easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

trashery

zemel

yokuchi

typotelegraphy

xenopterygian

zhongxiao

xenian

kostecki

untruthfulness

jointureless

yasht

vescum

vinculaque

thiooxidans

vicique

slaydon

withbeat

zorgite


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: dentelated
cipher variations:
efoufmbufe fgpvgncvgf ghqwhodwhg hirxipexih ijsyjqfyji
jktzkrgzkj klualshalk lmvbmtibml mnwcnujcnm noxdovkdon
opyepwlepo pqzfqxmfqp qragryngrq rsbhszohsr stcitapits
tudjubqjut uvekvcrkvu vwflwdslwv wxgmxetmxw xyhnyfunyx
yziozgvozy zajpahwpaz abkqbixqba bclrcjyrcb cdmsdkzsdc

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: dentelated
Cipher: wvmgvozgvw

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: dentelated
Cipher: AAABB AABAA ABBAA BAABA AABAA ABABA AAAAA BAABA AABAA AAABB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: dentelated
cipher variations:
efoufmbufeknognibgnkqvosvebsvqwdoedabedwcloqlwbqlcitoctsbctiujoajkbajuaromrgbmra
gzoyzcbyzgmhokhybkhmspowpubwpsyxoixqbixyfgpvgncvgflophojcholrwptwfctwrxepfebcfex
dmprmxcrmdjupdutcdujvkpbklcbkvbspnshcnsbhapzadczahniplizclintqpxqvcxqtzypjyrcjyz
ghqwhodwhgmpqipkdipmsxquxgduxsyfqgfcdgfyenqsnydsnekvqevudevkwlqclmdclwctqotidotc
ibqabedabiojqmjadmjourqyrwdyruazqkzsdkzahirxipexihnqrjqlejqntyrvyhevytzgrhgdehgz
fortozetoflwrfwvefwlxmrdmnedmxdurpujepudjcrbcfebcjpkrnkbenkpvsrzsxezsvbarlatelab
ijsyjqfyjiorskrmfkrouzswzifwzuahsihefihagpsupafupgmxsgxwfgxmynsenofenyevsqvkfqve
kdscdgfcdkqlsolcfolqwtsatyfatwcbsmbufmbcjktzkrgzkjpstlsnglspvatxajgxavbitjifgjib
hqtvqbgvqhnythyxghynzotfopgfozfwtrwlgrwfletdehgdelrmtpmdgpmrxutbuzgbuxdctncvgncd
klualshalkqtumtohmtqwbuybkhybwcjukjghkjciruwrchwriozuizyhizoapugpqhgpagxusxmhsxg
mfuefihefmsnuqnehqnsyvucvahcvyeduodwhodelmvbmtibmlruvnupinurxcvzclizcxdkvlkhilkd
jsvxsdixsjpavjazijapbqvhqrihqbhyvtynityhngvfgjifgntovrofirotzwvdwbidwzfevpexipef
mnwcnujcnmsvwovqjovsydwadmjadyelwmlijmlektwytejytkqbwkbajkbqcrwirsjircizwuzojuzi
ohwghkjghoupwspgjspuaxwexcjexagfwqfyjqfgnoxdovkdontwxpwrkpwtzexbenkbezfmxnmjknmf
luxzufkzulrcxlcbklcrdsxjstkjsdjaxvapkvajpixhilkhipvqxtqhktqvbyxfydkfybhgxrgzkrgh
opyepwlepouxyqxslqxuafycfolcfagnyonklongmvyavglavmsdymdclmdsetyktulktekbywbqlwbk
qjyijmlijqwryurilurwczygzelgzcihyshalshipqzfqxmfqpvyzrytmryvbgzdgpmdgbhozpolmpoh
nwzbwhmbwnteznedmnetfuzluvmluflczxcrmxclrkzjknmjkrxszvsjmvsxdazhafmhadjiztibmtij
qragryngrqwzaszunszwchaehqnehcipaqpmnqpioxacxincxoufaofenofugvamvwnmvgmdaydsnydm
slaklonklsytawtknwtyebaibgnibekjaujcnujkrsbhszohsrxabtavotaxdibfirofidjqbrqnorqj
pybdyjodypvgbpgfopgvhwbnwxonwhnebzetozentmblmpolmtzubxuloxuzfcbjchojcflkbvkdovkl
stcitapitsybcubwpubyejcgjspgjekrcsropsrkqzcezkpezqwhcqhgpqhwixcoxypoxiofcafupafo
uncmnqpmnuavcyvmpyvagdckdipkdgmlcwlepwlmtudjubqjutzcdvcxqvczfkdhktqhkflsdtspqtsl
radfalqfarxidrihqrixjydpyzqpyjpgdbgvqbgpvodnorqnovbwdzwnqzwbhedlejqlehnmdxmfqxmn
uvekvcrkvuadewdyrwdagleilurilgmteutqrutmsbegbmrgbsyjesjirsjykzeqzarqzkqhechwrchq
wpeopsropwcxeaxoraxcifemfkrmfioneyngrynovwflwdslwvbefxezsxebhmfjmvsjmhnufvursvun
tcfhcnshctzkftkjstkzlafrabsralrifdixsdirxqfpqtspqxdyfbypsbydjgfnglsngjpofzohszop
wxgmxetmxwcfgyfatyfcingknwtkniovgwvstwvoudgidotidualgulktulambgsbctsbmsjgejytejs
yrgqrutqryezgczqtczekhgohmtohkqpgapitapqxyhnyfunyxdghzgbuzgdjohloxulojpwhxwtuxwp
vehjepujevbmhvmluvmbnchtcdutcntkhfkzufktzshrsvurszfahdarudaflihpinupilrqhbqjubqr
yziozgvozyehiahcvahekpimpyvmpkqxiyxuvyxqwfikfqvkfwcniwnmvwncodiudevudouliglavglu
atistwvstagbiebsvebgmjiqjovqjmsricrkvcrszajpahwpazfijbidwbiflqjnqzwnqlryjzyvwzyr
xgjlgrwlgxdojxonwxodpejvefwvepvmjhmbwhmvbujtuxwtubhcjfctwfchnkjrkpwrkntsjdslwdst
abkqbixqbagjkcjexcjgmrkoraxormszkazwxazsyhkmhsxmhyepkypoxypeqfkwfgxwfqwnkincxinw
cvkuvyxuvcidkgduxgdiolkslqxsloutketmxetubclrcjyrcbhkldkfydkhnslpsbypsntalbaxybat
zilnitynizfqlzqpyzqfrglxghyxgrxoljodyjoxdwlvwzyvwdjelhevyhejpmltmrytmpvulfunyfuv
cdmsdkzsdcilmelgzeliotmqtczqtoubmcbyzcbuajmojuzojagrmarqzargshmyhizyhsypmkpezkpy
exmwxazwxekfmifwzifkqnmunszunqwvmgvozgvwdentelatedjmnfmhafmjpunrudarupvcndczadcv
bknpkvapkbhsnbsrabshtinzijazitzqnlqfalqzfynxybaxyflgnjgxajglronvotavorxwnhwpahwx

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: dentelated
Cipher: qragryngrq

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: dentelated
Cipher: 41513344511311445141

Extended Methods:
Method #1

Plaintext: dentelated
method variations:
iksykqfykiopxdpvldpotuciuaqiutyzhozfvozy

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
d e n t e l a t e d 
4 5 3 4 5 1 1 4 5 4 
1 1 3 4 1 3 1 4 1 1 
They are then read out in rows:
45345114541134131411
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: dentelated
Cipher: ysequaslqa

Read more ...
Method #3

Plaintext: dentelated
method variations:
vlsyacqyqq lsyacqyqqv syacqyqqvl
yacqyqqvls acqyqqvlsy cqyqqvlsya
qyqqvlsyac yqqvlsyacq qqvlsyacqy
qvlsyacqyq

