easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

fictionally

viduated

polyslo

theussl

ghislaine

delicata

guignet

intereras

loring

hogsty

preambular

schoolboyishly

dadjikra

pentene

antepreterit

regnaremusque

bosnia

libatoque


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: delavega
cipher variations:
efmbwfhb fgncxgic ghodyhjd hipezike ijqfajlf
jkrgbkmg klshclnh lmtidmoi mnujenpj novkfoqk
opwlgprl pqxmhqsm qrynirtn rszojsuo stapktvp
tubqluwq uvcrmvxr vwdsnwys wxetoxzt xyfupyau
yzgvqzbv zahwracw abixsbdx bcjytcey cdkzudfz

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: delavega
Cipher: wvozevtz

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: delavega
Cipher: AAABB AABAA ABABA AAAAA BBBAB AABAA AABBA AAAAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: delavega
cipher variations:
efmbwfhbknibmntbqvebcvfbwdabsdrbclwbildbitsbytpbujkbejnbargburzb
gzcbkzlbmhybahxbspubqpjbyxqbgxvbfgncxgiclojcnoucrwfcdwgcxebctesc
dmxcjmecjutczuqcvklcfkocbshcvsachadclamcnizcbiyctqvcrqkczyrchywc
ghodyhjdmpkdopvdsxgdexhdyfcduftdenydknfdkvudavrdwlmdglpdctidwtbd
ibedmbndojadcjzdurwdsrldazsdizxdhipezikenqlepqwetyhefyiezgdevgue
fozelogelwvebwsexmnehmqedujexucejcfencoepkbedkaevsxetsmebatejaye
ijqfajlformfqrxfuzifgzjfahefwhvfgpafmphfmxwfcxtfynofinrfevkfyvdf
kdgfodpfqlcfelbfwtyfutnfcbufkbzfjkrgbkmgpsngrsygvajghakgbifgxiwg
hqbgnqignyxgdyugzopgjosgfwlgzweglehgpeqgrmdgfmcgxuzgvuogdcvglcag
klshclnhqtohstzhwbkhiblhcjghyjxhirchorjhozyhezvhapqhkpthgxmhaxfh
mfihqfrhsnehgndhyvahwvphedwhmdbhlmtidmoirupituaixclijcmidkhizkyi
jsdipskipazifawibqrilquihynibygingjirgsitofihoeizwbixwqifexineci
mnujenpjsvqjuvbjydmjkdnjelijalzjktejqtljqbajgbxjcrsjmrvjizojczhj
ohkjshtjupgjipfjaxcjyxrjgfyjofdjnovkfoqktwrkvwckzenkleokfmjkbmak
lufkrumkrcbkhcykdstknswkjapkdaikpilktiukvqhkjqgkbydkzyskhgzkpgek
opwlgprluxslwxdlafolmfplgnklcnblmvglsvnlsdclidzletulotxlkbqlebjl
qjmlujvlwrilkrhlczelaztlihalqhflpqxmhqsmvytmxyembgpmngqmholmdocm
nwhmtwomtedmjeamfuvmpuymlcrmfckmrknmvkwmxsjmlsimdafmbaumjibmrigm
qrynirtnwzunyzfnchqnohrnipmnepdnoxinuxpnufenkfbngvwnqvznmdsngdln
slonwlxnytknmtjnebgncbvnkjcnsjhnrszojsuoxavozagodiropisojqnofqeo
pyjovyqovgfolgcohwxorwaonetohemotmpoxmyozulonukofchodcwolkdotkio
stapktvpybwpabhpejspqjtpkropgrfpqzkpwzrpwhgpmhdpixypsxbpofupifnp
unqpynzpavmpovlpgdipedxpmlepuljptubqluwqzcxqbciqfktqrkuqlspqhsgq
ralqxasqxihqnieqjyzqtycqpgvqjgoqvorqzoaqbwnqpwmqhejqfeyqnmfqvmkq
uvcrmvxradyrcdjrglurslvrmtqrithrsbmrybtryjirojfrkzaruzdrqhwrkhpr
wpsrapbrcxorqxnrifkrgfzrongrwnlrvwdsnwysbezsdekshmvstmwsnursjuis
tcnszcuszkjspkgslabsvaesrixsliqsxqtsbqcsdypsryosjglshgaspohsxoms
wxetoxztcfatefltinwtunxtovstkvjtudotadvtalktqlhtmbctwbftsjytmjrt
yrutcrdtezqtszptkhmtihbtqpitypntxyfupyaudgbufgmujoxuvoyupwtulwku
vepubewubmlurmiuncduxcgutkzunksuzsvudseufarutaqulinujicurqjuzqou
yzgvqzbvehcvghnvkpyvwpzvqxuvmxlvwfqvcfxvcnmvsnjvodevydhvulavoltv
atwvetfvgbsvubrvmjovkjdvsrkvarpvzahwracwfidwhiowlqzwxqawryvwnymw
xgrwdgywdonwtokwpefwzeiwvmbwpmuwbuxwfugwhctwvcswnkpwlkewtslwbsqw
abixsbdxgjexijpxmraxyrbxszwxoznxyhsxehzxepoxuplxqfgxafjxwncxqnvx
cvyxgvhxiduxwdtxolqxmlfxutmxctrxbcjytceyhkfyjkqynsbyzscytaxypaoy
zityfiayfqpyvqmyrghybgkyxodyrowydwzyhwiyjevyxeuypmrynmgyvunydusy
cdkzudfzilgzklrzotczatdzubyzqbpzajuzgjbzgrqzwrnzshizchlzypezspxz
exazixjzkfwzyfvzqnszonhzwvozevtzdelavegajmhalmsapudabueavczarcqa
bkvahkcahsraxsoatijadimazqfatqyafybajykalgxazgwarotapoiaxwpafwua

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: delavega
Cipher: qrynirtn

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: delavega
Cipher: 4151131115512211

Extended Methods:
Method #1

Plaintext: delavega
method variations:
ikqfakmfopvlfprltuaqluwqyzfvqzbv

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
d e l a v e g a 
4 5 1 1 1 5 2 1 
1 1 3 1 5 1 2 1 
They are then read out in rows:
4511152111315121
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: delavega
Cipher: yavbaceb

Read more ...
Method #3

Plaintext: delavega
method variations:
vacazfbq acazfbqv cazfbqva
azfbqvac zfbqvaca fbqvacaz
bqvacazf qvacazfb

