenelel dteneell dteneell dtenlele dtenleel dtenllee dtenllee dtenlele dtenleel
dtenllee dtenllee dtenlele dtenleel dtenleel dtenlele dtenelle dtenelel dtenelle dtenelel dteneell
dteneell dtelnele dtelneel dtelnlee dtelnlee dtelnele dtelneel dtelenle dtelenel dtelelne dtelelen
dteleeln dteleenl dtellene dtelleen dtellnee dtellnee dtellene dtelleen dteleeln dteleenl dtelelen
dtelelne dtelenle dtelenel dtelnlee dtelnlee dtelnele dtelneel dtelneel dtelnele dtellnee dtellnee
dtellene dtelleen dtelleen dtellene dtelelne dtelelen dtelenle dtelenel dteleenl dteleeln dtelelen
dtelelne dteleeln dteleenl dtelenel dtelenle dteenlle dteenlel dteenlle dteenlel dteenell dteenell
dteelnle dteelnel dteellne dteellen dteeleln dteelenl dteellne dteellen dteelnle dteelnel dteelenl
dteeleln dteeelln dteeelnl dteeelln dteeelnl dteeenll dteeenll dtleenle dtleenel dtleelne dtleelen
dtleeeln dtleeenl dtlenele dtleneel dtlenlee dtlenlee dtlenele dtleneel dtlelnee dtlelnee dtlelene
dtleleen dtleleen dtlelene dtleenle dtleenel dtleelne dtleelen dtleeeln dtleeenl dtleenle dtleenel
dtleelne dtleelen dtleeeln dtleeenl dtlenele dtleneel dtlenlee dtlenlee dtlenele dtleneel dtlelnee
dtlelnee dtlelene dtleleen dtleleen dtlelene dtleenle dtleenel dtleelne dtleelen dtleeeln dtleeenl
dtlneele dtlneeel dtlnelee dtlnelee dtlneele dtlneeel dtlneele dtlneeel dtlnelee dtlnelee dtlneele
dtlneeel dtlnleee dtlnleee dtlnleee dtlnleee dtlnleee dtlnleee dtlneele dtlneeel dtlnelee dtlnelee
dtlneele dtlneeel dtllenee dtllenee dtlleene dtlleeen dtlleeen dtlleene dtllneee dtllneee dtllneee
dtllneee dtllneee dtllneee dtllenee dtllenee dtlleene dtlleeen dtlleeen dtlleene dtllenee dtllenee
dtlleene dtlleeen dtlleeen dtlleene dtleenle dtleenel dtleelne dtleelen dtleeeln dtleeenl dtlenele
dtleneel dtlenlee dtlenlee dtlenele dtleneel dtlelnee dtlelnee dtlelene dtleleen dtleleen dtlelene
dtleenle dtleenel dtleelne dtleelen dtleeeln dtleeenl dtleelne dtleelen dtleenle dtleenel dtleeenl
dtleeeln dtlelene dtleleen dtlelnee dtlelnee dtlelene dtleleen dtlenlee dtlenlee dtlenele dtleneel
dtleneel dtlenele dtleelne dtleelen dtleenle dtleenel dtleeenl dtleeeln dtleelne dtleelen dtleenle
dtleenel dtleeenl dtleeeln dtlelene dtleleen dtlelnee dtlelnee dtlelene dtleleen dtlenlee dtlenlee
dtlenele dtleneel dtleneel dtlenele dtleelne dtleelen dtleenle dtleenel dtleeenl dtleeeln dtlleene
dtlleeen dtllenee dtllenee dtlleene dtlleeen dtlleene dtlleeen dtllenee dtllenee dtlleene dtlleeen
dtllneee dtllneee dtllneee dtllneee dtllneee dtllneee dtlleene dtlleeen dtllenee dtllenee dtlleene
dtlleeen dtlnelee dtlnelee dtlneele dtlneeel dtlneeel dtlneele dtlnleee dtlnleee dtlnleee dtlnleee
dtlnleee dtlnleee dtlnelee dtlnelee dtlneele dtlneeel dtlneeel dtlneele dtlnelee dtlnelee dtlneele
dtlneeel dtlneeel dtlneele dtleelne dtleelen dtleenle dtleenel dtleeenl dtleeeln dtlelene dtleleen
dtlelnee dtlelnee dtlelene dtleleen dtlenlee dtlenlee dtlenele dtleneel dtleneel dtlenele dtleelne
dtleelen dtleenle dtleenel dtleeenl dtleeeln dteeelln dteeelnl dteeelln dteeelnl dteeenll dteeenll
dteeleln dteelenl dteellen dteellne dteelnle dteelnel dteellen dteellne dteeleln dteelenl dteelnel
dteelnle dteenlle dteenlel dteenlle dteenlel dteenell dteenell dteeelln dteeelnl dteeelln dteeelnl
dteeenll dteeenll dteeleln dteelenl dteellen dteellne dteelnle dteelnel dteellen dteellne dteeleln
dteelenl dteelnel dteelnle dteenlle dteenlel dteenlle dteenlel dteenell dteenell dteleeln dteleenl
dtelelen dtelelne dtelenle dtelenel dteleeln dteleenl dtelelen dtelelne dtelenle dtelenel dtelleen
dtellene dtelleen dtellene dtellnee dtellnee dtelnele dtelneel dtelnlee dtelnlee dtelnele dtelneel
dtelelen dtelelne dteleeln dteleenl dtelenel dtelenle dtelleen dtellene dtelleen dtellene dtellnee