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: dentelated

first 5040 cipher variations(3628800 total)
dentelated dentelatde dentelaetd dentelaedt denteladet denteladte denteltaed denteltade denteltead dentelteda denteltdea
denteltdae denteletad denteletda denteleatd denteleadt denteledat denteledta denteldtea denteldtae denteldeta denteldeat
denteldaet denteldate dentealted dentealtde dentealetd dentealedt dentealdet dentealdte denteatled denteatlde denteateld
denteatedl denteatdel denteatdle denteaetld denteaetdl denteaeltd denteaeldt denteaedlt denteaedtl denteadtel denteadtle
denteadetl denteadelt denteadlet denteadlte dentetaled dentetalde dentetaeld dentetaedl dentetadel dentetadle dentetlaed
dentetlade dentetlead dentetleda dentetldea dentetldae dentetelad dentetelda denteteald denteteadl dentetedal dentetedla
dentetdlea dentetdlae dentetdela dentetdeal dentetdael dentetdale denteeatld denteeatdl denteealtd denteealdt denteeadlt
denteeadtl denteetald denteetadl denteetlad denteetlda denteetdla denteetdal denteeltad denteeltda denteelatd denteeladt
denteeldat denteeldta denteedtla denteedtal denteedlta denteedlat denteedalt denteedatl dentedatel dentedatle dentedaetl
dentedaelt dentedalet dentedalte dentedtael dentedtale dentedteal dentedtela dentedtlea dentedtlae dentedetal dentedetla
dentedeatl dentedealt dentedelat dentedelta dentedltea dentedltae dentedleta dentedleat dentedlaet dentedlate dentleated
dentleatde dentleaetd dentleaedt dentleadet dentleadte dentletaed dentletade dentletead dentleteda dentletdea dentletdae
dentleetad dentleetda dentleeatd dentleeadt dentleedat dentleedta dentledtea dentledtae dentledeta dentledeat dentledaet
dentledate dentlaeted dentlaetde dentlaeetd dentlaeedt dentlaedet dentlaedte dentlateed dentlatede dentlateed dentlatede
dentlatdee dentlatdee dentlaeted dentlaetde dentlaeetd dentlaeedt dentlaedet dentlaedte dentladtee dentladtee dentladete
dentladeet dentladeet dentladete dentltaeed dentltaede dentltaeed dentltaede dentltadee dentltadee dentlteaed dentlteade
dentlteead dentlteeda dentltedea dentltedae dentlteead dentlteeda dentlteaed dentlteade dentltedae dentltedea dentltdeea
dentltdeae dentltdeea dentltdeae dentltdaee dentltdaee dentleated dentleatde dentleaetd dentleaedt dentleadet dentleadte
dentletaed dentletade dentletead dentleteda dentletdea dentletdae dentleetad dentleetda dentleeatd dentleeadt dentleedat
dentleedta dentledtea dentledtae dentledeta dentledeat dentledaet dentledate dentldatee dentldatee dentldaete dentldaeet
dentldaeet dentldaete dentldtaee dentldtaee dentldteae dentldteea dentldteea dentldteae dentldetae dentldetea dentldeate
dentldeaet dentldeeat dentldeeta dentldetea dentldetae dentldeeta dentldeeat dentldeaet dentldeate dentaleted dentaletde
dentaleetd dentaleedt dentaledet dentaledte dentalteed dentaltede dentalteed dentaltede dentaltdee dentaltdee dentaleted
dentaletde dentaleetd dentaleedt dentaledet dentaledte dentaldtee dentaldtee dentaldete dentaldeet dentaldeet dentaldete
dentaelted dentaeltde dentaeletd dentaeledt dentaeldet dentaeldte dentaetled dentaetlde dentaeteld dentaetedl dentaetdel
dentaetdle dentaeetld dentaeetdl dentaeeltd dentaeeldt dentaeedlt dentaeedtl dentaedtel dentaedtle dentaedetl dentaedelt
dentaedlet dentaedlte dentateled dentatelde dentateeld dentateedl dentatedel dentatedle dentatleed dentatlede dentatleed
dentatlede dentatldee dentatldee dentateled dentatelde dentateeld dentateedl dentatedel dentatedle dentatdlee dentatdlee
dentatdele dentatdeel dentatdeel dentatdele dentaeetld dentaeetdl dentaeeltd dentaeeldt dentaeedlt dentaeedtl dentaeteld
dentaetedl dentaetled dentaetlde dentaetdle dentaetdel dentaelted dentaeltde dentaeletd dentaeledt dentaeldet dentaeldte
dentaedtle dentaedtel dentaedlte dentaedlet dentaedelt dentaedetl dentadetel dentadetle dentadeetl dentadeelt dentadelet
dentadelte dentadteel dentadtele dentadteel dentadtele dentadtlee dentadtlee dentadetel dentadetle dentadeetl dentadeelt
dentadelet dentadelte dentadltee dentadltee dentadlete dentadleet dentadleet dentadlete denttlaeed denttlaede denttlaeed
denttlaede denttladee denttladee denttleaed denttleade denttleead denttleeda denttledea denttledae denttleead denttleeda
denttleaed denttleade denttledae denttledea denttldeea denttldeae denttldeea denttldeae denttldaee denttldaee denttaleed
denttalede denttaleed denttalede denttaldee denttaldee denttaeled denttaelde denttaeeld denttaeedl denttaedel denttaedle
denttaeeld denttaeedl denttaeled denttaelde denttaedle denttaedel denttadeel denttadele denttadeel denttadele denttadlee
denttadlee denttealed denttealde dentteaeld dentteaedl dentteadel dentteadle denttelaed denttelade denttelead dentteleda
dentteldea dentteldae dentteelad dentteelda dentteeald dentteeadl dentteedal dentteedla denttedlea denttedlae denttedela
denttedeal denttedael denttedale dentteaeld dentteaedl denttealed denttealde dentteadle dentteadel dentteeald dentteeadl
dentteelad dentteelda dentteedla dentteedal denttelead dentteleda denttelaed denttelade dentteldae dentteldea denttedela
denttedeal denttedlea denttedlae denttedale denttedael denttdaeel denttdaele denttdaeel denttdaele denttdalee denttdalee
denttdeael denttdeale denttdeeal denttdeela denttdelea denttdelae denttdeeal denttdeela denttdeael denttdeale denttdelae
denttdelea denttdleea denttdleae denttdleea denttdleae denttdlaee denttdlaee dentelated dentelatde dentelaetd dentelaedt
denteladet denteladte denteltaed denteltade denteltead dentelteda denteltdea denteltdae denteletad denteletda denteleatd
denteleadt denteledat denteledta denteldtea denteldtae denteldeta denteldeat denteldaet denteldate dentealted dentealtde
dentealetd dentealedt dentealdet dentealdte denteatled denteatlde denteateld denteatedl denteatdel denteatdle denteaetld
denteaetdl denteaeltd denteaeldt denteaedlt denteaedtl denteadtel denteadtle denteadetl denteadelt denteadlet denteadlte
dentetaled dentetalde dentetaeld dentetaedl dentetadel dentetadle dentetlaed dentetlade dentetlead dentetleda dentetldea
dentetldae dentetelad dentetelda denteteald denteteadl dentetedal dentetedla dentetdlea dentetdlae dentetdela dentetdeal
dentetdael dentetdale denteeatld denteeatdl denteealtd denteealdt denteeadlt denteeadtl denteetald denteetadl denteetlad
denteetlda denteetdla denteetdal denteeltad denteeltda denteelatd denteeladt denteeldat denteeldta denteedtla denteedtal
denteedlta denteedlat denteedalt denteedatl dentedatel dentedatle dentedaetl dentedaelt dentedalet dentedalte dentedtael
dentedtale dentedteal dentedtela dentedtlea dentedtlae dentedetal dentedetla dentedeatl dentedealt dentedelat dentedelta
dentedltea dentedltae dentedleta dentedleat dentedlaet dentedlate dentdlatee dentdlatee dentdlaete dentdlaeet dentdlaeet
dentdlaete dentdltaee dentdltaee dentdlteae dentdlteea dentdlteea dentdlteae dentdletae dentdletea dentdleate dentdleaet
dentdleeat dentdleeta dentdletea dentdletae dentdleeta dentdleeat dentdleaet dentdleate dentdaltee dentdaltee dentdalete
dentdaleet dentdaleet dentdalete dentdatlee dentdatlee dentdatele dentdateel dentdateel dentdatele dentdaetle dentdaetel
dentdaelte dentdaelet dentdaeelt dentdaeetl dentdaetel dentdaetle dentdaeetl dentdaeelt dentdaelet dentdaelte dentdtalee
dentdtalee dentdtaele dentdtaeel dentdtaeel dentdtaele dentdtlaee dentdtlaee dentdtleae dentdtleea dentdtleea dentdtleae
dentdtelae dentdtelea dentdteale dentdteael dentdteeal dentdteela dentdtelea dentdtelae dentdteela dentdteeal dentdteael
dentdteale dentdeatle dentdeatel dentdealte dentdealet dentdeaelt dentdeaetl dentdetale dentdetael dentdetlae dentdetlea
dentdetela dentdeteal dentdeltae dentdeltea dentdelate dentdelaet dentdeleat dentdeleta dentdeetla dentdeetal dentdeelta
dentdeelat dentdeealt dentdeeatl dentdeatel dentdeatle dentdeaetl dentdeaelt dentdealet dentdealte dentdetael dentdetale
dentdeteal dentdetela dentdetlea dentdetlae dentdeetal dentdeetla dentdeeatl dentdeealt dentdeelat dentdeelta dentdeltea