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: delavega

first 5040 cipher variations(40320 total)
delavega delaveag delavgea delavgae delavage delavaeg delaevga delaevag delaegva delaegav delaeagv
delaeavg delageva delageav delagvea delagvae delagave delagaev delaaegv delaaevg delaagev delaagve
delaavge delaaveg delvaega delvaeag delvagea delvagae delvaage delvaaeg delveaga delveaag delvegaa
delvegaa delveaga delveaag delvgeaa delvgeaa delvgaea delvgaae delvgaae delvgaea delvaega delvaeag
delvagea delvagae delvaage delvaaeg delevaga delevaag delevgaa delevgaa delevaga delevaag deleavga
deleavag deleagva deleagav deleaagv deleaavg delegava delegaav delegvaa delegvaa delegava delegaav
deleaagv deleaavg deleagav deleagva deleavga deleavag delgveaa delgveaa delgvaea delgvaae delgvaae
delgvaea delgevaa delgevaa delgeava delgeaav delgeaav delgeava delgaeva delgaeav delgavea delgavae
delgaave delgaaev delgaeav delgaeva delgaaev delgaave delgavae delgavea delavega delaveag delavgea
delavgae delavage delavaeg delaevga delaevag delaegva delaegav delaeagv delaeavg delageva delageav
delagvea delagvae delagave delagaev delaaegv delaaevg delaagev delaagve delaavge delaaveg dealvega
dealveag dealvgea dealvgae dealvage dealvaeg dealevga dealevag dealegva dealegav dealeagv dealeavg
dealgeva dealgeav dealgvea dealgvae dealgave dealgaev dealaegv dealaevg dealagev dealagve dealavge
dealaveg deavlega deavleag deavlgea deavlgae deavlage deavlaeg deavelga deavelag deavegla deavegal
deaveagl deavealg deavgela deavgeal deavglea deavglae deavgale deavgael deavaegl deavaelg deavagel
deavagle deavalge deavaleg deaevlga deaevlag deaevgla deaevgal deaevagl deaevalg deaelvga deaelvag
deaelgva deaelgav deaelagv deaelavg deaeglva deaeglav deaegvla deaegval deaegavl deaegalv deaealgv
deaealvg deaeaglv deaeagvl deaeavgl deaeavlg deagvela deagveal deagvlea deagvlae deagvale deagvael
deagevla deageval deagelva deagelav deagealv deageavl deagleva deagleav deaglvea deaglvae deaglave
deaglaev deagaelv deagaevl deagalev deagalve deagavle deagavel deaavegl deaavelg deaavgel deaavgle
deaavlge deaavleg deaaevgl deaaevlg deaaegvl deaaeglv deaaelgv deaaelvg deaagevl deaagelv deaagvel
deaagvle deaaglve deaaglev deaalegv deaalevg deaalgev deaalgve deaalvge deaalveg devalega devaleag
devalgea devalgae devalage devalaeg devaelga devaelag devaegla devaegal devaeagl devaealg devagela
devageal devaglea devaglae devagale devagael devaaegl devaaelg devaagel devaagle devaalge devaaleg
devlaega devlaeag devlagea devlagae devlaage devlaaeg devleaga devleaag devlegaa devlegaa devleaga
devleaag devlgeaa devlgeaa devlgaea devlgaae devlgaae devlgaea devlaega devlaeag devlagea devlagae
devlaage devlaaeg develaga develaag develgaa develgaa develaga develaag devealga devealag deveagla
deveagal deveaagl deveaalg devegala devegaal deveglaa deveglaa devegala devegaal deveaagl deveaalg
deveagal deveagla devealga devealag devgleaa devgleaa devglaea devglaae devglaae devglaea devgelaa
devgelaa devgeala devgeaal devgeaal devgeala devgaela devgaeal devgalea devgalae devgaale devgaael
devgaeal devgaela devgaael devgaale devgalae devgalea devalega devaleag devalgea devalgae devalage
devalaeg devaelga devaelag devaegla devaegal devaeagl devaealg devagela devageal devaglea devaglae
devagale devagael devaaegl devaaelg devaagel devaagle devaalge devaaleg deeavlga deeavlag deeavgla
deeavgal deeavagl deeavalg deealvga deealvag deealgva deealgav deealagv deealavg deeaglva deeaglav
deeagvla deeagval deeagavl deeagalv deeaalgv deeaalvg deeaaglv deeaagvl deeaavgl deeaavlg deevalga
deevalag deevagla deevagal deevaagl deevaalg deevlaga deevlaag deevlgaa deevlgaa deevlaga deevlaag
deevglaa deevglaa deevgala deevgaal deevgaal deevgala deevalga deevalag deevagla deevagal deevaagl
deevaalg deelvaga deelvaag deelvgaa deelvgaa deelvaga deelvaag deelavga deelavag deelagva deelagav
deelaagv deelaavg deelgava deelgaav deelgvaa deelgvaa deelgava deelgaav deelaagv deelaavg deelagav
deelagva deelavga deelavag deegvlaa deegvlaa deegvala deegvaal deegvaal deegvala deeglvaa deeglvaa
deeglava deeglaav deeglaav deeglava deegalva deegalav deegavla deegaval deegaavl deegaalv deegalav
deegalva deegaalv deegaavl deegaval deegavla deeavlga deeavlag deeavgla deeavgal deeavagl deeavalg
deealvga deealvag deealgva deealgav deealagv deealavg deeaglva deeaglav deeagvla deeagval deeagavl
deeagalv deeaalgv deeaalvg deeaaglv deeaagvl deeaavgl deeaavlg degavela degaveal degavlea degavlae
degavale degavael degaevla degaeval degaelva degaelav degaealv degaeavl degaleva degaleav degalvea
degalvae degalave degalaev degaaelv degaaevl degaalev degaalve degaavle degaavel degvaela degvaeal
degvalea degvalae degvaale degvaael degveala degveaal degvelaa degvelaa degveala degveaal degvleaa
degvleaa degvlaea degvlaae degvlaae degvlaea degvaela degvaeal degvalea degvalae degvaale degvaael
degevala degevaal degevlaa degevlaa degevala degevaal degeavla degeaval degealva degealav degeaalv
degeaavl degelava degelaav degelvaa degelvaa degelava degelaav degeaalv degeaavl degealav degealva
degeavla degeaval deglveaa deglveaa deglvaea deglvaae deglvaae deglvaea deglevaa deglevaa degleava
degleaav degleaav degleava deglaeva deglaeav deglavea deglavae deglaave deglaaev deglaeav deglaeva
deglaaev deglaave deglavae deglavea degavela degaveal degavlea degavlae degavale degavael degaevla
degaeval degaelva degaelav degaealv degaeavl degaleva degaleav degalvea degalvae degalave degalaev
degaaelv degaaevl degaalev degaalve degaavle degaavel deaavegl deaavelg deaavgel deaavgle deaavlge
deaavleg deaaevgl deaaevlg deaaegvl deaaeglv deaaelgv deaaelvg deaagevl deaagelv deaagvel deaagvle
deaaglve deaaglev deaalegv deaalevg deaalgev deaalgve deaalvge deaalveg deavaegl deavaelg deavagel
deavagle deavalge deavaleg deaveagl deavealg deavegal deavegla deavelga deavelag deavgeal deavgela
deavgael deavgale deavglae deavglea deavlega deavleag deavlgea deavlgae deavlage deavlaeg deaevagl
deaevalg deaevgal deaevgla deaevlga deaevlag deaeavgl deaeavlg deaeagvl deaeaglv deaealgv deaealvg
deaegavl deaegalv deaegval deaegvla deaeglva deaeglav deaelagv deaelavg deaelgav deaelgva deaelvga
deaelvag deagveal deagvela deagvael deagvale deagvlae deagvlea deageval deagevla deageavl deagealv
deagelav deagelva deagaevl deagaelv deagavel deagavle deagalve deagalev deagleav deagleva deaglaev
deaglave deaglvae deaglvea dealvega dealveag dealvgea dealvgae dealvage dealvaeg dealevga dealevag
dealegva dealegav dealeagv dealeavg dealgeva dealgeav dealgvea dealgvae dealgave dealgaev dealaegv