dtellnee dtelelen dtelelne dteleeln dteleenl dtelenel dtelenle dtelnlee dtelnlee dtelnele dtelneel
dtelneel dtelnele dtenelle dtenelel dtenelle dtenelel dteneell dteneell dtenlele dtenleel dtenllee
dtenllee dtenlele dtenleel dtenllee dtenllee dtenlele dtenleel dtenleel dtenlele dtenelle dtenelel
dtenelle dtenelel dteneell dteneell dentelle dentelel dentelle dentelel denteell denteell dentlele
dentleel dentllee dentllee dentlele dentleel dentllee dentllee dentlele dentleel dentleel dentlele
dentelle dentelel dentelle dentelel denteell denteell denetlle denetlel denetlle denetlel denetell
denetell deneltle deneltel denellte denellet denelelt deneletl denellte denellet deneltle deneltel
deneletl denelelt deneellt deneeltl deneellt deneeltl deneetll deneetll denletle denletel denlelte
denlelet denleelt denleetl denltele denlteel denltlee denltlee denltele denlteel denlltee denlltee
denllete denlleet denlleet denllete denletle denletel denlelte denlelet denleelt denleetl denlelte
denlelet denletle denletel denleetl denleelt denllete denlleet denlltee denlltee denllete denlleet
denltlee denltlee denltele denlteel denlteel denltele denlelte denlelet denletle denletel denleetl
denleelt deneellt deneeltl deneellt deneeltl deneetll deneetll denelelt deneletl denellet denellte
deneltle deneltel denellet denellte denelelt deneletl deneltel deneltle denetlle denetlel denetlle
denetlel denetell denetell detnelle detnelel detnelle detnelel detneell detneell detnlele detnleel
detnllee detnllee detnlele detnleel detnllee detnllee detnlele detnleel detnleel detnlele detnelle
detnelel detnelle detnelel detneell detneell detenlle detenlel detenlle detenlel detenell detenell
detelnle detelnel detellne detellen deteleln detelenl detellne detellen detelnle detelnel detelenl
deteleln deteelln deteelnl deteelln deteelnl deteenll deteenll detlenle detlenel detlelne detlelen
detleeln detleenl detlnele detlneel detlnlee detlnlee detlnele detlneel detllnee detllnee detllene
detlleen detlleen detllene detlenle detlenel detlelne detlelen detleeln detleenl detlelne detlelen
detlenle detlenel detleenl detleeln detllene detlleen detllnee detllnee detllene detlleen detlnlee
detlnlee detlnele detlneel detlneel detlnele detlelne detlelen detlenle detlenel detleenl detleeln
deteelln deteelnl deteelln deteelnl deteenll deteenll deteleln detelenl detellen detellne detelnle
detelnel detellen detellne deteleln detelenl detelnel detelnle detenlle detenlel detenlle detenlel
detenell detenell deetnlle deetnlel deetnlle deetnlel deetnell deetnell deetlnle deetlnel deetllne
deetllen deetleln deetlenl deetllne deetllen deetlnle deetlnel deetlenl deetleln deetelln deetelnl
deetelln deetelnl deetenll deetenll deentlle deentlel deentlle deentlel deentell deentell deenltle
deenltel deenllte deenllet deenlelt deenletl deenllte deenllet deenltle deenltel deenletl deenlelt
deenellt deeneltl deenellt deeneltl deenetll deenetll deelntle deelntel deelnlte deelnlet deelnelt
deelnetl deeltnle deeltnel deeltlne deeltlen deelteln deeltenl deelltne deellten deellnte deellnet
deellent deelletn deeletln deeletnl deeleltn deelelnt deelenlt deelentl deelnlte deelnlet deelntle
deelntel deelnetl deelnelt deellnte deellnet deelltne deellten deelletn deellent deeltlne deeltlen
deeltnle deeltnel deeltenl deelteln deeleltn deelelnt deeletln deeletnl deelentl deelenlt deeenllt
deeenltl deeenllt deeenltl deeentll deeentll deeelnlt deeelntl deeellnt deeelltn deeeltln deeeltnl
deeellnt deeelltn deeelnlt deeelntl deeeltnl deeeltln deeetlln deeetlnl deeetlln deeetlnl deeetnll
deeetnll deltenle deltenel deltelne deltelen delteeln delteenl deltnele deltneel deltnlee deltnlee
deltnele deltneel deltlnee deltlnee deltlene deltleen deltleen deltlene deltenle deltenel deltelne