dentdeltae dentdeleta dentdeleat dentdelaet dentdelate denetlated denetlatde denetlaetd denetlaedt denetladet denetladte
denetltaed denetltade denetltead denetlteda denetltdea denetltdae denetletad denetletda denetleatd denetleadt denetledat
denetledta denetldtea denetldtae denetldeta denetldeat denetldaet denetldate denetalted denetaltde denetaletd denetaledt
denetaldet denetaldte denetatled denetatlde denetateld denetatedl denetatdel denetatdle denetaetld denetaetdl denetaeltd
denetaeldt denetaedlt denetaedtl denetadtel denetadtle denetadetl denetadelt denetadlet denetadlte denettaled denettalde
denettaeld denettaedl denettadel denettadle denettlaed denettlade denettlead denettleda denettldea denettldae denettelad
denettelda denetteald denetteadl denettedal denettedla denettdlea denettdlae denettdela denettdeal denettdael denettdale
deneteatld deneteatdl denetealtd denetealdt deneteadlt deneteadtl denetetald denetetadl denetetlad denetetlda denetetdla
denetetdal deneteltad deneteltda denetelatd deneteladt deneteldat deneteldta denetedtla denetedtal denetedlta denetedlat
denetedalt denetedatl denetdatel denetdatle denetdaetl denetdaelt denetdalet denetdalte denetdtael denetdtale denetdteal
denetdtela denetdtlea denetdtlae denetdetal denetdetla denetdeatl denetdealt denetdelat denetdelta denetdltea denetdltae
denetdleta denetdleat denetdlaet denetdlate deneltated deneltatde deneltaetd deneltaedt deneltadet deneltadte denelttaed
denelttade denelttead deneltteda denelttdea denelttdae deneltetad deneltetda denelteatd denelteadt deneltedat deneltedta
deneltdtea deneltdtae deneltdeta deneltdeat deneltdaet deneltdate denelatted denelattde denelatetd denelatedt denelatdet
denelatdte denelatted denelattde denelatetd denelatedt denelatdet denelatdte denelaettd denelaetdt denelaettd denelaetdt
denelaedtt denelaedtt deneladtet deneladtte deneladett deneladett deneladtet deneladtte deneltated deneltatde deneltaetd
deneltaedt deneltadet deneltadte denelttaed denelttade denelttead deneltteda denelttdea denelttdae deneltetad deneltetda
denelteatd denelteadt deneltedat deneltedta deneltdtea deneltdtae deneltdeta deneltdeat deneltdaet deneltdate deneleattd
deneleatdt deneleattd deneleatdt deneleadtt deneleadtt deneletatd deneletadt denelettad denelettda deneletdta deneletdat
denelettad denelettda deneletatd deneletadt deneletdat deneletdta deneledtta deneledtat deneledtta deneledtat deneledatt
deneledatt deneldatet deneldatte deneldaett deneldaett deneldatet deneldatte deneldtaet deneldtate deneldteat deneldteta
deneldttea deneldttae deneldetat deneldetta deneldeatt deneldeatt deneldetat deneldetta deneldttea deneldttae deneldteta
deneldteat deneldtaet deneldtate denealtted denealttde denealtetd denealtedt denealtdet denealtdte denealtted denealttde
denealtetd denealtedt denealtdet denealtdte denealettd denealetdt denealettd denealetdt denealedtt denealedtt denealdtet
denealdtte denealdett denealdett denealdtet denealdtte deneatlted deneatltde deneatletd deneatledt deneatldet deneatldte
deneattled deneattlde deneatteld deneattedl deneattdel deneattdle deneatetld deneatetdl deneateltd deneateldt deneatedlt
deneatedtl deneatdtel deneatdtle deneatdetl deneatdelt deneatdlet deneatdlte deneattled deneattlde deneatteld deneattedl
deneattdel deneattdle deneatlted deneatltde deneatletd deneatledt deneatldet deneatldte deneateltd deneateldt deneatetld
deneatetdl deneatedtl deneatedlt deneatdlet deneatdlte deneatdelt deneatdetl deneatdtel deneatdtle deneaettld deneaettdl
deneaetltd deneaetldt deneaetdlt deneaetdtl deneaettld deneaettdl deneaetltd deneaetldt deneaetdlt deneaetdtl deneaelttd
deneaeltdt deneaelttd deneaeltdt deneaeldtt deneaeldtt deneaedtlt deneaedttl deneaedltt deneaedltt deneaedtlt deneaedttl
deneadttel deneadttle deneadtetl deneadtelt deneadtlet deneadtlte deneadttel deneadttle deneadtetl deneadtelt deneadtlet
deneadtlte deneadettl deneadetlt deneadettl deneadetlt deneadeltt deneadeltt deneadltet deneadltte deneadlett deneadlett
deneadltet deneadltte denetlated denetlatde denetlaetd denetlaedt denetladet denetladte denetltaed denetltade denetltead
denetlteda denetltdea denetltdae denetletad denetletda denetleatd denetleadt denetledat denetledta denetldtea denetldtae
denetldeta denetldeat denetldaet denetldate denetalted denetaltde denetaletd denetaledt denetaldet denetaldte denetatled
denetatlde denetateld denetatedl denetatdel denetatdle denetaetld denetaetdl denetaeltd denetaeldt denetaedlt denetaedtl
denetadtel denetadtle denetadetl denetadelt denetadlet denetadlte denettaled denettalde denettaeld denettaedl denettadel
denettadle denettlaed denettlade denettlead denettleda denettldea denettldae denettelad denettelda denetteald denetteadl
denettedal denettedla denettdlea denettdlae denettdela denettdeal denettdael denettdale deneteatld deneteatdl denetealtd
denetealdt deneteadlt deneteadtl denetetald denetetadl denetetlad denetetlda denetetdla denetetdal deneteltad deneteltda
denetelatd deneteladt deneteldat deneteldta denetedtla denetedtal denetedlta denetedlat denetedalt denetedatl denetdatel
denetdatle denetdaetl denetdaelt denetdalet denetdalte denetdtael denetdtale denetdteal denetdtela denetdtlea denetdtlae
denetdetal denetdetla denetdeatl denetdealt denetdelat denetdelta denetdltea denetdltae denetdleta denetdleat denetdlaet
denetdlate deneelattd deneelatdt deneelattd deneelatdt deneeladtt deneeladtt deneeltatd deneeltadt deneelttad deneelttda
deneeltdta deneeltdat deneelttad deneelttda deneeltatd deneeltadt deneeltdat deneeltdta deneeldtta deneeldtat deneeldtta
deneeldtat deneeldatt deneeldatt deneealttd deneealtdt deneealttd deneealtdt deneealdtt deneealdtt deneeatltd deneeatldt
deneeattld deneeattdl deneeatdtl deneeatdlt deneeattld deneeattdl deneeatltd deneeatldt deneeatdlt deneeatdtl deneeadttl
deneeadtlt deneeadttl deneeadtlt deneeadltt deneeadltt deneetaltd deneetaldt deneetatld deneetatdl deneetadtl deneetadlt
deneetlatd deneetladt deneetltad deneetltda deneetldta deneetldat deneettlad deneettlda deneettald deneettadl deneettdal
deneettdla deneetdlta deneetdlat deneetdtla deneetdtal deneetdatl deneetdalt deneetatld deneetatdl deneetaltd deneetaldt
deneetadlt deneetadtl deneettald deneettadl deneettlad deneettlda deneettdla deneettdal deneetltad deneetltda deneetlatd
deneetladt deneetldat deneetldta deneetdtla deneetdtal deneetdlta deneetdlat deneetdalt deneetdatl deneedattl deneedatlt
deneedattl deneedatlt deneedaltt deneedaltt deneedtatl deneedtalt deneedttal deneedttla deneedtlta deneedtlat deneedttal
deneedttla deneedtatl deneedtalt deneedtlat deneedtlta deneedltta deneedltat deneedltta deneedltat deneedlatt deneedlatt
denedlatet denedlatte denedlaett denedlaett denedlatet denedlatte denedltaet denedltate denedlteat denedlteta denedlttea
denedlttae denedletat denedletta denedleatt denedleatt denedletat denedletta denedlttea denedlttae denedlteta denedlteat
denedltaet denedltate denedaltet denedaltte denedalett denedalett denedaltet denedaltte denedatlet denedatlte denedatelt
denedatetl denedattel denedattle denedaetlt denedaettl denedaeltt denedaeltt denedaetlt denedaettl denedattel denedattle
denedatetl denedatelt denedatlet denedatlte denedtalet denedtalte denedtaelt denedtaetl denedtatel denedtatle denedtlaet
denedtlate denedtleat denedtleta denedtltea denedtltae denedtelat denedtelta denedtealt denedteatl denedtetal denedtetla
denedttlea denedttlae denedttela denedtteal denedttael denedttale denedeatlt denedeattl denedealtt denedealtt denedeatlt
denedeattl denedetalt denedetatl denedetlat denedetlta denedettla denedettal denedeltat denedeltta denedelatt denedelatt
denedeltat denedeltta denedettla denedettal denedetlta denedetlat denedetalt denedetatl denedtatel denedtatle denedtaetl
denedtaelt denedtalet denedtalte denedttael denedttale denedtteal denedttela denedttlea denedttlae denedtetal denedtetla