dealaevg dealagev dealagve dealavge dealaveg dleavega dleaveag dleavgea dleavgae dleavage dleavaeg
dleaevga dleaevag dleaegva dleaegav dleaeagv dleaeavg dleageva dleageav dleagvea dleagvae dleagave
dleagaev dleaaegv dleaaevg dleaagev dleaagve dleaavge dleaaveg dlevaega dlevaeag dlevagea dlevagae
dlevaage dlevaaeg dleveaga dleveaag dlevegaa dlevegaa dleveaga dleveaag dlevgeaa dlevgeaa dlevgaea
dlevgaae dlevgaae dlevgaea dlevaega dlevaeag dlevagea dlevagae dlevaage dlevaaeg dleevaga dleevaag
dleevgaa dleevgaa dleevaga dleevaag dleeavga dleeavag dleeagva dleeagav dleeaagv dleeaavg dleegava
dleegaav dleegvaa dleegvaa dleegava dleegaav dleeaagv dleeaavg dleeagav dleeagva dleeavga dleeavag
dlegveaa dlegveaa dlegvaea dlegvaae dlegvaae dlegvaea dlegevaa dlegevaa dlegeava dlegeaav dlegeaav
dlegeava dlegaeva dlegaeav dlegavea dlegavae dlegaave dlegaaev dlegaeav dlegaeva dlegaaev dlegaave
dlegavae dlegavea dleavega dleaveag dleavgea dleavgae dleavage dleavaeg dleaevga dleaevag dleaegva
dleaegav dleaeagv dleaeavg dleageva dleageav dleagvea dleagvae dleagave dleagaev dleaaegv dleaaevg
dleaagev dleaagve dleaavge dleaaveg dlaevega dlaeveag dlaevgea dlaevgae dlaevage dlaevaeg dlaeevga
dlaeevag dlaeegva dlaeegav dlaeeagv dlaeeavg dlaegeva dlaegeav dlaegvea dlaegvae dlaegave dlaegaev
dlaeaegv dlaeaevg dlaeagev dlaeagve dlaeavge dlaeaveg dlaveega dlaveeag dlavegea dlavegae dlaveage
dlaveaeg dlaveega dlaveeag dlavegea dlavegae dlaveage dlaveaeg dlavgeea dlavgeae dlavgeea dlavgeae
dlavgaee dlavgaee dlavaege dlavaeeg dlavagee dlavagee dlavaege dlavaeeg dlaevega dlaeveag dlaevgea
dlaevgae dlaevage dlaevaeg dlaeevga dlaeevag dlaeegva dlaeegav dlaeeagv dlaeeavg dlaegeva dlaegeav
dlaegvea dlaegvae dlaegave dlaegaev dlaeaegv dlaeaevg dlaeagev dlaeagve dlaeavge dlaeaveg dlagveea
dlagveae dlagveea dlagveae dlagvaee dlagvaee dlagevea dlagevae dlageeva dlageeav dlageaev dlageave
dlageeva dlageeav dlagevea dlagevae dlageave dlageaev dlagaeev dlagaeve dlagaeev dlagaeve dlagavee
dlagavee dlaavege dlaaveeg dlaavgee dlaavgee dlaavege dlaaveeg dlaaevge dlaaeveg dlaaegve dlaaegev
dlaaeegv dlaaeevg dlaageve dlaageev dlaagvee dlaagvee dlaageve dlaageev dlaaeegv dlaaeevg dlaaegev
dlaaegve dlaaevge dlaaeveg dlvaeega dlvaeeag dlvaegea dlvaegae dlvaeage dlvaeaeg dlvaeega dlvaeeag
dlvaegea dlvaegae dlvaeage dlvaeaeg dlvageea dlvageae dlvageea dlvageae dlvagaee dlvagaee dlvaaege
dlvaaeeg dlvaagee dlvaagee dlvaaege dlvaaeeg dlveaega dlveaeag dlveagea dlveagae dlveaage dlveaaeg
dlveeaga dlveeaag dlveegaa dlveegaa dlveeaga dlveeaag dlvegeaa dlvegeaa dlvegaea dlvegaae dlvegaae
dlvegaea dlveaega dlveaeag dlveagea dlveagae dlveaage dlveaaeg dlveeaga dlveeaag dlveegaa dlveegaa
dlveeaga dlveeaag dlveaega dlveaeag dlveagea dlveagae dlveaage dlveaaeg dlvegaea dlvegaae dlvegeaa
dlvegeaa dlvegaea dlvegaae dlveaage dlveaaeg dlveagae dlveagea dlveaega dlveaeag dlvgeeaa dlvgeeaa
dlvgeaea dlvgeaae dlvgeaae dlvgeaea dlvgeeaa dlvgeeaa dlvgeaea dlvgeaae dlvgeaae dlvgeaea dlvgaeea
dlvgaeae dlvgaeea dlvgaeae dlvgaaee dlvgaaee dlvgaeae dlvgaeea dlvgaaee dlvgaaee dlvgaeae dlvgaeea
dlvaeega dlvaeeag dlvaegea dlvaegae dlvaeage dlvaeaeg dlvaeega dlvaeeag dlvaegea dlvaegae dlvaeage
dlvaeaeg dlvageea dlvageae dlvageea dlvageae dlvagaee dlvagaee dlvaaege dlvaaeeg dlvaagee dlvaagee
dlvaaege dlvaaeeg dleavega dleaveag dleavgea dleavgae dleavage dleavaeg dleaevga dleaevag dleaegva
dleaegav dleaeagv dleaeavg dleageva dleageav dleagvea dleagvae dleagave dleagaev dleaaegv dleaaevg
dleaagev dleaagve dleaavge dleaaveg dlevaega dlevaeag dlevagea dlevagae dlevaage dlevaaeg dleveaga
dleveaag dlevegaa dlevegaa dleveaga dleveaag dlevgeaa dlevgeaa dlevgaea dlevgaae dlevgaae dlevgaea
dlevaega dlevaeag dlevagea dlevagae dlevaage dlevaaeg dleevaga dleevaag dleevgaa dleevgaa dleevaga
dleevaag dleeavga dleeavag dleeagva dleeagav dleeaagv dleeaavg dleegava dleegaav dleegvaa dleegvaa
dleegava dleegaav dleeaagv dleeaavg dleeagav dleeagva dleeavga dleeavag dlegveaa dlegveaa dlegvaea
dlegvaae dlegvaae dlegvaea dlegevaa dlegevaa dlegeava dlegeaav dlegeaav dlegeava dlegaeva dlegaeav
dlegavea dlegavae dlegaave dlegaaev dlegaeav dlegaeva dlegaaev dlegaave dlegavae dlegavea dleavega
dleaveag dleavgea dleavgae dleavage dleavaeg dleaevga dleaevag dleaegva dleaegav dleaeagv dleaeavg
dleageva dleageav dleagvea dleagvae dleagave dleagaev dleaaegv dleaaevg dleaagev dleaagve dleaavge
dleaaveg dlgaveea dlgaveae dlgaveea dlgaveae dlgavaee dlgavaee dlgaevea dlgaevae dlgaeeva dlgaeeav
dlgaeaev dlgaeave dlgaeeva dlgaeeav dlgaevea dlgaevae dlgaeave dlgaeaev dlgaaeev dlgaaeve dlgaaeev
dlgaaeve dlgaavee dlgaavee dlgvaeea dlgvaeae dlgvaeea dlgvaeae dlgvaaee dlgvaaee dlgveaea dlgveaae
dlgveeaa dlgveeaa dlgveaea dlgveaae dlgveeaa dlgveeaa dlgveaea dlgveaae dlgveaae dlgveaea dlgvaeea
dlgvaeae dlgvaeea dlgvaeae dlgvaaee dlgvaaee dlgevaea dlgevaae dlgeveaa dlgeveaa dlgevaea dlgevaae
dlgeavea dlgeavae dlgeaeva dlgeaeav dlgeaaev dlgeaave dlgeeava dlgeeaav dlgeevaa dlgeevaa dlgeeava
dlgeeaav dlgeaaev dlgeaave dlgeaeav dlgeaeva dlgeavea dlgeavae dlgeveaa dlgeveaa dlgevaea dlgevaae
dlgevaae dlgevaea dlgeevaa dlgeevaa dlgeeava dlgeeaav dlgeeaav dlgeeava dlgeaeva dlgeaeav dlgeavea
dlgeavae dlgeaave dlgeaaev dlgeaeav dlgeaeva dlgeaaev dlgeaave dlgeavae dlgeavea dlgaveea dlgaveae
dlgaveea dlgaveae dlgavaee dlgavaee dlgaevea dlgaevae dlgaeeva dlgaeeav dlgaeaev dlgaeave dlgaeeva
dlgaeeav dlgaevea dlgaevae dlgaeave dlgaeaev dlgaaeev dlgaaeve dlgaaeev dlgaaeve dlgaavee dlgaavee
dlaavege dlaaveeg dlaavgee dlaavgee dlaavege dlaaveeg dlaaevge dlaaeveg dlaaegve dlaaegev dlaaeegv
dlaaeevg dlaageve dlaageev dlaagvee dlaagvee dlaageve dlaageev dlaaeegv dlaaeevg dlaaegev dlaaegve
dlaaevge dlaaeveg dlavaege dlavaeeg dlavagee dlavagee dlavaege dlavaeeg dlaveage dlaveaeg dlavegae
dlavegea dlaveega dlaveeag dlavgeae dlavgeea dlavgaee dlavgaee dlavgeae dlavgeea dlaveega dlaveeag
dlavegea dlavegae dlaveage dlaveaeg dlaevage dlaevaeg dlaevgae dlaevgea dlaevega dlaeveag dlaeavge
dlaeaveg dlaeagve dlaeagev dlaeaegv dlaeaevg dlaegave dlaegaev dlaegvae dlaegvea dlaegeva dlaegeav
dlaeeagv dlaeeavg dlaeegav dlaeegva dlaeevga dlaeevag dlagveae dlagveea dlagvaee dlagvaee dlagveae
dlagveea dlagevae dlagevea dlageave dlageaev dlageeav dlageeva dlagaeve dlagaeev dlagavee dlagavee
dlagaeve dlagaeev dlageeav dlageeva dlageaev dlageave dlagevae dlagevea dlaevega dlaeveag dlaevgea
dlaevgae dlaevage dlaevaeg dlaeevga dlaeevag dlaeegva dlaeegav dlaeeagv dlaeeavg dlaegeva dlaegeav