deltelen delteeln delteenl deletnle deletnel deletlne deletlen deleteln deletenl delentle delentel
delenlte delenlet delenelt delenetl delelnte delelnet deleltne delelten deleletn delelent deleenlt
deleentl deleelnt deleeltn deleetln deleetnl delnetle delnetel delnelte delnelet delneelt delneetl
delntele delnteel delntlee delntlee delntele delnteel delnltee delnltee delnlete delnleet delnleet
delnlete delnetle delnetel delnelte delnelet delneelt delneetl dellente dellenet delletne delleten
delleetn delleent dellnete dellneet dellntee dellntee dellnete dellneet delltnee delltnee delltene
dellteen dellteen delltene dellente dellenet delletne delleten delleetn delleent deleenlt deleentl
deleelnt deleeltn deleetln deleetnl delenelt delenetl delenlet delenlte delentle delentel delelnet
delelnte delelent deleletn delelten deleltne deletnle deletnel deletlne deletlen deleteln deletenl
deltelne deltelen deltenle deltenel delteenl delteeln deltlene deltleen deltlnee deltlnee deltlene
deltleen deltnlee deltnlee deltnele deltneel deltneel deltnele deltelne deltelen deltenle deltenel
delteenl delteeln deletlne deletlen deletnle deletnel deletenl deleteln deleltne delelten delelnte
delelnet delelent deleletn delenlte delenlet delentle delentel delenetl delenelt deleelnt deleeltn
deleenlt deleentl deleetnl deleetln delletne delleten dellente dellenet delleent delleetn delltene
dellteen delltnee delltnee delltene dellteen dellntee dellntee dellnete dellneet dellneet dellnete
delletne delleten dellente dellenet delleent delleetn delnelte delnelet delnetle delnetel delneetl
delneelt delnlete delnleet delnltee delnltee delnlete delnleet delntlee delntlee delntele delnteel
delnteel delntele delnelte delnelet delnetle delnetel delneetl delneelt deleelnt deleeltn deleenlt
deleentl deleetnl deleetln delelent deleletn delelnet delelnte deleltne delelten delenlet delenlte
delenelt delenetl delentel delentle deletlne deletlen deletnle deletnel deletenl deleteln deetelln
deetelnl deetelln deetelnl deetenll deetenll deetleln deetlenl deetllen deetllne deetlnle deetlnel
deetllen deetllne deetleln deetlenl deetlnel deetlnle deetnlle deetnlel deetnlle deetnlel deetnell
deetnell deeetlln deeetlnl deeetlln deeetlnl deeetnll deeetnll deeeltln deeeltnl deeelltn deeellnt
deeelnlt deeelntl deeelltn deeellnt deeeltln deeeltnl deeelntl deeelnlt deeenllt deeenltl deeenllt
deeenltl deeentll deeentll deeletln deeletnl deeleltn deelelnt deelenlt deelentl deelteln deeltenl
deeltlen deeltlne deeltnle deeltnel deellten deelltne deelletn deellent deellnet deellnte deelntle
deelntel deelnlte deelnlet deelnelt deelnetl deeleltn deelelnt deeletln deeletnl deelentl deelenlt
deelletn deellent deellten deelltne deellnte deellnet deeltlen deeltlne deelteln deeltenl deeltnel
deeltnle deelnlte deelnlet deelntle deelntel deelnetl deelnelt deenellt deeneltl deenellt deeneltl
deenetll deenetll deenlelt deenletl deenllet deenllte deenltle deenltel deenllet deenllte deenlelt
deenletl deenltel deenltle deentlle deentlel deentlle deentlel deentell deentell dlnteele dlnteeel
dlntelee dlntelee dlnteele dlnteeel dlnteele dlnteeel dlntelee dlntelee dlnteele dlnteeel dlntleee
dlntleee dlntleee dlntleee dlntleee dlntleee dlnteele dlnteeel dlntelee dlntelee dlnteele dlnteeel
dlnetele dlneteel dlnetlee dlnetlee dlnetele dlneteel dlneetle dlneetel dlneelte dlneelet dlneeelt
dlneeetl dlnelete dlneleet dlneltee dlneltee dlnelete dlneleet dlneeelt dlneeetl dlneelet dlneelte
dlneetle dlneetel dlneetle dlneetel dlneelte dlneelet dlneeelt dlneeetl dlnetele dlneteel dlnetlee
dlnetlee dlnetele dlneteel dlneltee dlneltee dlnelete dlneleet dlneleet dlnelete dlneetle dlneetel
dlneelte dlneelet dlneeelt dlneeetl dlnleete dlnleeet dlnletee dlnletee dlnleete dlnleeet dlnleete