denedteatl denedtealt denedtelat denedtelta denedtltea denedtltae denedtleta denedtleat denedtlaet denedtlate denletated
denletatde denletaetd denletaedt denletadet denletadte denlettaed denlettade denlettead denletteda denlettdea denlettdae
denletetad denletetda denleteatd denleteadt denletedat denletedta denletdtea denletdtae denletdeta denletdeat denletdaet
denletdate denleatted denleattde denleatetd denleatedt denleatdet denleatdte denleatted denleattde denleatetd denleatedt
denleatdet denleatdte denleaettd denleaetdt denleaettd denleaetdt denleaedtt denleaedtt denleadtet denleadtte denleadett
denleadett denleadtet denleadtte denletated denletatde denletaetd denletaedt denletadet denletadte denlettaed denlettade
denlettead denletteda denlettdea denlettdae denletetad denletetda denleteatd denleteadt denletedat denletedta denletdtea
denletdtae denletdeta denletdeat denletdaet denletdate denleeattd denleeatdt denleeattd denleeatdt denleeadtt denleeadtt
denleetatd denleetadt denleettad denleettda denleetdta denleetdat denleettad denleettda denleetatd denleetadt denleetdat
denleetdta denleedtta denleedtat denleedtta denleedtat denleedatt denleedatt denledatet denledatte denledaett denledaett
denledatet denledatte denledtaet denledtate denledteat denledteta denledttea denledttae denledetat denledetta denledeatt
denledeatt denledetat denledetta denledttea denledttae denledteta denledteat denledtaet denledtate denlteated denlteatde
denlteaetd denlteaedt denlteadet denlteadte denltetaed denltetade denltetead denlteteda denltetdea denltetdae denlteetad
denlteetda denlteeatd denlteeadt denlteedat denlteedta denltedtea denltedtae denltedeta denltedeat denltedaet denltedate
denltaeted denltaetde denltaeetd denltaeedt denltaedet denltaedte denltateed denltatede denltateed denltatede denltatdee
denltatdee denltaeted denltaetde denltaeetd denltaeedt denltaedet denltaedte denltadtee denltadtee denltadete denltadeet
denltadeet denltadete denlttaeed denlttaede denlttaeed denlttaede denlttadee denlttadee denltteaed denltteade denltteead
denltteeda denlttedea denlttedae denltteead denltteeda denltteaed denltteade denlttedae denlttedea denlttdeea denlttdeae
denlttdeea denlttdeae denlttdaee denlttdaee denlteated denlteatde denlteaetd denlteaedt denlteadet denlteadte denltetaed
denltetade denltetead denlteteda denltetdea denltetdae denlteetad denlteetda denlteeatd denlteeadt denlteedat denlteedta
denltedtea denltedtae denltedeta denltedeat denltedaet denltedate denltdatee denltdatee denltdaete denltdaeet denltdaeet
denltdaete denltdtaee denltdtaee denltdteae denltdteea denltdteea denltdteae denltdetae denltdetea denltdeate denltdeaet
denltdeeat denltdeeta denltdetea denltdetae denltdeeta denltdeeat denltdeaet denltdeate denlateted denlatetde denlateetd
denlateedt denlatedet denlatedte denlatteed denlattede denlatteed denlattede denlattdee denlattdee denlateted denlatetde
denlateetd denlateedt denlatedet denlatedte denlatdtee denlatdtee denlatdete denlatdeet denlatdeet denlatdete denlaetted
denlaettde denlaetetd denlaetedt denlaetdet denlaetdte denlaetted denlaettde denlaetetd denlaetedt denlaetdet denlaetdte
denlaeettd denlaeetdt denlaeettd denlaeetdt denlaeedtt denlaeedtt denlaedtet denlaedtte denlaedett denlaedett denlaedtet
denlaedtte denlateted denlatetde denlateetd denlateedt denlatedet denlatedte denlatteed denlattede denlatteed denlattede
denlattdee denlattdee denlateted denlatetde denlateetd denlateedt denlatedet denlatedte denlatdtee denlatdtee denlatdete
denlatdeet denlatdeet denlatdete denlaeettd denlaeetdt denlaeettd denlaeetdt denlaeedtt denlaeedtt denlaetetd denlaetedt
denlaetted denlaettde denlaetdte denlaetdet denlaetted denlaettde denlaetetd denlaetedt denlaetdet denlaetdte denlaedtte
denlaedtet denlaedtte denlaedtet denlaedett denlaedett denladetet denladette denladeett denladeett denladetet denladette
denladteet denladtete denladteet denladtete denladttee denladttee denladetet denladette denladeett denladeett denladetet
denladette denladttee denladttee denladtete denladteet denladteet denladtete denlttaeed denlttaede denlttaeed denlttaede
denlttadee denlttadee denltteaed denltteade denltteead denltteeda denlttedea denlttedae denltteead denltteeda denltteaed
denltteade denlttedae denlttedea denlttdeea denlttdeae denlttdeea denlttdeae denlttdaee denlttdaee denltateed denltatede
denltateed denltatede denltatdee denltatdee denltaeted denltaetde denltaeetd denltaeedt denltaedet denltaedte denltaeetd
denltaeedt denltaeted denltaetde denltaedte denltaedet denltadeet denltadete denltadeet denltadete denltadtee denltadtee
denlteated denlteatde denlteaetd denlteaedt denlteadet denlteadte denltetaed denltetade denltetead denlteteda denltetdea
denltetdae denlteetad denlteetda denlteeatd denlteeadt denlteedat denlteedta denltedtea denltedtae denltedeta denltedeat
denltedaet denltedate denlteaetd denlteaedt denlteated denlteatde denlteadte denlteadet denlteeatd denlteeadt denlteetad
denlteetda denlteedta denlteedat denltetead denlteteda denltetaed denltetade denltetdae denltetdea denltedeta denltedeat
denltedtea denltedtae denltedate denltedaet denltdaeet denltdaete denltdaeet denltdaete denltdatee denltdatee denltdeaet
denltdeate denltdeeat denltdeeta denltdetea denltdetae denltdeeat denltdeeta denltdeaet denltdeate denltdetae denltdetea
denltdteea denltdteae denltdteea denltdteae denltdtaee denltdtaee denletated denletatde denletaetd denletaedt denletadet
denletadte denlettaed denlettade denlettead denletteda denlettdea denlettdae denletetad denletetda denleteatd denleteadt
denletedat denletedta denletdtea denletdtae denletdeta denletdeat denletdaet denletdate denleatted denleattde denleatetd
denleatedt denleatdet denleatdte denleatted denleattde denleatetd denleatedt denleatdet denleatdte denleaettd denleaetdt
denleaettd denleaetdt denleaedtt denleaedtt denleadtet denleadtte denleadett denleadett denleadtet denleadtte denletated
denletatde denletaetd denletaedt denletadet denletadte denlettaed denlettade denlettead denletteda denlettdea denlettdae
denletetad denletetda denleteatd denleteadt denletedat denletedta denletdtea denletdtae denletdeta denletdeat denletdaet
denletdate denleeattd denleeatdt denleeattd denleeatdt denleeadtt denleeadtt denleetatd denleetadt denleettad denleettda
denleetdta denleetdat denleettad denleettda denleetatd denleetadt denleetdat denleetdta denleedtta denleedtat denleedtta
denleedtat denleedatt denleedatt denledatet denledatte denledaett denledaett denledatet denledatte denledtaet denledtate
denledteat denledteta denledttea denledttae denledetat denledetta denledeatt denledeatt denledetat denledetta denledttea
denledttae denledteta denledteat denledtaet denledtate denldtatee denldtatee denldtaete denldtaeet denldtaeet denldtaete
denldttaee denldttaee denldtteae denldtteea denldtteea denldtteae denldtetae denldtetea denldteate denldteaet denldteeat
denldteeta denldtetea denldtetae denldteeta denldteeat denldteaet denldteate denldattee denldattee denldatete denldateet
denldateet denldatete denldattee denldattee denldatete denldateet denldateet denldatete denldaette denldaetet denldaette
denldaetet denldaeett denldaeett denldaetet denldaette denldaeett denldaeett denldaetet denldaette denldtatee denldtatee
denldtaete denldtaeet denldtaeet denldtaete denldttaee denldttaee denldtteae denldtteea denldtteea denldtteae denldtetae
denldtetea denldteate denldteaet denldteeat denldteeta denldtetea denldtetae denldteeta denldteeat denldteaet denldteate
denldeatte denldeatet denldeatte denldeatet denldeaett denldeaett denldetate denldetaet denldettae denldettea denldeteta
denldeteat denldettae denldettea denldetate denldetaet denldeteat denldeteta denldeetta denldeetat denldeetta denldeetat
denldeeatt denldeeatt denldeatet denldeatte denldeaett denldeaett denldeatet denldeatte denldetaet denldetate denldeteat
denldeteta denldettea denldettae denldeetat denldeetta denldeeatt denldeeatt denldeetat denldeetta denldettea denldettae