dlaegvea dlaegvae dlaegave dlaegaev dlaeaegv dlaeaevg dlaeagev dlaeagve dlaeavge dlaeaveg dalevega
daleveag dalevgea dalevgae dalevage dalevaeg daleevga daleevag daleegva daleegav daleeagv daleeavg
dalegeva dalegeav dalegvea dalegvae dalegave dalegaev daleaegv daleaevg daleagev daleagve daleavge
daleaveg dalveega dalveeag dalvegea dalvegae dalveage dalveaeg dalveega dalveeag dalvegea dalvegae
dalveage dalveaeg dalvgeea dalvgeae dalvgeea dalvgeae dalvgaee dalvgaee dalvaege dalvaeeg dalvagee
dalvagee dalvaege dalvaeeg dalevega daleveag dalevgea dalevgae dalevage dalevaeg daleevga daleevag
daleegva daleegav daleeagv daleeavg dalegeva dalegeav dalegvea dalegvae dalegave dalegaev daleaegv
daleaevg daleagev daleagve daleavge daleaveg dalgveea dalgveae dalgveea dalgveae dalgvaee dalgvaee
dalgevea dalgevae dalgeeva dalgeeav dalgeaev dalgeave dalgeeva dalgeeav dalgevea dalgevae dalgeave
dalgeaev dalgaeev dalgaeve dalgaeev dalgaeve dalgavee dalgavee dalavege dalaveeg dalavgee dalavgee
dalavege dalaveeg dalaevge dalaeveg dalaegve dalaegev dalaeegv dalaeevg dalageve dalageev dalagvee
dalagvee dalageve dalageev dalaeegv dalaeevg dalaegev dalaegve dalaevge dalaeveg daelvega daelveag
daelvgea daelvgae daelvage daelvaeg daelevga daelevag daelegva daelegav daeleagv daeleavg daelgeva
daelgeav daelgvea daelgvae daelgave daelgaev daelaegv daelaevg daelagev daelagve daelavge daelaveg
daevlega daevleag daevlgea daevlgae daevlage daevlaeg daevelga daevelag daevegla daevegal daeveagl
daevealg daevgela daevgeal daevglea daevglae daevgale daevgael daevaegl daevaelg daevagel daevagle
daevalge daevaleg daeevlga daeevlag daeevgla daeevgal daeevagl daeevalg daeelvga daeelvag daeelgva
daeelgav daeelagv daeelavg daeeglva daeeglav daeegvla daeegval daeegavl daeegalv daeealgv daeealvg
daeeaglv daeeagvl daeeavgl daeeavlg daegvela daegveal daegvlea daegvlae daegvale daegvael daegevla
daegeval daegelva daegelav daegealv daegeavl daegleva daegleav daeglvea daeglvae daeglave daeglaev
daegaelv daegaevl daegalev daegalve daegavle daegavel daeavegl daeavelg daeavgel daeavgle daeavlge
daeavleg daeaevgl daeaevlg daeaegvl daeaeglv daeaelgv daeaelvg daeagevl daeagelv daeagvel daeagvle
daeaglve daeaglev daealegv daealevg daealgev daealgve daealvge daealveg davelega daveleag davelgea
davelgae davelage davelaeg daveelga daveelag daveegla daveegal daveeagl daveealg davegela davegeal
daveglea daveglae davegale davegael daveaegl daveaelg daveagel daveagle davealge davealeg davleega
davleeag davlegea davlegae davleage davleaeg davleega davleeag davlegea davlegae davleage davleaeg
davlgeea davlgeae davlgeea davlgeae davlgaee davlgaee davlaege davlaeeg davlagee davlagee davlaege
davlaeeg davelega daveleag davelgea davelgae davelage davelaeg daveelga daveelag daveegla daveegal
daveeagl daveealg davegela davegeal daveglea daveglae davegale davegael daveaegl daveaelg daveagel
daveagle davealge davealeg davgleea davgleae davgleea davgleae davglaee davglaee davgelea davgelae
davgeela davgeeal davgeael davgeale davgeela davgeeal davgelea davgelae davgeale davgeael davgaeel
davgaele davgaeel davgaele davgalee davgalee davalege davaleeg davalgee davalgee davalege davaleeg
davaelge davaeleg davaegle davaegel davaeegl davaeelg davagele davageel davaglee davaglee davagele
davageel davaeegl davaeelg davaegel davaegle davaelge davaeleg daeevlga daeevlag daeevgla daeevgal
daeevagl daeevalg daeelvga daeelvag daeelgva daeelgav daeelagv daeelavg daeeglva daeeglav daeegvla
daeegval daeegavl daeegalv daeealgv daeealvg daeeaglv daeeagvl daeeavgl daeeavlg daevelga daevelag
daevegla daevegal daeveagl daevealg daevlega daevleag daevlgea daevlgae daevlage daevlaeg daevglea
daevglae daevgela daevgeal daevgael daevgale daevalge daevaleg daevagle daevagel daevaegl daevaelg
daelvega daelveag daelvgea daelvgae daelvage daelvaeg daelevga daelevag daelegva daelegav daeleagv
daeleavg daelgeva daelgeav daelgvea daelgvae daelgave daelgaev daelaegv daelaevg daelagev daelagve
daelavge daelaveg daegvlea daegvlae daegvela daegveal daegvael daegvale daeglvea daeglvae daegleva
daegleav daeglaev daeglave daegelva daegelav daegevla daegeval daegeavl daegealv daegalev daegalve
daegaelv daegaevl daegavel daegavle daeavlge daeavleg daeavgle daeavgel daeavegl daeavelg daealvge
daealveg daealgve daealgev daealegv daealevg daeaglve daeaglev daeagvle daeagvel daeagevl daeagelv
daeaelgv daeaelvg daeaeglv daeaegvl daeaevgl daeaevlg dagevela dageveal dagevlea dagevlae dagevale
dagevael dageevla dageeval dageelva dageelav dageealv dageeavl dageleva dageleav dagelvea dagelvae
dagelave dagelaev dageaelv dageaevl dagealev dagealve dageavle dageavel dagveela dagveeal dagvelea
dagvelae dagveale dagveael dagveela dagveeal dagvelea dagvelae dagveale dagveael dagvleea dagvleae
dagvleea dagvleae dagvlaee dagvlaee dagvaele dagvaeel dagvalee dagvalee dagvaele dagvaeel dagevela
dageveal dagevlea dagevlae dagevale dagevael dageevla dageeval dageelva dageelav dageealv dageeavl
dageleva dageleav dagelvea dagelvae dagelave dagelaev dageaelv dageaevl dagealev dagealve dageavle
dageavel daglveea daglveae daglveea daglveae daglvaee daglvaee daglevea daglevae dagleeva dagleeav
dagleaev dagleave dagleeva dagleeav daglevea daglevae dagleave dagleaev daglaeev daglaeve daglaeev
daglaeve daglavee daglavee dagavele dagaveel dagavlee dagavlee dagavele dagaveel dagaevle dagaevel
dagaelve dagaelev dagaeelv dagaeevl dagaleve dagaleev dagalvee dagalvee dagaleve dagaleev dagaeelv
dagaeevl dagaelev dagaelve dagaevle dagaevel daaevegl daaevelg daaevgel daaevgle daaevlge daaevleg
daaeevgl daaeevlg daaeegvl daaeeglv daaeelgv daaeelvg daaegevl daaegelv daaegvel daaegvle daaeglve
daaeglev daaelegv daaelevg daaelgev daaelgve daaelvge daaelveg daaveegl daaveelg daavegel daavegle
daavelge daaveleg daaveegl daaveelg daavegel daavegle daavelge daaveleg daavgeel daavgele daavgeel
daavgele daavglee daavglee daavlege daavleeg daavlgee daavlgee daavlege daavleeg daaevegl daaevelg
daaevgel daaevgle daaevlge daaevleg daaeevgl daaeevlg daaeegvl daaeeglv daaeelgv daaeelvg daaegevl
daaegelv daaegvel daaegvle daaeglve daaeglev daaelegv daaelevg daaelgev daaelgve daaelvge daaelveg
daagveel daagvele daagveel daagvele daagvlee daagvlee daagevel daagevle daageevl daageelv daagelev
daagelve daageevl daageelv daagevel daagevle daagelve daagelev daagleev daagleve daagleev daagleve
daaglvee daaglvee daalvege daalveeg daalvgee daalvgee daalvege daalveeg daalevge daaleveg daalegve
daalegev daaleegv daaleevg daalgeve daalgeev daalgvee daalgvee daalgeve daalgeev daaleegv daaleevg