dlnleeet dlnletee dlnletee dlnleete dlnleeet dlnlteee dlnlteee dlnlteee dlnlteee dlnlteee dlnlteee
dlnleete dlnleeet dlnletee dlnletee dlnleete dlnleeet dlneeelt dlneeetl dlneelet dlneelte dlneetle
dlneetel dlneeelt dlneeetl dlneelet dlneelte dlneetle dlneetel dlneleet dlnelete dlneleet dlnelete
dlneltee dlneltee dlnetele dlneteel dlnetlee dlnetlee dlnetele dlneteel dltneele dltneeel dltnelee
dltnelee dltneele dltneeel dltneele dltneeel dltnelee dltnelee dltneele dltneeel dltnleee dltnleee
dltnleee dltnleee dltnleee dltnleee dltneele dltneeel dltnelee dltnelee dltneele dltneeel dltenele
dlteneel dltenlee dltenlee dltenele dlteneel dlteenle dlteenel dlteelne dlteelen dlteeeln dlteeenl
dltelene dlteleen dltelnee dltelnee dltelene dlteleen dlteeeln dlteeenl dlteelen dlteelne dlteenle
dlteenel dlteenle dlteenel dlteelne dlteelen dlteeeln dlteeenl dltenele dlteneel dltenlee dltenlee
dltenele dlteneel dltelnee dltelnee dltelene dlteleen dlteleen dltelene dlteenle dlteenel dlteelne
dlteelen dlteeeln dlteeenl dltleene dltleeen dltlenee dltlenee dltleene dltleeen dltleene dltleeen
dltlenee dltlenee dltleene dltleeen dltlneee dltlneee dltlneee dltlneee dltlneee dltlneee dltleene
dltleeen dltlenee dltlenee dltleene dltleeen dlteeeln dlteeenl dlteelen dlteelne dlteenle dlteenel
dlteeeln dlteeenl dlteelen dlteelne dlteenle dlteenel dlteleen dltelene dlteleen dltelene dltelnee
dltelnee dltenele dlteneel dltenlee dltenlee dltenele dlteneel dletnele dletneel dletnlee dletnlee
dletnele dletneel dletenle dletenel dletelne dletelen dleteeln dleteenl dletlene dletleen dletlnee
dletlnee dletlene dletleen dleteeln dleteenl dletelen dletelne dletenle dletenel dlentele dlenteel
dlentlee dlentlee dlentele dlenteel dlenetle dlenetel dlenelte dlenelet dleneelt dleneetl dlenlete
dlenleet dlenltee dlenltee dlenlete dlenleet dleneelt dleneetl dlenelet dlenelte dlenetle dlenetel
dleentle dleentel dleenlte dleenlet dleenelt dleenetl dleetnle dleetnel dleetlne dleetlen dleeteln
dleetenl dleeltne dleelten dleelnte dleelnet dleelent dleeletn dleeetln dleeetnl dleeeltn dleeelnt
dleeenlt dleeentl dlelnete dlelneet dlelntee dlelntee dlelnete dlelneet dlelente dlelenet dleletne
dleleten dleleetn dleleent dleltene dlelteen dleltnee dleltnee dleltene dlelteen dleleetn dleleent
dleleten dleletne dlelente dlelenet dleenelt dleenetl dleenlet dleenlte dleentle dleentel dleeenlt
dleeentl dleeelnt dleeeltn dleeetln dleeetnl dleelent dleeletn dleelnet dleelnte dleeltne dleelten
dleeteln dleetenl dleetlen dleetlne dleetnle dleetnel dletenle dletenel dletelne dletelen dleteeln
dleteenl dletnele dletneel dletnlee dletnlee dletnele dletneel dletlnee dletlnee dletlene dletleen
dletleen dletlene dletenle dletenel dletelne dletelen dleteeln dleteenl dleetnle dleetnel dleetlne
dleetlen dleeteln dleetenl dleentle dleentel dleenlte dleenlet dleenelt dleenetl dleelnte dleelnet
dleeltne dleelten dleeletn dleelent dleeenlt dleeentl dleeelnt dleeeltn dleeetln dleeetnl dlenetle
dlenetel dlenelte dlenelet dleneelt dleneetl dlentele dlenteel dlentlee dlentlee dlentele dlenteel
dlenltee dlenltee dlenlete dlenleet dlenleet dlenlete dlenetle dlenetel dlenelte dlenelet dleneelt
dleneetl dlelente dlelenet dleletne dleleten dleleetn dleleent dlelnete dlelneet dlelntee dlelntee
dlelnete dlelneet dleltnee dleltnee dleltene dlelteen dlelteen dleltene dlelente dlelenet dleletne
dleleten dleleetn dleleent dleeenlt dleeentl dleeelnt dleeeltn dleeetln dleeetnl dleenelt dleenetl
dleenlet dleenlte dleentle dleentel dleelnet dleelnte dleelent dleeletn dleelten dleeltne dleetnle
dleetnel dleetlne dleetlen dleeteln dleetenl dllteene dllteeen dlltenee dlltenee dllteene dllteeen
dllteene dllteeen dlltenee dlltenee dllteene dllteeen dlltneee dlltneee dlltneee dlltneee dlltneee