denldeteta denldeteat denldetaet denldetate denaeltted denaelttde denaeltetd denaeltedt denaeltdet denaeltdte denaeltted
denaelttde denaeltetd denaeltedt denaeltdet denaeltdte denaelettd denaeletdt denaelettd denaeletdt denaeledtt denaeledtt
denaeldtet denaeldtte denaeldett denaeldett denaeldtet denaeldtte denaetlted denaetltde denaetletd denaetledt denaetldet
denaetldte denaettled denaettlde denaetteld denaettedl denaettdel denaettdle denaetetld denaetetdl denaeteltd denaeteldt
denaetedlt denaetedtl denaetdtel denaetdtle denaetdetl denaetdelt denaetdlet denaetdlte denaettled denaettlde denaetteld
denaettedl denaettdel denaettdle denaetlted denaetltde denaetletd denaetledt denaetldet denaetldte denaeteltd denaeteldt
denaetetld denaetetdl denaetedtl denaetedlt denaetdlet denaetdlte denaetdelt denaetdetl denaetdtel denaetdtle denaeettld
denaeettdl denaeetltd denaeetldt denaeetdlt denaeetdtl denaeettld denaeettdl denaeetltd denaeetldt denaeetdlt denaeetdtl
denaeelttd denaeeltdt denaeelttd denaeeltdt denaeeldtt denaeeldtt denaeedtlt denaeedttl denaeedltt denaeedltt denaeedtlt
denaeedttl denaedttel denaedttle denaedtetl denaedtelt denaedtlet denaedtlte denaedttel denaedttle denaedtetl denaedtelt
denaedtlet denaedtlte denaedettl denaedetlt denaedettl denaedetlt denaedeltt denaedeltt denaedltet denaedltte denaedlett
denaedlett denaedltet denaedltte denaletted denalettde denaletetd denaletedt denaletdet denaletdte denaletted denalettde
denaletetd denaletedt denaletdet denaletdte denaleettd denaleetdt denaleettd denaleetdt denaleedtt denaleedtt denaledtet
denaledtte denaledett denaledett denaledtet denaledtte denalteted denaltetde denalteetd denalteedt denaltedet denaltedte
denaltteed denalttede denaltteed denalttede denalttdee denalttdee denalteted denaltetde denalteetd denalteedt denaltedet
denaltedte denaltdtee denaltdtee denaltdete denaltdeet denaltdeet denaltdete denaltteed denalttede denaltteed denalttede
denalttdee denalttdee denalteted denaltetde denalteetd denalteedt denaltedet denaltedte denalteetd denalteedt denalteted
denaltetde denaltedte denaltedet denaltdeet denaltdete denaltdeet denaltdete denaltdtee denaltdtee denaletted denalettde
denaletetd denaletedt denaletdet denaletdte denaletted denalettde denaletetd denaletedt denaletdet denaletdte denaleettd
denaleetdt denaleettd denaleetdt denaleedtt denaleedtt denaledtet denaledtte denaledett denaledett denaledtet denaledtte
denaldttee denaldttee denaldtete denaldteet denaldteet denaldtete denaldttee denaldttee denaldtete denaldteet denaldteet
denaldtete denaldette denaldetet denaldette denaldetet denaldeett denaldeett denaldetet denaldette denaldeett denaldeett
denaldetet denaldette denatleted denatletde denatleetd denatleedt denatledet denatledte denatlteed denatltede denatlteed
denatltede denatltdee denatltdee denatleted denatletde denatleetd denatleedt denatledet denatledte denatldtee denatldtee
denatldete denatldeet denatldeet denatldete denatelted denateltde denateletd denateledt denateldet denateldte denatetled
denatetlde denateteld denatetedl denatetdel denatetdle denateetld denateetdl denateeltd denateeldt denateedlt denateedtl
denatedtel denatedtle denatedetl denatedelt denatedlet denatedlte denatteled denattelde denatteeld denatteedl denattedel
denattedle denattleed denattlede denattleed denattlede denattldee denattldee denatteled denattelde denatteeld denatteedl
denattedel denattedle denattdlee denattdlee denattdele denattdeel denattdeel denattdele denateetld denateetdl denateeltd
denateeldt denateedlt denateedtl denateteld denatetedl denatetled denatetlde denatetdle denatetdel denatelted denateltde
denateletd denateledt denateldet denateldte denatedtle denatedtel denatedlte denatedlet denatedelt denatedetl denatdetel
denatdetle denatdeetl denatdeelt denatdelet denatdelte denatdteel denatdtele denatdteel denatdtele denatdtlee denatdtlee
denatdetel denatdetle denatdeetl denatdeelt denatdelet denatdelte denatdltee denatdltee denatdlete denatdleet denatdleet
denatdlete denatlteed denatltede denatlteed denatltede denatltdee denatltdee denatleted denatletde denatleetd denatleedt
denatledet denatledte denatleetd denatleedt denatleted denatletde denatledte denatledet denatldeet denatldete denatldeet
denatldete denatldtee denatldtee denattleed denattlede denattleed denattlede denattldee denattldee denatteled denattelde
denatteeld denatteedl denattedel denattedle denatteeld denatteedl denatteled denattelde denattedle denattedel denattdeel
denattdele denattdeel denattdele denattdlee denattdlee denatetled denatetlde denateteld denatetedl denatetdel denatetdle
denatelted denateltde denateletd denateledt denateldet denateldte denateeltd denateeldt denateetld denateetdl denateedtl
denateedlt denatedlet denatedlte denatedelt denatedetl denatedtel denatedtle denateteld denatetedl denatetled denatetlde
denatetdle denatetdel denateetld denateetdl denateeltd denateeldt denateedlt denateedtl denateletd denateledt denatelted
denateltde denateldte denateldet denatedelt denatedetl denatedlet denatedlte denatedtle denatedtel denatdteel denatdtele
denatdteel denatdtele denatdtlee denatdtlee denatdetel denatdetle denatdeetl denatdeelt denatdelet denatdelte denatdeetl
denatdeelt denatdetel denatdetle denatdelte denatdelet denatdleet denatdlete denatdleet denatdlete denatdltee denatdltee
denaeltted denaelttde denaeltetd denaeltedt denaeltdet denaeltdte denaeltted denaelttde denaeltetd denaeltedt denaeltdet
denaeltdte denaelettd denaeletdt denaelettd denaeletdt denaeledtt denaeledtt denaeldtet denaeldtte denaeldett denaeldett
denaeldtet denaeldtte denaetlted denaetltde denaetletd denaetledt denaetldet denaetldte denaettled denaettlde denaetteld
denaettedl denaettdel denaettdle denaetetld denaetetdl denaeteltd denaeteldt denaetedlt denaetedtl denaetdtel denaetdtle
denaetdetl denaetdelt denaetdlet denaetdlte denaettled denaettlde denaetteld denaettedl denaettdel denaettdle denaetlted
denaetltde denaetletd denaetledt denaetldet denaetldte denaeteltd denaeteldt denaetetld denaetetdl denaetedtl denaetedlt
denaetdlet denaetdlte denaetdelt denaetdetl denaetdtel denaetdtle denaeettld denaeettdl denaeetltd denaeetldt denaeetdlt
denaeetdtl denaeettld denaeettdl denaeetltd denaeetldt denaeetdlt denaeetdtl denaeelttd denaeeltdt denaeelttd denaeeltdt
denaeeldtt denaeeldtt denaeedtlt denaeedttl denaeedltt denaeedltt denaeedtlt denaeedttl denaedttel denaedttle denaedtetl
denaedtelt denaedtlet denaedtlte denaedttel denaedttle denaedtetl denaedtelt denaedtlet denaedtlte denaedettl denaedetlt
denaedettl denaedetlt denaedeltt denaedeltt denaedltet denaedltte denaedlett denaedlett denaedltet denaedltte denadlttee
denadlttee denadltete denadlteet denadlteet denadltete denadlttee denadlttee denadltete denadlteet denadlteet denadltete
denadlette denadletet denadlette denadletet denadleett denadleett denadletet denadlette denadleett denadleett denadletet
denadlette denadtltee denadtltee denadtlete denadtleet denadtleet denadtlete denadttlee denadttlee denadttele denadtteel
denadtteel denadttele denadtetle denadtetel denadtelte denadtelet denadteelt denadteetl denadtetel denadtetle denadteetl
denadteelt denadtelet denadtelte denadttlee denadttlee denadttele denadtteel denadtteel denadttele denadtltee denadtltee
denadtlete denadtleet denadtleet denadtlete denadtelte denadtelet denadtetle denadtetel denadteetl denadteelt denadtelet
denadtelte denadteelt denadteetl denadtetel denadtetle denadettle denadettel denadetlte denadetlet denadetelt denadetetl
denadettle denadettel denadetlte denadetlet denadetelt denadetetl denadeltte denadeltet denadeltte denadeltet denadelett
denadelett denadeetlt denadeettl denadeeltt denadeeltt denadeetlt denadeettl denadettel denadettle denadetetl denadetelt
denadetlet denadetlte denadettel denadettle denadetetl denadetelt denadetlet denadetlte denadeettl denadeetlt denadeettl
denadeetlt denadeeltt denadeeltt denadeltet denadeltte denadelett denadelett denadeltet denadeltte dentelated dentelatde