daalegev daalegve daalevge daaleveg dvlaeega dvlaeeag dvlaegea dvlaegae dvlaeage dvlaeaeg dvlaeega
dvlaeeag dvlaegea dvlaegae dvlaeage dvlaeaeg dvlageea dvlageae dvlageea dvlageae dvlagaee dvlagaee
dvlaaege dvlaaeeg dvlaagee dvlaagee dvlaaege dvlaaeeg dvleaega dvleaeag dvleagea dvleagae dvleaage
dvleaaeg dvleeaga dvleeaag dvleegaa dvleegaa dvleeaga dvleeaag dvlegeaa dvlegeaa dvlegaea dvlegaae
dvlegaae dvlegaea dvleaega dvleaeag dvleagea dvleagae dvleaage dvleaaeg dvleeaga dvleeaag dvleegaa
dvleegaa dvleeaga dvleeaag dvleaega dvleaeag dvleagea dvleagae dvleaage dvleaaeg dvlegaea dvlegaae
dvlegeaa dvlegeaa dvlegaea dvlegaae dvleaage dvleaaeg dvleagae dvleagea dvleaega dvleaeag dvlgeeaa
dvlgeeaa dvlgeaea dvlgeaae dvlgeaae dvlgeaea dvlgeeaa dvlgeeaa dvlgeaea dvlgeaae dvlgeaae dvlgeaea
dvlgaeea dvlgaeae dvlgaeea dvlgaeae dvlgaaee dvlgaaee dvlgaeae dvlgaeea dvlgaaee dvlgaaee dvlgaeae
dvlgaeea dvlaeega dvlaeeag dvlaegea dvlaegae dvlaeage dvlaeaeg dvlaeega dvlaeeag dvlaegea dvlaegae
dvlaeage dvlaeaeg dvlageea dvlageae dvlageea dvlageae dvlagaee dvlagaee dvlaaege dvlaaeeg dvlaagee
dvlaagee dvlaaege dvlaaeeg dvaleega dvaleeag dvalegea dvalegae dvaleage dvaleaeg dvaleega dvaleeag
dvalegea dvalegae dvaleage dvaleaeg dvalgeea dvalgeae dvalgeea dvalgeae dvalgaee dvalgaee dvalaege
dvalaeeg dvalagee dvalagee dvalaege dvalaeeg dvaelega dvaeleag dvaelgea dvaelgae dvaelage dvaelaeg
dvaeelga dvaeelag dvaeegla dvaeegal dvaeeagl dvaeealg dvaegela dvaegeal dvaeglea dvaeglae dvaegale
dvaegael dvaeaegl dvaeaelg dvaeagel dvaeagle dvaealge dvaealeg dvaeelga dvaeelag dvaeegla dvaeegal
dvaeeagl dvaeealg dvaelega dvaeleag dvaelgea dvaelgae dvaelage dvaelaeg dvaeglea dvaeglae dvaegela
dvaegeal dvaegael dvaegale dvaealge dvaealeg dvaeagle dvaeagel dvaeaegl dvaeaelg dvageela dvageeal
dvagelea dvagelae dvageale dvageael dvageela dvageeal dvagelea dvagelae dvageale dvageael dvagleea
dvagleae dvagleea dvagleae dvaglaee dvaglaee dvagaele dvagaeel dvagalee dvagalee dvagaele dvagaeel
dvaaeegl dvaaeelg dvaaegel dvaaegle dvaaelge dvaaeleg dvaaeegl dvaaeelg dvaaegel dvaaegle dvaaelge
dvaaeleg dvaageel dvaagele dvaageel dvaagele dvaaglee dvaaglee dvaalege dvaaleeg dvaalgee dvaalgee
dvaalege dvaaleeg dvealega dvealeag dvealgea dvealgae dvealage dvealaeg dveaelga dveaelag dveaegla
dveaegal dveaeagl dveaealg dveagela dveageal dveaglea dveaglae dveagale dveagael dveaaegl dveaaelg
dveaagel dveaagle dveaalge dveaaleg dvelaega dvelaeag dvelagea dvelagae dvelaage dvelaaeg dveleaga
dveleaag dvelegaa dvelegaa dveleaga dveleaag dvelgeaa dvelgeaa dvelgaea dvelgaae dvelgaae dvelgaea
dvelaega dvelaeag dvelagea dvelagae dvelaage dvelaaeg dveelaga dveelaag dveelgaa dveelgaa dveelaga
dveelaag dveealga dveealag dveeagla dveeagal dveeaagl dveeaalg dveegala dveegaal dveeglaa dveeglaa
dveegala dveegaal dveeaagl dveeaalg dveeagal dveeagla dveealga dveealag dvegleaa dvegleaa dveglaea
dveglaae dveglaae dveglaea dvegelaa dvegelaa dvegeala dvegeaal dvegeaal dvegeala dvegaela dvegaeal
dvegalea dvegalae dvegaale dvegaael dvegaeal dvegaela dvegaael dvegaale dvegalae dvegalea dvealega
dvealeag dvealgea dvealgae dvealage dvealaeg dveaelga dveaelag dveaegla dveaegal dveaeagl dveaealg
dveagela dveageal dveaglea dveaglae dveagale dveagael dveaaegl dveaaelg dveaagel dveaagle dveaalge
dveaaleg dveaelga dveaelag dveaegla dveaegal dveaeagl dveaealg dvealega dvealeag dvealgea dvealgae
dvealage dvealaeg dveaglea dveaglae dveagela dveageal dveagael dveagale dveaalge dveaaleg dveaagle
dveaagel dveaaegl dveaaelg dveealga dveealag dveeagla dveeagal dveeaagl dveeaalg dveelaga dveelaag
dveelgaa dveelgaa dveelaga dveelaag dveeglaa dveeglaa dveegala dveegaal dveegaal dveegala dveealga
dveealag dveeagla dveeagal dveeaagl dveeaalg dveleaga dveleaag dvelegaa dvelegaa dveleaga dveleaag
dvelaega dvelaeag dvelagea dvelagae dvelaage dvelaaeg dvelgaea dvelgaae dvelgeaa dvelgeaa dvelgaea
dvelgaae dvelaage dvelaaeg dvelagae dvelagea dvelaega dvelaeag dvegelaa dvegelaa dvegeala dvegeaal
dvegeaal dvegeala dvegleaa dvegleaa dveglaea dveglaae dveglaae dveglaea dvegalea dvegalae dvegaela
dvegaeal dvegaael dvegaale dvegalae dvegalea dvegaale dvegaael dvegaeal dvegaela dveaelga dveaelag
dveaegla dveaegal dveaeagl dveaealg dvealega dvealeag dvealgea dvealgae dvealage dvealaeg dveaglea
dveaglae dveagela dveageal dveagael dveagale dveaalge dveaaleg dveaagle dveaagel dveaaegl dveaaelg
dvgaeela dvgaeeal dvgaelea dvgaelae dvgaeale dvgaeael dvgaeela dvgaeeal dvgaelea dvgaelae dvgaeale
dvgaeael dvgaleea dvgaleae dvgaleea dvgaleae dvgalaee dvgalaee dvgaaele dvgaaeel dvgaalee dvgaalee
dvgaaele dvgaaeel dvgeaela dvgeaeal dvgealea dvgealae dvgeaale dvgeaael dvgeeala dvgeeaal dvgeelaa
dvgeelaa dvgeeala dvgeeaal dvgeleaa dvgeleaa dvgelaea dvgelaae dvgelaae dvgelaea dvgeaela dvgeaeal
dvgealea dvgealae dvgeaale dvgeaael dvgeeala dvgeeaal dvgeelaa dvgeelaa dvgeeala dvgeeaal dvgeaela
dvgeaeal dvgealea dvgealae dvgeaale dvgeaael dvgelaea dvgelaae dvgeleaa dvgeleaa dvgelaea dvgelaae
dvgeaale dvgeaael dvgealae dvgealea dvgeaela dvgeaeal dvgleeaa dvgleeaa dvgleaea dvgleaae dvgleaae
dvgleaea dvgleeaa dvgleeaa dvgleaea dvgleaae dvgleaae dvgleaea dvglaeea dvglaeae dvglaeea dvglaeae
dvglaaee dvglaaee dvglaeae dvglaeea dvglaaee dvglaaee dvglaeae dvglaeea dvgaeela dvgaeeal dvgaelea
dvgaelae dvgaeale dvgaeael dvgaeela dvgaeeal dvgaelea dvgaelae dvgaeale dvgaeael dvgaleea dvgaleae
dvgaleea dvgaleae dvgalaee dvgalaee dvgaaele dvgaaeel dvgaalee dvgaalee dvgaaele dvgaaeel dvaaeegl
dvaaeelg dvaaegel dvaaegle dvaaelge dvaaeleg dvaaeegl dvaaeelg dvaaegel dvaaegle dvaaelge dvaaeleg
dvaageel dvaagele dvaageel dvaagele dvaaglee dvaaglee dvaalege dvaaleeg dvaalgee dvaalgee dvaalege
dvaaleeg dvaeaegl dvaeaelg dvaeagel dvaeagle dvaealge dvaealeg dvaeeagl dvaeealg dvaeegal dvaeegla
dvaeelga dvaeelag dvaegeal dvaegela dvaegael dvaegale dvaeglae dvaeglea dvaelega dvaeleag dvaelgea
dvaelgae dvaelage dvaelaeg dvaeeagl dvaeealg dvaeegal dvaeegla dvaeelga dvaeelag dvaeaegl dvaeaelg
dvaeagel dvaeagle dvaealge dvaealeg dvaegael dvaegale dvaegeal dvaegela dvaeglea dvaeglae dvaelage
dvaelaeg dvaelgae dvaelgea dvaelega dvaeleag dvageeal dvageela dvageael dvageale dvagelae dvagelea
dvageeal dvageela dvageael dvageale dvagelae dvagelea dvagaeel dvagaele dvagaeel dvagaele dvagalee
dvagalee dvagleae dvagleea dvaglaee dvaglaee dvagleae dvagleea dvaleega dvaleeag dvalegea dvalegae
dvaleage dvaleaeg dvaleega dvaleeag dvalegea dvalegae dvaleage dvaleaeg dvalgeea dvalgeae dvalgeea
dvalgeae dvalgaee dvalgaee dvalaege dvalaeeg dvalagee dvalagee dvalaege dvalaeeg delavega delaveag