dlltneee dllteene dllteeen dlltenee dlltenee dllteene dllteeen dlletene dlleteen dlletnee dlletnee
dlletene dlleteen dlleetne dlleeten dlleente dlleenet dlleeent dlleeetn dllenete dlleneet dllentee
dllentee dllenete dlleneet dlleeent dlleeetn dlleenet dlleente dlleetne dlleeten dlleetne dlleeten
dlleente dlleenet dlleeent dlleeetn dlletene dlleteen dlletnee dlletnee dlletene dlleteen dllentee
dllentee dllenete dlleneet dlleneet dllenete dlleetne dlleeten dlleente dlleenet dlleeent dlleeetn
dllneete dllneeet dllnetee dllnetee dllneete dllneeet dllneete dllneeet dllnetee dllnetee dllneete
dllneeet dllnteee dllnteee dllnteee dllnteee dllnteee dllnteee dllneete dllneeet dllnetee dllnetee
dllneete dllneeet dlleeent dlleeetn dlleenet dlleente dlleetne dlleeten dlleeent dlleeetn dlleenet
dlleente dlleetne dlleeten dlleneet dllenete dlleneet dllenete dllentee dllentee dlletene dlleteen
dlletnee dlletnee dlletene dlleteen dleteeln dleteenl dletelen dletelne dletenle dletenel dleteeln
dleteenl dletelen dletelne dletenle dletenel dletleen dletlene dletleen dletlene dletlnee dletlnee
dletnele dletneel dletnlee dletnlee dletnele dletneel dleeteln dleetenl dleetlen dleetlne dleetnle
dleetnel dleeetln dleeetnl dleeeltn dleeelnt dleeenlt dleeentl dleeletn dleelent dleelten dleeltne
dleelnte dleelnet dleenelt dleenetl dleenlet dleenlte dleentle dleentel dleeetln dleeetnl dleeeltn
dleeelnt dleeenlt dleeentl dleeteln dleetenl dleetlen dleetlne dleetnle dleetnel dleelten dleeltne
dleeletn dleelent dleelnet dleelnte dleentle dleentel dleenlte dleenlet dleenelt dleenetl dleleetn
dleleent dleleten dleletne dlelente dlelenet dleleetn dleleent dleleten dleletne dlelente dlelenet
dlelteen dleltene dlelteen dleltene dleltnee dleltnee dlelnete dlelneet dlelntee dlelntee dlelnete
dlelneet dleneelt dleneetl dlenelet dlenelte dlenetle dlenetel dleneelt dleneetl dlenelet dlenelte
dlenetle dlenetel dlenleet dlenlete dlenleet dlenlete dlenltee dlenltee dlentele dlenteel dlentlee
dlentlee dlentele dlenteel dlntelee dlntelee dlnteele dlnteeel dlnteeel dlnteele dlntleee dlntleee
dlntleee dlntleee dlntleee dlntleee dlntelee dlntelee dlnteele dlnteeel dlnteeel dlnteele dlntelee
dlntelee dlnteele dlnteeel dlnteeel dlnteele dlnetlee dlnetlee dlnetele dlneteel dlneteel dlnetele
dlneltee dlneltee dlnelete dlneleet dlneleet dlnelete dlneelte dlneelet dlneetle dlneetel dlneeetl
dlneeelt dlneelet dlneelte dlneeelt dlneeetl dlneetel dlneetle dlnletee dlnletee dlnleete dlnleeet
dlnleeet dlnleete dlnlteee dlnlteee dlnlteee dlnlteee dlnlteee dlnlteee dlnletee dlnletee dlnleete
dlnleeet dlnleeet dlnleete dlnletee dlnletee dlnleete dlnleeet dlnleeet dlnleete dlneelte dlneelet
dlneetle dlneetel dlneeetl dlneeelt dlnelete dlneleet dlneltee dlneltee dlnelete dlneleet dlnetlee
dlnetlee dlnetele dlneteel dlneteel dlnetele dlneelte dlneelet dlneetle dlneetel dlneeetl dlneeelt
dlneelet dlneelte dlneeelt dlneeetl dlneetel dlneetle dlneleet dlnelete dlneleet dlnelete dlneltee
dlneltee dlneelet dlneelte dlneeelt dlneeetl dlneetel dlneetle dlnetlee dlnetlee dlnetele dlneteel
dlneteel dlnetele dltnelee dltnelee dltneele dltneeel dltneeel dltneele dltnleee dltnleee dltnleee
dltnleee dltnleee dltnleee dltnelee dltnelee dltneele dltneeel dltneeel dltneele dltnelee dltnelee
dltneele dltneeel dltneeel dltneele dltenlee dltenlee dltenele dlteneel dlteneel dltenele dltelnee
dltelnee dltelene dlteleen dlteleen dltelene dlteelne dlteelen dlteenle dlteenel dlteeenl dlteeeln
dlteelen dlteelne dlteeeln dlteeenl dlteenel dlteenle dltlenee dltlenee dltleene dltleeen dltleeen
dltleene dltlneee dltlneee dltlneee dltlneee dltlneee dltlneee dltlenee dltlenee dltleene dltleeen
dltleeen dltleene dltlenee dltlenee dltleene dltleeen dltleeen dltleene dlteelne dlteelen dlteenle