dentelaetd dentelaedt denteladet denteladte denteltaed denteltade denteltead dentelteda denteltdea denteltdae denteletad
denteletda denteleatd denteleadt denteledat denteledta denteldtea denteldtae denteldeta denteldeat denteldaet denteldate
dentealted dentealtde dentealetd dentealedt dentealdet dentealdte denteatled denteatlde denteateld denteatedl denteatdel
denteatdle denteaetld denteaetdl denteaeltd denteaeldt denteaedlt denteaedtl denteadtel denteadtle denteadetl denteadelt
denteadlet denteadlte dentetaled dentetalde dentetaeld dentetaedl dentetadel dentetadle dentetlaed dentetlade dentetlead
dentetleda dentetldea dentetldae dentetelad dentetelda denteteald denteteadl dentetedal dentetedla dentetdlea dentetdlae
dentetdela dentetdeal dentetdael dentetdale denteeatld denteeatdl denteealtd denteealdt denteeadlt denteeadtl denteetald
denteetadl denteetlad denteetlda denteetdla denteetdal denteeltad denteeltda denteelatd denteeladt denteeldat denteeldta
denteedtla denteedtal denteedlta denteedlat denteedalt denteedatl dentedatel dentedatle dentedaetl dentedaelt dentedalet
dentedalte dentedtael dentedtale dentedteal dentedtela dentedtlea dentedtlae dentedetal dentedetla dentedeatl dentedealt
dentedelat dentedelta dentedltea dentedltae dentedleta dentedleat dentedlaet dentedlate dentleated dentleatde dentleaetd
dentleaedt dentleadet dentleadte dentletaed dentletade dentletead dentleteda dentletdea dentletdae dentleetad dentleetda
dentleeatd dentleeadt dentleedat dentleedta dentledtea dentledtae dentledeta dentledeat dentledaet dentledate dentlaeted
dentlaetde dentlaeetd dentlaeedt dentlaedet dentlaedte dentlateed dentlatede dentlateed dentlatede dentlatdee dentlatdee
dentlaeted dentlaetde dentlaeetd dentlaeedt dentlaedet dentlaedte dentladtee dentladtee dentladete dentladeet dentladeet
dentladete dentltaeed dentltaede dentltaeed dentltaede dentltadee dentltadee dentlteaed dentlteade dentlteead dentlteeda
dentltedea dentltedae dentlteead dentlteeda dentlteaed dentlteade dentltedae dentltedea dentltdeea dentltdeae dentltdeea
dentltdeae dentltdaee dentltdaee dentleated dentleatde dentleaetd dentleaedt dentleadet dentleadte dentletaed dentletade
dentletead dentleteda dentletdea dentletdae dentleetad dentleetda dentleeatd dentleeadt dentleedat dentleedta dentledtea
dentledtae dentledeta dentledeat dentledaet dentledate dentldatee dentldatee dentldaete dentldaeet dentldaeet dentldaete
dentldtaee dentldtaee dentldteae dentldteea dentldteea dentldteae dentldetae dentldetea dentldeate dentldeaet dentldeeat
dentldeeta dentldetea dentldetae dentldeeta dentldeeat dentldeaet dentldeate dentaleted dentaletde dentaleetd dentaleedt
dentaledet dentaledte dentalteed dentaltede dentalteed dentaltede dentaltdee dentaltdee dentaleted dentaletde dentaleetd
dentaleedt dentaledet dentaledte dentaldtee dentaldtee dentaldete dentaldeet dentaldeet dentaldete dentaelted dentaeltde
dentaeletd dentaeledt dentaeldet dentaeldte dentaetled dentaetlde dentaeteld dentaetedl dentaetdel dentaetdle dentaeetld
dentaeetdl dentaeeltd dentaeeldt dentaeedlt dentaeedtl dentaedtel dentaedtle dentaedetl dentaedelt dentaedlet dentaedlte
dentateled dentatelde dentateeld dentateedl dentatedel dentatedle dentatleed dentatlede dentatleed dentatlede dentatldee
dentatldee dentateled dentatelde dentateeld dentateedl dentatedel dentatedle dentatdlee dentatdlee dentatdele dentatdeel
dentatdeel dentatdele dentaeetld dentaeetdl dentaeeltd dentaeeldt dentaeedlt dentaeedtl dentaeteld dentaetedl dentaetled
dentaetlde dentaetdle dentaetdel dentaelted dentaeltde dentaeletd dentaeledt dentaeldet dentaeldte dentaedtle dentaedtel
dentaedlte dentaedlet dentaedelt dentaedetl dentadetel dentadetle dentadeetl dentadeelt dentadelet dentadelte dentadteel
dentadtele dentadteel dentadtele dentadtlee dentadtlee dentadetel dentadetle dentadeetl dentadeelt dentadelet dentadelte
dentadltee dentadltee dentadlete dentadleet dentadleet dentadlete denttlaeed denttlaede denttlaeed denttlaede denttladee
denttladee denttleaed denttleade denttleead denttleeda denttledea denttledae denttleead denttleeda denttleaed denttleade
denttledae denttledea denttldeea denttldeae denttldeea denttldeae denttldaee denttldaee denttaleed denttalede denttaleed
denttalede denttaldee denttaldee denttaeled denttaelde denttaeeld denttaeedl denttaedel denttaedle denttaeeld denttaeedl
denttaeled denttaelde denttaedle denttaedel denttadeel denttadele denttadeel denttadele denttadlee denttadlee denttealed
denttealde dentteaeld dentteaedl dentteadel dentteadle denttelaed denttelade denttelead dentteleda dentteldea dentteldae
dentteelad dentteelda dentteeald dentteeadl dentteedal dentteedla denttedlea denttedlae denttedela denttedeal denttedael
denttedale dentteaeld dentteaedl denttealed denttealde dentteadle dentteadel dentteeald dentteeadl dentteelad dentteelda
dentteedla dentteedal denttelead dentteleda denttelaed denttelade dentteldae dentteldea denttedela denttedeal denttedlea
denttedlae denttedale denttedael denttdaeel denttdaele denttdaeel denttdaele denttdalee denttdalee denttdeael denttdeale
denttdeeal denttdeela denttdelea denttdelae denttdeeal denttdeela denttdeael denttdeale denttdelae denttdelea denttdleea
denttdleae denttdleea denttdleae denttdlaee denttdlaee dentelated dentelatde dentelaetd dentelaedt denteladet denteladte
denteltaed denteltade denteltead dentelteda denteltdea denteltdae denteletad denteletda denteleatd denteleadt denteledat
denteledta denteldtea denteldtae denteldeta denteldeat denteldaet denteldate dentealted dentealtde dentealetd dentealedt
dentealdet dentealdte denteatled denteatlde denteateld denteatedl denteatdel denteatdle denteaetld denteaetdl denteaeltd
denteaeldt denteaedlt denteaedtl denteadtel denteadtle denteadetl denteadelt denteadlet denteadlte dentetaled dentetalde
dentetaeld dentetaedl dentetadel dentetadle dentetlaed dentetlade dentetlead dentetleda dentetldea dentetldae dentetelad
dentetelda denteteald denteteadl dentetedal dentetedla dentetdlea dentetdlae dentetdela dentetdeal dentetdael dentetdale
denteeatld denteeatdl denteealtd denteealdt denteeadlt denteeadtl denteetald denteetadl denteetlad denteetlda denteetdla
denteetdal denteeltad denteeltda denteelatd denteeladt denteeldat denteeldta denteedtla denteedtal denteedlta denteedlat
denteedalt denteedatl dentedatel dentedatle dentedaetl dentedaelt dentedalet dentedalte dentedtael dentedtale dentedteal
dentedtela dentedtlea dentedtlae dentedetal dentedetla dentedeatl dentedealt dentedelat dentedelta dentedltea dentedltae
dentedleta dentedleat dentedlaet dentedlate dentdlatee dentdlatee dentdlaete dentdlaeet dentdlaeet dentdlaete dentdltaee
dentdltaee dentdlteae dentdlteea dentdlteea dentdlteae dentdletae dentdletea dentdleate dentdleaet dentdleeat dentdleeta
dentdletea dentdletae dentdleeta dentdleeat dentdleaet dentdleate dentdaltee dentdaltee dentdalete dentdaleet dentdaleet
dentdalete dentdatlee dentdatlee dentdatele dentdateel dentdateel dentdatele dentdaetle dentdaetel dentdaelte dentdaelet
dentdaeelt dentdaeetl dentdaetel dentdaetle dentdaeetl dentdaeelt dentdaelet dentdaelte dentdtalee dentdtalee dentdtaele
dentdtaeel dentdtaeel dentdtaele dentdtlaee dentdtlaee dentdtleae dentdtleea dentdtleea dentdtleae dentdtelae dentdtelea
dentdteale dentdteael dentdteeal dentdteela dentdtelea dentdtelae dentdteela dentdteeal dentdteael dentdteale dentdeatle
dentdeatel dentdealte dentdealet dentdeaelt dentdeaetl dentdetale dentdetael dentdetlae dentdetlea dentdetela dentdeteal
dentdeltae dentdeltea dentdelate dentdelaet dentdeleat dentdeleta dentdeetla dentdeetal dentdeelta dentdeelat dentdeealt
dentdeeatl dentdeatel dentdeatle dentdeaetl dentdeaelt dentdealet dentdealte dentdetael dentdetale dentdeteal dentdetela
dentdetlea dentdetlae dentdeetal dentdeetla dentdeeatl dentdeealt dentdeelat dentdeelta dentdeltea dentdeltae dentdeleta