delavgea delavgae delavage delavaeg delaevga delaevag delaegva delaegav delaeagv delaeavg delageva
delageav delagvea delagvae delagave delagaev delaaegv delaaevg delaagev delaagve delaavge delaaveg
delvaega delvaeag delvagea delvagae delvaage delvaaeg delveaga delveaag delvegaa delvegaa delveaga
delveaag delvgeaa delvgeaa delvgaea delvgaae delvgaae delvgaea delvaega delvaeag delvagea delvagae
delvaage delvaaeg delevaga delevaag delevgaa delevgaa delevaga delevaag deleavga deleavag deleagva
deleagav deleaagv deleaavg delegava delegaav delegvaa delegvaa delegava delegaav deleaagv deleaavg
deleagav deleagva deleavga deleavag delgveaa delgveaa delgvaea delgvaae delgvaae delgvaea delgevaa
delgevaa delgeava delgeaav delgeaav delgeava delgaeva delgaeav delgavea delgavae delgaave delgaaev
delgaeav delgaeva delgaaev delgaave delgavae delgavea delavega delaveag delavgea delavgae delavage
delavaeg delaevga delaevag delaegva delaegav delaeagv delaeavg delageva delageav delagvea delagvae
delagave delagaev delaaegv delaaevg delaagev delaagve delaavge delaaveg dealvega dealveag dealvgea
dealvgae dealvage dealvaeg dealevga dealevag dealegva dealegav dealeagv dealeavg dealgeva dealgeav
dealgvea dealgvae dealgave dealgaev dealaegv dealaevg dealagev dealagve dealavge dealaveg deavlega
deavleag deavlgea deavlgae deavlage deavlaeg deavelga deavelag deavegla deavegal deaveagl deavealg
deavgela deavgeal deavglea deavglae deavgale deavgael deavaegl deavaelg deavagel deavagle deavalge
deavaleg deaevlga deaevlag deaevgla deaevgal deaevagl deaevalg deaelvga deaelvag deaelgva deaelgav
deaelagv deaelavg deaeglva deaeglav deaegvla deaegval deaegavl deaegalv deaealgv deaealvg deaeaglv
deaeagvl deaeavgl deaeavlg deagvela deagveal deagvlea deagvlae deagvale deagvael deagevla deageval
deagelva deagelav deagealv deageavl deagleva deagleav deaglvea deaglvae deaglave deaglaev deagaelv
deagaevl deagalev deagalve deagavle deagavel deaavegl deaavelg deaavgel deaavgle deaavlge deaavleg
deaaevgl deaaevlg deaaegvl deaaeglv deaaelgv deaaelvg deaagevl deaagelv deaagvel deaagvle deaaglve
deaaglev deaalegv deaalevg deaalgev deaalgve deaalvge deaalveg devalega devaleag devalgea devalgae
devalage devalaeg devaelga devaelag devaegla devaegal devaeagl devaealg devagela devageal devaglea
devaglae devagale devagael devaaegl devaaelg devaagel devaagle devaalge devaaleg devlaega devlaeag
devlagea devlagae devlaage devlaaeg devleaga devleaag devlegaa devlegaa devleaga devleaag devlgeaa
devlgeaa devlgaea devlgaae devlgaae devlgaea devlaega devlaeag devlagea devlagae devlaage devlaaeg
develaga develaag develgaa develgaa develaga develaag devealga devealag deveagla deveagal deveaagl
deveaalg devegala devegaal deveglaa deveglaa devegala devegaal deveaagl deveaalg deveagal deveagla
devealga devealag devgleaa devgleaa devglaea devglaae devglaae devglaea devgelaa devgelaa devgeala
devgeaal devgeaal devgeala devgaela devgaeal devgalea devgalae devgaale devgaael devgaeal devgaela
devgaael devgaale devgalae devgalea devalega devaleag devalgea devalgae devalage devalaeg devaelga
devaelag devaegla devaegal devaeagl devaealg devagela devageal devaglea devaglae devagale devagael
devaaegl devaaelg devaagel devaagle devaalge devaaleg deeavlga deeavlag deeavgla deeavgal deeavagl
deeavalg deealvga deealvag deealgva deealgav deealagv deealavg deeaglva deeaglav deeagvla deeagval
deeagavl deeagalv deeaalgv deeaalvg deeaaglv deeaagvl deeaavgl deeaavlg deevalga deevalag deevagla
deevagal deevaagl deevaalg deevlaga deevlaag deevlgaa deevlgaa deevlaga deevlaag deevglaa deevglaa
deevgala deevgaal deevgaal deevgala deevalga deevalag deevagla deevagal deevaagl deevaalg deelvaga
deelvaag deelvgaa deelvgaa deelvaga deelvaag deelavga deelavag deelagva deelagav deelaagv deelaavg
deelgava deelgaav deelgvaa deelgvaa deelgava deelgaav deelaagv deelaavg deelagav deelagva deelavga
deelavag deegvlaa deegvlaa deegvala deegvaal deegvaal deegvala deeglvaa deeglvaa deeglava deeglaav
deeglaav deeglava deegalva deegalav deegavla deegaval deegaavl deegaalv deegalav deegalva deegaalv
deegaavl deegaval deegavla deeavlga deeavlag deeavgla deeavgal deeavagl deeavalg deealvga deealvag
deealgva deealgav deealagv deealavg deeaglva deeaglav deeagvla deeagval deeagavl deeagalv deeaalgv
deeaalvg deeaaglv deeaagvl deeaavgl deeaavlg degavela degaveal degavlea degavlae degavale degavael
degaevla degaeval degaelva degaelav degaealv degaeavl degaleva degaleav degalvea degalvae degalave
degalaev degaaelv degaaevl degaalev degaalve degaavle degaavel degvaela degvaeal degvalea degvalae
degvaale degvaael degveala degveaal degvelaa degvelaa degveala degveaal degvleaa degvleaa degvlaea
degvlaae degvlaae degvlaea degvaela degvaeal degvalea degvalae degvaale degvaael degevala degevaal
degevlaa degevlaa degevala degevaal degeavla degeaval degealva degealav degeaalv degeaavl degelava
degelaav degelvaa degelvaa degelava degelaav degeaalv degeaavl degealav degealva degeavla degeaval
deglveaa deglveaa deglvaea deglvaae deglvaae deglvaea deglevaa deglevaa degleava degleaav degleaav
degleava deglaeva deglaeav deglavea deglavae deglaave deglaaev deglaeav deglaeva deglaaev deglaave
deglavae deglavea degavela degaveal degavlea degavlae degavale degavael degaevla degaeval degaelva
degaelav degaealv degaeavl degaleva degaleav degalvea degalvae degalave degalaev degaaelv degaaevl
degaalev degaalve degaavle degaavel deaavegl deaavelg deaavgel deaavgle deaavlge deaavleg deaaevgl
deaaevlg deaaegvl deaaeglv deaaelgv deaaelvg deaagevl deaagelv deaagvel deaagvle deaaglve deaaglev
deaalegv deaalevg deaalgev deaalgve deaalvge deaalveg deavaegl deavaelg deavagel deavagle deavalge
deavaleg deaveagl deavealg deavegal deavegla deavelga deavelag deavgeal deavgela deavgael deavgale
deavglae deavglea deavlega deavleag deavlgea deavlgae deavlage deavlaeg deaevagl deaevalg deaevgal
deaevgla deaevlga deaevlag deaeavgl deaeavlg deaeagvl deaeaglv deaealgv deaealvg deaegavl deaegalv
deaegval deaegvla deaeglva deaeglav deaelagv deaelavg deaelgav deaelgva deaelvga deaelvag deagveal
deagvela deagvael deagvale deagvlae deagvlea deageval deagevla deageavl deagealv deagelav deagelva
deagaevl deagaelv deagavel deagavle deagalve deagalev deagleav deagleva deaglaev deaglave deaglvae
deaglvea dealvega dealveag dealvgea dealvgae dealvage dealvaeg dealevga dealevag dealegva dealegav
dealeagv dealeavg dealgeva dealgeav dealgvea dealgvae dealgave dealgaev dealaegv dealaevg dealagev