dlteenel dlteeenl dlteeeln dltelene dlteleen dltelnee dltelnee dltelene dlteleen dltenlee dltenlee
dltenele dlteneel dlteneel dltenele dlteelne dlteelen dlteenle dlteenel dlteeenl dlteeeln dlteelen
dlteelne dlteeeln dlteeenl dlteenel dlteenle dlteleen dltelene dlteleen dltelene dltelnee dltelnee
dlteelen dlteelne dlteeeln dlteeenl dlteenel dlteenle dltenlee dltenlee dltenele dlteneel dlteneel
dltenele dletnlee dletnlee dletnele dletneel dletneel dletnele dletlnee dletlnee dletlene dletleen
dletleen dletlene dletelne dletelen dletenle dletenel dleteenl dleteeln dletelen dletelne dleteeln
dleteenl dletenel dletenle dlentlee dlentlee dlentele dlenteel dlenteel dlentele dlenltee dlenltee
dlenlete dlenleet dlenleet dlenlete dlenelte dlenelet dlenetle dlenetel dleneetl dleneelt dlenelet
dlenelte dleneelt dleneetl dlenetel dlenetle dlelntee dlelntee dlelnete dlelneet dlelneet dlelnete
dleltnee dleltnee dleltene dlelteen dlelteen dleltene dleletne dleleten dlelente dlelenet dleleent
dleleetn dleleten dleletne dleleetn dleleent dlelenet dlelente dleenlte dleenlet dleentle dleentel
dleenetl dleenelt dleelnte dleelnet dleeltne dleelten dleeletn dleelent dleetlne dleetlen dleetnle
dleetnel dleetenl dleeteln dleeeltn dleeelnt dleeetln dleeetnl dleeentl dleeenlt dleenlet dleenlte
dleenelt dleenetl dleentel dleentle dleelnet dleelnte dleelent dleeletn dleelten dleeltne dleeelnt
dleeeltn dleeenlt dleeentl dleeetnl dleeetln dleetlen dleetlne dleeteln dleetenl dleetnel dleetnle
dlltenee dlltenee dllteene dllteeen dllteeen dllteene dlltneee dlltneee dlltneee dlltneee dlltneee
dlltneee dlltenee dlltenee dllteene dllteeen dllteeen dllteene dlltenee dlltenee dllteene dllteeen
dllteeen dllteene dlletnee dlletnee dlletene dlleteen dlleteen dlletene dllentee dllentee dllenete
dlleneet dlleneet dllenete dlleente dlleenet dlleetne dlleeten dlleeetn dlleeent dlleenet dlleente
dlleeent dlleeetn dlleeten dlleetne dllnetee dllnetee dllneete dllneeet dllneeet dllneete dllnteee
dllnteee dllnteee dllnteee dllnteee dllnteee dllnetee dllnetee dllneete dllneeet dllneeet dllneete
dllnetee dllnetee dllneete dllneeet dllneeet dllneete dlleente dlleenet dlleetne dlleeten dlleeetn
dlleeent dllenete dlleneet dllentee dllentee dllenete dlleneet dlletnee dlletnee dlletene dlleteen
dlleteen dlletene dlleente dlleenet dlleetne dlleeten dlleeetn dlleeent dlleenet dlleente dlleeent
dlleeetn dlleeten dlleetne dlleneet dllenete dlleneet dllenete dllentee dllentee dlleenet dlleente
dlleeent dlleeetn dlleeten dlleetne dlletnee dlletnee dlletene dlleteen dlleteen dlletene dletelne
dletelen dletenle dletenel dleteenl dleteeln dletlene dletleen dletlnee dletlnee dletlene dletleen
dletnlee dletnlee dletnele dletneel dletneel dletnele dletelne dletelen dletenle dletenel dleteenl
dleteeln dleetlne dleetlen dleetnle dleetnel dleetenl dleeteln dleeltne dleelten dleelnte dleelnet
dleelent dleeletn dleenlte dleenlet dleentle dleentel dleenetl dleenelt dleeelnt dleeeltn dleeenlt
dleeentl dleeetnl dleeetln dleletne dleleten dlelente dlelenet dleleent dleleetn dleltene dlelteen
dleltnee dleltnee dleltene dlelteen dlelntee dlelntee dlelnete dlelneet dlelneet dlelnete dleletne
dleleten dlelente dlelenet dleleent dleleetn dlenelte dlenelet dlenetle dlenetel dleneetl dleneelt
dlenlete dlenleet dlenltee dlenltee dlenlete dlenleet dlentlee dlentlee dlentele dlenteel dlenteel
dlentele dlenelte dlenelet dlenetle dlenetel dleneetl dleneelt dleeelnt dleeeltn dleeenlt dleeentl
dleeetnl dleeetln dleelent dleeletn dleelnet dleelnte dleeltne dleelten dleenlet dleenlte dleenelt
dleenetl dleentel dleentle dleetlne dleetlen dleetnle dleetnel dleetenl dleeteln dletelen dletelne
dleteeln dleteenl dletenel dletenle dletleen dletlene dletleen dletlene dletlnee dletlnee dletelen