dentdeleat dentdelaet dentdelate deneelattd deneelatdt deneelattd deneelatdt deneeladtt deneeladtt deneeltatd deneeltadt
deneelttad deneelttda deneeltdta deneeltdat deneelttad deneelttda deneeltatd deneeltadt deneeltdat deneeltdta deneeldtta
deneeldtat deneeldtta deneeldtat deneeldatt deneeldatt deneealttd deneealtdt deneealttd deneealtdt deneealdtt deneealdtt
deneeatltd deneeatldt deneeattld deneeattdl deneeatdtl deneeatdlt deneeattld deneeattdl deneeatltd deneeatldt deneeatdlt
deneeatdtl deneeadttl deneeadtlt deneeadttl deneeadtlt deneeadltt deneeadltt deneetaltd deneetaldt deneetatld deneetatdl
deneetadtl deneetadlt deneetlatd deneetladt deneetltad deneetltda deneetldta deneetldat deneettlad deneettlda deneettald
deneettadl deneettdal deneettdla deneetdlta deneetdlat deneetdtla deneetdtal deneetdatl deneetdalt deneetatld deneetatdl
deneetaltd deneetaldt deneetadlt deneetadtl deneettald deneettadl deneettlad deneettlda deneettdla deneettdal deneetltad
deneetltda deneetlatd deneetladt deneetldat deneetldta deneetdtla deneetdtal deneetdlta deneetdlat deneetdalt deneetdatl
deneedattl deneedatlt deneedattl deneedatlt deneedaltt deneedaltt deneedtatl deneedtalt deneedttal deneedttla deneedtlta
deneedtlat deneedttal deneedttla deneedtatl deneedtalt deneedtlat deneedtlta deneedltta deneedltat deneedltta deneedltat
deneedlatt deneedlatt deneleattd deneleatdt deneleattd deneleatdt deneleadtt deneleadtt deneletatd deneletadt denelettad
denelettda deneletdta deneletdat denelettad denelettda deneletatd deneletadt deneletdat deneletdta deneledtta deneledtat
deneledtta deneledtat deneledatt deneledatt denelaettd denelaetdt denelaettd denelaetdt denelaedtt denelaedtt denelatetd
denelatedt denelatted denelattde denelatdte denelatdet denelatted denelattde denelatetd denelatedt denelatdet denelatdte
deneladtte deneladtet deneladtte deneladtet deneladett deneladett deneltaetd deneltaedt deneltated deneltatde deneltadte
deneltadet denelteatd denelteadt deneltetad deneltetda deneltedta deneltedat denelttead deneltteda denelttaed denelttade
denelttdae denelttdea deneltdeta deneltdeat deneltdtea deneltdtae deneltdate deneltdaet deneltated deneltatde deneltaetd
deneltaedt deneltadet deneltadte denelttaed denelttade denelttead deneltteda denelttdea denelttdae deneltetad deneltetda
denelteatd denelteadt deneltedat deneltedta deneltdtea deneltdtae deneltdeta deneltdeat deneltdaet deneltdate deneldatte
deneldatet deneldatte deneldatet deneldaett deneldaett deneldtate deneldtaet deneldttae deneldttea deneldteta deneldteat
deneldttae deneldttea deneldtate deneldtaet deneldteat deneldteta deneldetta deneldetat deneldetta deneldetat deneldeatt
deneldeatt denealettd denealetdt denealettd denealetdt denealedtt denealedtt denealtetd denealtedt denealtted denealttde
denealtdte denealtdet denealtted denealttde denealtetd denealtedt denealtdet denealtdte denealdtte denealdtet denealdtte
denealdtet denealdett denealdett deneaelttd deneaeltdt deneaelttd deneaeltdt deneaeldtt deneaeldtt deneaetltd deneaetldt
deneaettld deneaettdl deneaetdtl deneaetdlt deneaettld deneaettdl deneaetltd deneaetldt deneaetdlt deneaetdtl deneaedttl
deneaedtlt deneaedttl deneaedtlt deneaedltt deneaedltt deneateltd deneateldt deneatetld deneatetdl deneatedtl deneatedlt
deneatletd deneatledt deneatlted deneatltde deneatldte deneatldet deneattled deneattlde deneatteld deneattedl deneattdel
deneattdle deneatdlte deneatdlet deneatdtle deneatdtel deneatdetl deneatdelt deneatetld deneatetdl deneateltd deneateldt
deneatedlt deneatedtl deneatteld deneattedl deneattled deneattlde deneattdle deneattdel deneatlted deneatltde deneatletd
deneatledt deneatldet deneatldte deneatdtle deneatdtel deneatdlte deneatdlet deneatdelt deneatdetl deneadettl deneadetlt
deneadettl deneadetlt deneadeltt deneadeltt deneadtetl deneadtelt deneadttel deneadttle deneadtlte deneadtlet deneadttel
deneadttle deneadtetl deneadtelt deneadtlet deneadtlte deneadltte deneadltet deneadltte deneadltet deneadlett deneadlett
denetlaetd denetlaedt denetlated denetlatde denetladte denetladet denetleatd denetleadt denetletad denetletda denetledta
denetledat denetltead denetlteda denetltaed denetltade denetltdae denetltdea denetldeta denetldeat denetldtea denetldtae
denetldate denetldaet denetaletd denetaledt denetalted denetaltde denetaldte denetaldet denetaeltd denetaeldt denetaetld
denetaetdl denetaedtl denetaedlt denetateld denetatedl denetatled denetatlde denetatdle denetatdel denetadetl denetadelt
denetadtel denetadtle denetadlte denetadlet denetealtd denetealdt deneteatld deneteatdl deneteadtl deneteadlt denetelatd
deneteladt deneteltad deneteltda deneteldta deneteldat denetetlad denetetlda denetetald denetetadl denetetdal denetetdla
denetedlta denetedlat denetedtla denetedtal denetedatl denetedalt denettaeld denettaedl denettaled denettalde denettadle
denettadel denetteald denetteadl denettelad denettelda denettedla denettedal denettlead denettleda denettlaed denettlade
denettldae denettldea denettdela denettdeal denettdlea denettdlae denettdale denettdael denetdaetl denetdaelt denetdatel
denetdatle denetdalte denetdalet denetdeatl denetdealt denetdetal denetdetla denetdelta denetdelat denetdteal denetdtela
denetdtael denetdtale denetdtlae denetdtlea denetdleta denetdleat denetdltea denetdltae denetdlate denetdlaet denetlated
denetlatde denetlaetd denetlaedt denetladet denetladte denetltaed denetltade denetltead denetlteda denetltdea denetltdae
denetletad denetletda denetleatd denetleadt denetledat denetledta denetldtea denetldtae denetldeta denetldeat denetldaet
denetldate denetalted denetaltde denetaletd denetaledt denetaldet denetaldte denetatled denetatlde denetateld denetatedl
denetatdel denetatdle denetaetld denetaetdl denetaeltd denetaeldt denetaedlt denetaedtl denetadtel denetadtle denetadetl
denetadelt denetadlet denetadlte denettaled denettalde denettaeld denettaedl denettadel denettadle denettlaed denettlade
denettlead denettleda denettldea denettldae denettelad denettelda denetteald denetteadl denettedal denettedla denettdlea
denettdlae denettdela denettdeal denettdael denettdale deneteatld deneteatdl denetealtd denetealdt deneteadlt deneteadtl
denetetald denetetadl denetetlad denetetlda denetetdla denetetdal deneteltad deneteltda denetelatd deneteladt deneteldat
deneteldta denetedtla denetedtal denetedlta denetedlat denetedalt denetedatl denetdatel denetdatle denetdaetl denetdaelt
denetdalet denetdalte denetdtael denetdtale denetdteal denetdtela denetdtlea denetdtlae denetdetal denetdetla denetdeatl
denetdealt denetdelat denetdelta denetdltea denetdltae denetdleta denetdleat denetdlaet denetdlate denedlatte denedlatet
denedlatte denedlatet denedlaett denedlaett denedltate denedltaet denedlttae denedlttea denedlteta denedlteat denedlttae
denedlttea denedltate denedltaet denedlteat denedlteta denedletta denedletat denedletta denedletat denedleatt denedleatt
denedaltte denedaltet denedaltte denedaltet denedalett denedalett denedatlte denedatlet denedattle denedattel denedatetl
denedatelt denedattle denedattel denedatlte denedatlet denedatelt denedatetl denedaettl denedaetlt denedaettl denedaetlt
denedaeltt denedaeltt denedtalte denedtalet denedtatle denedtatel denedtaetl denedtaelt denedtlate denedtlaet denedtltae
denedtltea denedtleta denedtleat denedttlae denedttlea denedttale denedttael denedtteal denedttela denedtelta denedtelat
denedtetla denedtetal denedteatl denedtealt denedtatle denedtatel denedtalte denedtalet denedtaelt denedtaetl denedttale
denedttael denedttlae denedttlea denedttela denedtteal denedtltae denedtltea denedtlate denedtlaet denedtleat denedtleta
denedtetla denedtetal denedtelta denedtelat denedtealt denedteatl denedeattl denedeatlt denedeattl denedeatlt denedealtt
denedealtt denedetatl denedetalt denedettal denedettla denedetlta denedetlat denedettal denedettla denedetatl denedetalt
denedetlat denedetlta denedeltta denedeltat denedeltta denedeltat denedelatt denedelatt dendelatet dendelatte dendelaett