dealagve dealavge dealaveg dglaveea dglaveae dglaveea dglaveae dglavaee dglavaee dglaevea dglaevae
dglaeeva dglaeeav dglaeaev dglaeave dglaeeva dglaeeav dglaevea dglaevae dglaeave dglaeaev dglaaeev
dglaaeve dglaaeev dglaaeve dglaavee dglaavee dglvaeea dglvaeae dglvaeea dglvaeae dglvaaee dglvaaee
dglveaea dglveaae dglveeaa dglveeaa dglveaea dglveaae dglveeaa dglveeaa dglveaea dglveaae dglveaae
dglveaea dglvaeea dglvaeae dglvaeea dglvaeae dglvaaee dglvaaee dglevaea dglevaae dgleveaa dgleveaa
dglevaea dglevaae dgleavea dgleavae dgleaeva dgleaeav dgleaaev dgleaave dgleeava dgleeaav dgleevaa
dgleevaa dgleeava dgleeaav dgleaaev dgleaave dgleaeav dgleaeva dgleavea dgleavae dgleveaa dgleveaa
dglevaea dglevaae dglevaae dglevaea dgleevaa dgleevaa dgleeava dgleeaav dgleeaav dgleeava dgleaeva
dgleaeav dgleavea dgleavae dgleaave dgleaaev dgleaeav dgleaeva dgleaaev dgleaave dgleavae dgleavea
dglaveea dglaveae dglaveea dglaveae dglavaee dglavaee dglaevea dglaevae dglaeeva dglaeeav dglaeaev
dglaeave dglaeeva dglaeeav dglaevea dglaevae dglaeave dglaeaev dglaaeev dglaaeve dglaaeev dglaaeve
dglaavee dglaavee dgalveea dgalveae dgalveea dgalveae dgalvaee dgalvaee dgalevea dgalevae dgaleeva
dgaleeav dgaleaev dgaleave dgaleeva dgaleeav dgalevea dgalevae dgaleave dgaleaev dgalaeev dgalaeve
dgalaeev dgalaeve dgalavee dgalavee dgavleea dgavleae dgavleea dgavleae dgavlaee dgavlaee dgavelea
dgavelae dgaveela dgaveeal dgaveael dgaveale dgaveela dgaveeal dgavelea dgavelae dgaveale dgaveael
dgavaeel dgavaele dgavaeel dgavaele dgavalee dgavalee dgaevlea dgaevlae dgaevela dgaeveal dgaevael
dgaevale dgaelvea dgaelvae dgaeleva dgaeleav dgaelaev dgaelave dgaeelva dgaeelav dgaeevla dgaeeval
dgaeeavl dgaeealv dgaealev dgaealve dgaeaelv dgaeaevl dgaeavel dgaeavle dgaevela dgaeveal dgaevlea
dgaevlae dgaevale dgaevael dgaeevla dgaeeval dgaeelva dgaeelav dgaeealv dgaeeavl dgaeleva dgaeleav
dgaelvea dgaelvae dgaelave dgaelaev dgaeaelv dgaeaevl dgaealev dgaealve dgaeavle dgaeavel dgaaveel
dgaavele dgaaveel dgaavele dgaavlee dgaavlee dgaaevel dgaaevle dgaaeevl dgaaeelv dgaaelev dgaaelve
dgaaeevl dgaaeelv dgaaevel dgaaevle dgaaelve dgaaelev dgaaleev dgaaleve dgaaleev dgaaleve dgaalvee
dgaalvee dgvaleea dgvaleae dgvaleea dgvaleae dgvalaee dgvalaee dgvaelea dgvaelae dgvaeela dgvaeeal
dgvaeael dgvaeale dgvaeela dgvaeeal dgvaelea dgvaelae dgvaeale dgvaeael dgvaaeel dgvaaele dgvaaeel
dgvaaele dgvaalee dgvaalee dgvlaeea dgvlaeae dgvlaeea dgvlaeae dgvlaaee dgvlaaee dgvleaea dgvleaae
dgvleeaa dgvleeaa dgvleaea dgvleaae dgvleeaa dgvleeaa dgvleaea dgvleaae dgvleaae dgvleaea dgvlaeea
dgvlaeae dgvlaeea dgvlaeae dgvlaaee dgvlaaee dgvelaea dgvelaae dgveleaa dgveleaa dgvelaea dgvelaae
dgvealea dgvealae dgveaela dgveaeal dgveaael dgveaale dgveeala dgveeaal dgveelaa dgveelaa dgveeala
dgveeaal dgveaael dgveaale dgveaeal dgveaela dgvealea dgvealae dgveleaa dgveleaa dgvelaea dgvelaae
dgvelaae dgvelaea dgveelaa dgveelaa dgveeala dgveeaal dgveeaal dgveeala dgveaela dgveaeal dgvealea
dgvealae dgveaale dgveaael dgveaeal dgveaela dgveaael dgveaale dgvealae dgvealea dgvaleea dgvaleae
dgvaleea dgvaleae dgvalaee dgvalaee dgvaelea dgvaelae dgvaeela dgvaeeal dgvaeael dgvaeale dgvaeela
dgvaeeal dgvaelea dgvaelae dgvaeale dgvaeael dgvaaeel dgvaaele dgvaaeel dgvaaele dgvaalee dgvaalee
dgeavlea dgeavlae dgeavela dgeaveal dgeavael dgeavale dgealvea dgealvae dgealeva dgealeav dgealaev
dgealave dgeaelva dgeaelav dgeaevla dgeaeval dgeaeavl dgeaealv dgeaalev dgeaalve dgeaaelv dgeaaevl
dgeaavel dgeaavle dgevalea dgevalae dgevaela dgevaeal dgevaael dgevaale dgevlaea dgevlaae dgevleaa
dgevleaa dgevlaea dgevlaae dgevelaa dgevelaa dgeveala dgeveaal dgeveaal dgeveala dgevalea dgevalae
dgevaela dgevaeal dgevaael dgevaale dgelvaea dgelvaae dgelveaa dgelveaa dgelvaea dgelvaae dgelavea
dgelavae dgelaeva dgelaeav dgelaaev dgelaave dgeleava dgeleaav dgelevaa dgelevaa dgeleava dgeleaav
dgelaaev dgelaave dgelaeav dgelaeva dgelavea dgelavae dgeevlaa dgeevlaa dgeevala dgeevaal dgeevaal
dgeevala dgeelvaa dgeelvaa dgeelava dgeelaav dgeelaav dgeelava dgeealva dgeealav dgeeavla dgeeaval
dgeeaavl dgeeaalv dgeealav dgeealva dgeeaalv dgeeaavl dgeeaval dgeeavla dgeavlea dgeavlae dgeavela
dgeaveal dgeavael dgeavale dgealvea dgealvae dgealeva dgealeav dgealaev dgealave dgeaelva dgeaelav
dgeaevla dgeaeval dgeaeavl dgeaealv dgeaalev dgeaalve dgeaaelv dgeaaevl dgeaavel dgeaavle dgeavela
dgeaveal dgeavlea dgeavlae dgeavale dgeavael dgeaevla dgeaeval dgeaelva dgeaelav dgeaealv dgeaeavl
dgealeva dgealeav dgealvea dgealvae dgealave dgealaev dgeaaelv dgeaaevl dgeaalev dgeaalve dgeaavle
dgeaavel dgevaela dgevaeal dgevalea dgevalae dgevaale dgevaael dgeveala dgeveaal dgevelaa dgevelaa
dgeveala dgeveaal dgevleaa dgevleaa dgevlaea dgevlaae dgevlaae dgevlaea dgevaela dgevaeal dgevalea
dgevalae dgevaale dgevaael dgeevala dgeevaal dgeevlaa dgeevlaa dgeevala dgeevaal dgeeavla dgeeaval
dgeealva dgeealav dgeeaalv dgeeaavl dgeelava dgeelaav dgeelvaa dgeelvaa dgeelava dgeelaav dgeeaalv
dgeeaavl dgeealav dgeealva dgeeavla dgeeaval dgelveaa dgelveaa dgelvaea dgelvaae dgelvaae dgelvaea
dgelevaa dgelevaa dgeleava dgeleaav dgeleaav dgeleava dgelaeva dgelaeav dgelavea dgelavae dgelaave
dgelaaev dgelaeav dgelaeva dgelaaev dgelaave dgelavae dgelavea dgeavela dgeaveal dgeavlea dgeavlae
dgeavale dgeavael dgeaevla dgeaeval dgeaelva dgeaelav dgeaealv dgeaeavl dgealeva dgealeav dgealvea
dgealvae dgealave dgealaev dgeaaelv dgeaaevl dgeaalev dgeaalve dgeaavle dgeaavel dgaaveel dgaavele
dgaaveel dgaavele dgaavlee dgaavlee dgaaevel dgaaevle dgaaeevl dgaaeelv dgaaelev dgaaelve dgaaeevl
dgaaeelv dgaaevel dgaaevle dgaaelve dgaaelev dgaaleev dgaaleve dgaaleev dgaaleve dgaalvee dgaalvee
dgavaeel dgavaele dgavaeel dgavaele dgavalee dgavalee dgaveael dgaveale dgaveeal dgaveela dgavelea
dgavelae dgaveeal dgaveela dgaveael dgaveale dgavelae dgavelea dgavleea dgavleae dgavleea dgavleae
dgavlaee dgavlaee dgaevael dgaevale dgaeveal dgaevela dgaevlea dgaevlae dgaeavel dgaeavle dgaeaevl
dgaeaelv dgaealev dgaealve dgaeeavl dgaeealv dgaeeval dgaeevla dgaeelva dgaeelav dgaelaev dgaelave
dgaeleav dgaeleva dgaelvea dgaelvae dgaeveal dgaevela dgaevael dgaevale dgaevlae dgaevlea dgaeeval
dgaeevla dgaeeavl dgaeealv dgaeelav dgaeelva dgaeaevl dgaeaelv dgaeavel dgaeavle dgaealve dgaealev
dgaeleav dgaeleva dgaelaev dgaelave dgaelvae dgaelvea dgalveea dgalveae dgalveea dgalveae dgalvaee
dgalvaee dgalevea dgalevae dgaleeva dgaleeav dgaleaev dgaleave dgaleeva dgaleeav dgalevea dgalevae
dgaleave dgaleaev dgalaeev dgalaeve dgalaeev dgalaeve dgalavee dgalavee dalavege dalaveeg dalavgee