dletelne dleteeln dleteenl dletenel dletenle dletnlee dletnlee dletnele dletneel dletneel dletnele
dleetlen dleetlne dleeteln dleetenl dleetnel dleetnle dleelten dleeltne dleeletn dleelent dleelnet
dleelnte dleeeltn dleeelnt dleeetln dleeetnl dleeentl dleeenlt dleenlet dleenlte dleenelt dleenetl
dleentel dleentle dleleten dleletne dleleetn dleleent dlelenet dlelente dlelteen dleltene dlelteen
dleltene dleltnee dleltnee dleleten dleletne dleleetn dleleent dlelenet dlelente dlelntee dlelntee
dlelnete dlelneet dlelneet dlelnete dleeeltn dleeelnt dleeetln dleeetnl dleeentl dleeenlt dleeletn
dleelent dleelten dleeltne dleelnte dleelnet dleetlen dleetlne dleeteln dleetenl dleetnel dleetnle
dleenlte dleenlet dleentle dleentel dleenetl dleenelt dlenelet dlenelte dleneelt dleneetl dlenetel
dlenetle dlenleet dlenlete dlenleet dlenlete dlenltee dlenltee dlenelet dlenelte dleneelt dleneetl
dlenetel dlenetle dlentlee dlentlee dlentele dlenteel dlenteel dlentele dentelle dentelel dentelle
dentelel denteell denteell dentlele dentleel dentllee dentllee dentlele dentleel dentllee dentllee
dentlele dentleel dentleel dentlele dentelle dentelel dentelle dentelel denteell denteell denetlle
denetlel denetlle denetlel denetell denetell deneltle deneltel denellte denellet denelelt deneletl
denellte denellet deneltle deneltel deneletl denelelt deneellt deneeltl deneellt deneeltl deneetll
deneetll denletle denletel denlelte denlelet denleelt denleetl denltele denlteel denltlee denltlee
denltele denlteel denlltee denlltee denllete denlleet denlleet denllete denletle denletel denlelte
denlelet denleelt denleetl denlelte denlelet denletle denletel denleetl denleelt denllete denlleet
denlltee denlltee denllete denlleet denltlee denltlee denltele denlteel denlteel denltele denlelte
denlelet denletle denletel denleetl denleelt deneellt deneeltl deneellt deneeltl deneetll deneetll
denelelt deneletl denellet denellte deneltle deneltel denellet denellte denelelt deneletl deneltel
deneltle denetlle denetlel denetlle denetlel denetell denetell detnelle detnelel detnelle detnelel
detneell detneell detnlele detnleel detnllee detnllee detnlele detnleel detnllee detnllee detnlele
detnleel detnleel detnlele detnelle detnelel detnelle detnelel detneell detneell detenlle detenlel
detenlle detenlel detenell detenell detelnle detelnel detellne detellen deteleln detelenl detellne
detellen detelnle detelnel detelenl deteleln deteelln deteelnl deteelln deteelnl deteenll deteenll
detlenle detlenel detlelne detlelen detleeln detleenl detlnele detlneel detlnlee detlnlee detlnele
detlneel detllnee detllnee detllene detlleen detlleen detllene detlenle detlenel detlelne detlelen
detleeln detleenl detlelne detlelen detlenle detlenel detleenl detleeln detllene detlleen detllnee
detllnee detllene detlleen detlnlee detlnlee detlnele detlneel detlneel detlnele detlelne detlelen
detlenle detlenel detleenl detleeln deteelln deteelnl deteelln deteelnl deteenll deteenll deteleln
detelenl detellen detellne detelnle detelnel detellen detellne deteleln detelenl detelnel detelnle
detenlle detenlel detenlle detenlel detenell detenell deetnlle deetnlel deetnlle deetnlel deetnell
deetnell deetlnle deetlnel deetllne deetllen deetleln deetlenl deetllne deetllen deetlnle deetlnel
deetlenl deetleln deetelln deetelnl deetelln deetelnl deetenll deetenll deentlle deentlel deentlle
deentlel deentell deentell deenltle deenltel deenllte deenllet deenlelt deenletl deenllte deenllet
deenltle deenltel deenletl deenlelt deenellt deeneltl deenellt deeneltl deenetll deenetll deelntle
deelntel deelnlte deelnlet deelnelt deelnetl deeltnle deeltnel deeltlne deeltlen deelteln deeltenl
deelltne deellten deellnte deellnet deellent deelletn deeletln deeletnl deeleltn deelelnt deelenlt