dendelaett dendelatet dendelatte dendeltaet dendeltate dendelteat dendelteta dendelttea dendelttae dendeletat dendeletta
dendeleatt dendeleatt dendeletat dendeletta dendelttea dendelttae dendelteta dendelteat dendeltaet dendeltate dendealtet
dendealtte dendealett dendealett dendealtet dendealtte dendeatlet dendeatlte dendeatelt dendeatetl dendeattel dendeattle
dendeaetlt dendeaettl dendeaeltt dendeaeltt dendeaetlt dendeaettl dendeattel dendeattle dendeatetl dendeatelt dendeatlet
dendeatlte dendetalet dendetalte dendetaelt dendetaetl dendetatel dendetatle dendetlaet dendetlate dendetleat dendetleta
dendetltea dendetltae dendetelat dendetelta dendetealt dendeteatl dendetetal dendetetla dendettlea dendettlae dendettela
dendetteal dendettael dendettale dendeeatlt dendeeattl dendeealtt dendeealtt dendeeatlt dendeeattl dendeetalt dendeetatl
dendeetlat dendeetlta dendeettla dendeettal dendeeltat dendeeltta dendeelatt dendeelatt dendeeltat dendeeltta dendeettla
dendeettal dendeetlta dendeetlat dendeetalt dendeetatl dendetatel dendetatle dendetaetl dendetaelt dendetalet dendetalte
dendettael dendettale dendetteal dendettela dendettlea dendettlae dendetetal dendetetla dendeteatl dendetealt dendetelat
dendetelta dendetltea dendetltae dendetleta dendetleat dendetlaet dendetlate dendleatet dendleatte dendleaett dendleaett
dendleatet dendleatte dendletaet dendletate dendleteat dendleteta dendlettea dendlettae dendleetat dendleetta dendleeatt
dendleeatt dendleetat dendleetta dendlettea dendlettae dendleteta dendleteat dendletaet dendletate dendlaetet dendlaette
dendlaeett dendlaeett dendlaetet dendlaette dendlateet dendlatete dendlateet dendlatete dendlattee dendlattee dendlaetet
dendlaette dendlaeett dendlaeett dendlaetet dendlaette dendlattee dendlattee dendlatete dendlateet dendlateet dendlatete
dendltaeet dendltaete dendltaeet dendltaete dendltatee dendltatee dendlteaet dendlteate dendlteeat dendlteeta dendltetea
dendltetae dendlteeat dendlteeta dendlteaet dendlteate dendltetae dendltetea dendltteea dendltteae dendltteea dendltteae
dendlttaee dendlttaee dendleatet dendleatte dendleaett dendleaett dendleatet dendleatte dendletaet dendletate dendleteat
dendleteta dendlettea dendlettae dendleetat dendleetta dendleeatt dendleeatt dendleetat dendleetta dendlettea dendlettae
dendleteta dendleteat dendletaet dendletate dendltatee dendltatee dendltaete dendltaeet dendltaeet dendltaete dendlttaee
dendlttaee dendltteae dendltteea dendltteea dendltteae dendltetae dendltetea dendlteate dendlteaet dendlteeat dendlteeta
dendltetea dendltetae dendlteeta dendlteeat dendlteaet dendlteate dendaletet dendalette dendaleett dendaleett dendaletet
dendalette dendalteet dendaltete dendalteet dendaltete dendalttee dendalttee dendaletet dendalette dendaleett dendaleett
dendaletet dendalette dendalttee dendalttee dendaltete dendalteet dendalteet dendaltete dendaeltet dendaeltte dendaelett
dendaelett dendaeltet dendaeltte dendaetlet dendaetlte dendaetelt dendaetetl dendaettel dendaettle dendaeetlt dendaeettl
dendaeeltt dendaeeltt dendaeetlt dendaeettl dendaettel dendaettle dendaetetl dendaetelt dendaetlet dendaetlte dendatelet
dendatelte dendateelt dendateetl dendatetel dendatetle dendatleet dendatlete dendatleet dendatlete dendatltee dendatltee
dendatelet dendatelte dendateelt dendateetl dendatetel dendatetle dendattlee dendattlee dendattele dendatteel dendatteel
dendattele dendaeetlt dendaeettl dendaeeltt dendaeeltt dendaeetlt dendaeettl dendaetelt dendaetetl dendaetlet dendaetlte
dendaettle dendaettel dendaeltet dendaeltte dendaelett dendaelett dendaeltet dendaeltte dendaettle dendaettel dendaetlte
dendaetlet dendaetelt dendaetetl dendatetel dendatetle dendateetl dendateelt dendatelet dendatelte dendatteel dendattele
dendatteel dendattele dendattlee dendattlee dendatetel dendatetle dendateetl dendateelt dendatelet dendatelte dendatltee
dendatltee dendatlete dendatleet dendatleet dendatlete dendtlaeet dendtlaete dendtlaeet dendtlaete dendtlatee dendtlatee
dendtleaet dendtleate dendtleeat dendtleeta dendtletea dendtletae dendtleeat dendtleeta dendtleaet dendtleate dendtletae
dendtletea dendtlteea dendtlteae dendtlteea dendtlteae dendtltaee dendtltaee dendtaleet dendtalete dendtaleet dendtalete
dendtaltee dendtaltee dendtaelet dendtaelte dendtaeelt dendtaeetl dendtaetel dendtaetle dendtaeelt dendtaeetl dendtaelet
dendtaelte dendtaetle dendtaetel dendtateel dendtatele dendtateel dendtatele dendtatlee dendtatlee dendtealet dendtealte
dendteaelt dendteaetl dendteatel dendteatle dendtelaet dendtelate dendteleat dendteleta dendteltea dendteltae dendteelat
dendteelta dendteealt dendteeatl dendteetal dendteetla dendtetlea dendtetlae dendtetela dendteteal dendtetael dendtetale
dendteaelt dendteaetl dendtealet dendtealte dendteatle dendteatel dendteealt dendteeatl dendteelat dendteelta dendteetla
dendteetal dendteleat dendteleta dendtelaet dendtelate dendteltae dendteltea dendtetela dendteteal dendtetlea dendtetlae
dendtetale dendtetael dendttaeel dendttaele dendttaeel dendttaele dendttalee dendttalee dendtteael dendtteale dendtteeal
dendtteela dendttelea dendttelae dendtteeal dendtteela dendtteael dendtteale dendttelae dendttelea dendttleea dendttleae
dendttleea dendttleae dendttlaee dendttlaee dendelatet dendelatte dendelaett dendelaett dendelatet dendelatte dendeltaet
dendeltate dendelteat dendelteta dendelttea dendelttae dendeletat dendeletta dendeleatt dendeleatt dendeletat dendeletta
dendelttea dendelttae dendelteta dendelteat dendeltaet dendeltate dendealtet dendealtte dendealett dendealett dendealtet
dendealtte dendeatlet dendeatlte dendeatelt dendeatetl dendeattel dendeattle dendeaetlt dendeaettl dendeaeltt dendeaeltt
dendeaetlt dendeaettl dendeattel dendeattle dendeatetl dendeatelt dendeatlet dendeatlte dendetalet dendetalte dendetaelt
dendetaetl dendetatel dendetatle dendetlaet dendetlate dendetleat dendetleta dendetltea dendetltae dendetelat dendetelta
dendetealt dendeteatl dendetetal dendetetla dendettlea dendettlae dendettela dendetteal dendettael dendettale dendeeatlt
dendeeattl dendeealtt dendeealtt dendeeatlt dendeeattl dendeetalt dendeetatl dendeetlat dendeetlta dendeettla dendeettal
dendeeltat dendeeltta dendeelatt dendeelatt dendeeltat dendeeltta dendeettla dendeettal dendeetlta dendeetlat dendeetalt
dendeetatl dendetatel dendetatle dendetaetl dendetaelt dendetalet dendetalte dendettael dendettale dendetteal dendettela
dendettlea dendettlae dendetetal dendetetla dendeteatl dendetealt dendetelat dendetelta dendetltea dendetltae dendetleta
dendetleat dendetlaet dendetlate dendtlatee dendtlatee dendtlaete dendtlaeet dendtlaeet dendtlaete dendtltaee dendtltaee
dendtlteae dendtlteea dendtlteea dendtlteae dendtletae dendtletea dendtleate dendtleaet dendtleeat dendtleeta dendtletea
dendtletae dendtleeta dendtleeat dendtleaet dendtleate dendtaltee dendtaltee dendtalete dendtaleet dendtaleet dendtalete
dendtatlee dendtatlee dendtatele dendtateel dendtateel dendtatele dendtaetle dendtaetel dendtaelte dendtaelet dendtaeelt
dendtaeetl dendtaetel dendtaetle dendtaeetl dendtaeelt dendtaelet dendtaelte dendttalee dendttalee dendttaele dendttaeel
dendttaeel dendttaele dendttlaee dendttlaee dendttleae dendttleea dendttleea dendttleae dendttelae dendttelea dendtteale
dendtteael dendtteeal dendtteela dendttelea dendttelae dendtteela dendtteeal dendtteael dendtteale dendteatle dendteatel
dendtealte dendtealet dendteaelt dendteaetl dendtetale dendtetael dendtetlae dendtetlea dendtetela dendteteal dendteltae
dendteltea dendtelate dendtelaet dendteleat dendteleta dendteetla dendteetal dendteelta dendteelat dendteealt dendteeatl
dendteatel dendteatle dendteaetl dendteaelt dendtealet dendtealte dendtetael dendtetale dendteteal dendtetela dendtetlea
dendtetlae dendteetal dendteetla dendteeatl dendteealt dendteelat dendteelta dendteltea dendteltae dendteleta dendteleat
dendtelaet dendtelate

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us