dalavgee dalavege dalaveeg dalaevge dalaeveg dalaegve dalaegev dalaeegv dalaeevg dalageve dalageev
dalagvee dalagvee dalageve dalageev dalaeegv dalaeevg dalaegev dalaegve dalaevge dalaeveg dalvaege
dalvaeeg dalvagee dalvagee dalvaege dalvaeeg dalveage dalveaeg dalvegae dalvegea dalveega dalveeag
dalvgeae dalvgeea dalvgaee dalvgaee dalvgeae dalvgeea dalveega dalveeag dalvegea dalvegae dalveage
dalveaeg dalevage dalevaeg dalevgae dalevgea dalevega daleveag daleavge daleaveg daleagve daleagev
daleaegv daleaevg dalegave dalegaev dalegvae dalegvea dalegeva dalegeav daleeagv daleeavg daleegav
daleegva daleevga daleevag dalgveae dalgveea dalgvaee dalgvaee dalgveae dalgveea dalgevae dalgevea
dalgeave dalgeaev dalgeeav dalgeeva dalgaeve dalgaeev dalgavee dalgavee dalgaeve dalgaeev dalgeeav
dalgeeva dalgeaev dalgeave dalgevae dalgevea dalevega daleveag dalevgea dalevgae dalevage dalevaeg
daleevga daleevag daleegva daleegav daleeagv daleeavg dalegeva dalegeav dalegvea dalegvae dalegave
dalegaev daleaegv daleaevg daleagev daleagve daleavge daleaveg daalvege daalveeg daalvgee daalvgee
daalvege daalveeg daalevge daaleveg daalegve daalegev daaleegv daaleevg daalgeve daalgeev daalgvee
daalgvee daalgeve daalgeev daaleegv daaleevg daalegev daalegve daalevge daaleveg daavlege daavleeg
daavlgee daavlgee daavlege daavleeg daavelge daaveleg daavegle daavegel daaveegl daaveelg daavgele
daavgeel daavglee daavglee daavgele daavgeel daaveegl daaveelg daavegel daavegle daavelge daaveleg
daaevlge daaevleg daaevgle daaevgel daaevegl daaevelg daaelvge daaelveg daaelgve daaelgev daaelegv
daaelevg daaeglve daaeglev daaegvle daaegvel daaegevl daaegelv daaeelgv daaeelvg daaeeglv daaeegvl
daaeevgl daaeevlg daagvele daagveel daagvlee daagvlee daagvele daagveel daagevle daagevel daagelve
daagelev daageelv daageevl daagleve daagleev daaglvee daaglvee daagleve daagleev daageelv daageevl
daagelev daagelve daagevle daagevel daaevegl daaevelg daaevgel daaevgle daaevlge daaevleg daaeevgl
daaeevlg daaeegvl daaeeglv daaeelgv daaeelvg daaegevl daaegelv daaegvel daaegvle daaeglve daaeglev
daaelegv daaelevg daaelgev daaelgve daaelvge daaelveg davalege davaleeg davalgee davalgee davalege
davaleeg davaelge davaeleg davaegle davaegel davaeegl davaeelg davagele davageel davaglee davaglee
davagele davageel davaeegl davaeelg davaegel davaegle davaelge davaeleg davlaege davlaeeg davlagee
davlagee davlaege davlaeeg davleage davleaeg davlegae davlegea davleega davleeag davlgeae davlgeea
davlgaee davlgaee davlgeae davlgeea davleega davleeag davlegea davlegae davleage davleaeg davelage
davelaeg davelgae davelgea davelega daveleag davealge davealeg daveagle daveagel daveaegl daveaelg
davegale davegael daveglae daveglea davegela davegeal daveeagl daveealg daveegal daveegla daveelga
daveelag davgleae davgleea davglaee davglaee davgleae davgleea davgelae davgelea davgeale davgeael
davgeeal davgeela davgaele davgaeel davgalee davgalee davgaele davgaeel davgeeal davgeela davgeael
davgeale davgelae davgelea davelega daveleag davelgea davelgae davelage davelaeg daveelga daveelag
daveegla daveegal daveeagl daveealg davegela davegeal daveglea daveglae davegale davegael daveaegl
daveaelg daveagel daveagle davealge davealeg daeavlge daeavleg daeavgle daeavgel daeavegl daeavelg
daealvge daealveg daealgve daealgev daealegv daealevg daeaglve daeaglev daeagvle daeagvel daeagevl
daeagelv daeaelgv daeaelvg daeaeglv daeaegvl daeaevgl daeaevlg daevalge daevaleg daevagle daevagel
daevaegl daevaelg daevlage daevlaeg daevlgae daevlgea daevlega daevleag daevglae daevglea daevgale
daevgael daevgeal daevgela daevelga daevelag daevegla daevegal daeveagl daevealg daelvage daelvaeg
daelvgae daelvgea daelvega daelveag daelavge daelaveg daelagve daelagev daelaegv daelaevg daelgave
daelgaev daelgvae daelgvea daelgeva daelgeav daeleagv daeleavg daelegav daelegva daelevga daelevag
daegvlae daegvlea daegvale daegvael daegveal daegvela daeglvae daeglvea daeglave daeglaev daegleav
daegleva daegalve daegalev daegavle daegavel daegaevl daegaelv daegelav daegelva daegealv daegeavl
daegeval daegevla daeevlga daeevlag daeevgla daeevgal daeevagl daeevalg daeelvga daeelvag daeelgva
daeelgav daeelagv daeelavg daeeglva daeeglav daeegvla daeegval daeegavl daeegalv daeealgv daeealvg
daeeaglv daeeagvl daeeavgl daeeavlg dagavele dagaveel dagavlee dagavlee dagavele dagaveel dagaevle
dagaevel dagaelve dagaelev dagaeelv dagaeevl dagaleve dagaleev dagalvee dagalvee dagaleve dagaleev
dagaeelv dagaeevl dagaelev dagaelve dagaevle dagaevel dagvaele dagvaeel dagvalee dagvalee dagvaele
dagvaeel dagveale dagveael dagvelae dagvelea dagveela dagveeal dagvleae dagvleea dagvlaee dagvlaee
dagvleae dagvleea dagveela dagveeal dagvelea dagvelae dagveale dagveael dagevale dagevael dagevlae
dagevlea dagevela dageveal dageavle dageavel dagealve dagealev dageaelv dageaevl dagelave dagelaev
dagelvae dagelvea dageleva dageleav dageealv dageeavl dageelav dageelva dageevla dageeval daglveae
daglveea daglvaee daglvaee daglveae daglveea daglevae daglevea dagleave dagleaev dagleeav dagleeva
daglaeve daglaeev daglavee daglavee daglaeve daglaeev dagleeav dagleeva dagleaev dagleave daglevae
daglevea dagevela dageveal dagevlea dagevlae dagevale dagevael dageevla dageeval dageelva dageelav
dageealv dageeavl dageleva dageleav dagelvea dagelvae dagelave dagelaev dageaelv dageaevl dagealev
dagealve dageavle dageavel daeavegl daeavelg daeavgel daeavgle daeavlge daeavleg daeaevgl daeaevlg
daeaegvl daeaeglv daeaelgv daeaelvg daeagevl daeagelv daeagvel daeagvle daeaglve daeaglev daealegv
daealevg daealgev daealgve daealvge daealveg daevaegl daevaelg daevagel daevagle daevalge daevaleg
daeveagl daevealg daevegal daevegla daevelga daevelag daevgeal daevgela daevgael daevgale daevglae
daevglea daevlega daevleag daevlgea daevlgae daevlage daevlaeg daeevagl daeevalg daeevgal daeevgla
daeevlga daeevlag daeeavgl daeeavlg daeeagvl daeeaglv daeealgv daeealvg daeegavl daeegalv daeegval
daeegvla daeeglva daeeglav daeelagv daeelavg daeelgav daeelgva daeelvga daeelvag daegveal daegvela
daegvael daegvale daegvlae daegvlea daegeval daegevla daegeavl daegealv daegelav daegelva daegaevl
daegaelv daegavel daegavle daegalve daegalev daegleav daegleva daeglaev daeglave daeglvae daeglvea
daelvega daelveag daelvgea daelvgae daelvage daelvaeg daelevga daelevag daelegva daelegav daeleagv
daeleavg daelgeva daelgeav daelgvea daelgvae daelgave daelgaev daelaegv daelaevg daelagev daelagve
daelavge daelaveg

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us