deelentl deelnlte deelnlet deelntle deelntel deelnetl deelnelt deellnte deellnet deelltne deellten
deelletn deellent deeltlne deeltlen deeltnle deeltnel deeltenl deelteln deeleltn deelelnt deeletln
deeletnl deelentl deelenlt deeenllt deeenltl deeenllt deeenltl deeentll deeentll deeelnlt deeelntl
deeellnt deeelltn deeeltln deeeltnl deeellnt deeelltn deeelnlt deeelntl deeeltnl deeeltln deeetlln
deeetlnl deeetlln deeetlnl deeetnll deeetnll deltenle deltenel deltelne deltelen delteeln delteenl
deltnele deltneel deltnlee deltnlee deltnele deltneel deltlnee deltlnee deltlene deltleen deltleen
deltlene deltenle deltenel deltelne deltelen delteeln delteenl deletnle deletnel deletlne deletlen
deleteln deletenl delentle delentel delenlte delenlet delenelt delenetl delelnte delelnet deleltne
delelten deleletn delelent deleenlt deleentl deleelnt deleeltn deleetln deleetnl delnetle delnetel
delnelte delnelet delneelt delneetl delntele delnteel delntlee delntlee delntele delnteel delnltee
delnltee delnlete delnleet delnleet delnlete delnetle delnetel delnelte delnelet delneelt delneetl
dellente dellenet delletne delleten delleetn delleent dellnete dellneet dellntee dellntee dellnete
dellneet delltnee delltnee delltene dellteen dellteen delltene dellente dellenet delletne delleten
delleetn delleent deleenlt deleentl deleelnt deleeltn deleetln deleetnl delenelt delenetl delenlet
delenlte delentle delentel delelnet delelnte delelent deleletn delelten deleltne deletnle deletnel
deletlne deletlen deleteln deletenl deltelne deltelen deltenle deltenel delteenl delteeln deltlene
deltleen deltlnee deltlnee deltlene deltleen deltnlee deltnlee deltnele deltneel deltneel deltnele
deltelne deltelen deltenle deltenel delteenl delteeln deletlne deletlen deletnle deletnel deletenl
deleteln deleltne delelten delelnte delelnet delelent deleletn delenlte delenlet delentle delentel
delenetl delenelt deleelnt deleeltn deleenlt deleentl deleetnl deleetln delletne delleten dellente
dellenet delleent delleetn delltene dellteen delltnee delltnee delltene dellteen dellntee dellntee
dellnete dellneet dellneet dellnete delletne delleten dellente dellenet delleent delleetn delnelte
delnelet delnetle delnetel delneetl delneelt delnlete delnleet delnltee delnltee delnlete delnleet
delntlee delntlee delntele delnteel delnteel delntele delnelte delnelet delnetle delnetel delneetl
delneelt deleelnt deleeltn deleenlt deleentl deleetnl deleetln delelent deleletn delelnet delelnte
deleltne delelten delenlet delenlte delenelt delenetl delentel delentle deletlne deletlen deletnle
deletnel deletenl deleteln deetelln deetelnl deetelln deetelnl deetenll deetenll deetleln deetlenl
deetllen deetllne deetlnle deetlnel deetllen deetllne deetleln deetlenl deetlnel deetlnle deetnlle
deetnlel deetnlle deetnlel deetnell deetnell deeetlln deeetlnl deeetlln deeetlnl deeetnll deeetnll
deeeltln deeeltnl deeelltn deeellnt deeelnlt deeelntl deeelltn deeellnt deeeltln deeeltnl deeelntl
deeelnlt deeenllt deeenltl deeenllt deeenltl deeentll deeentll deeletln deeletnl deeleltn deelelnt
deelenlt deelentl deelteln deeltenl deeltlen deeltlne deeltnle deeltnel deellten deelltne deelletn
deellent deellnet deellnte deelntle deelntel deelnlte deelnlet deelnelt deelnetl deeleltn deelelnt
deeletln deeletnl deelentl deelenlt deelletn deellent deellten deelltne deellnte deellnet deeltlen
deeltlne deelteln deeltenl deeltnel deeltnle deelnlte deelnlet deelntle deelntel deelnetl deelnelt
deenellt deeneltl deenellt deeneltl deenetll deenetll deenlelt deenletl deenllet deenllte deenltle
deenltel deenllet deenllte deenlelt deenletl deenltel deenltle deentlle deentlel deentlle deentlel
deentell deentell

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us