easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

laish

handbag

pugmarks

raguly

torpedoist

cadmiumize

understrike

ingloriously

charice

patuere

attulerimus

sclerophthalmia

pledgeors

musketries

tiddle

degraded

dilema

acritan


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: deferebar
cipher variations:
efgfsfcbs fghgtgdct ghihuhedu hijivifev ijkjwjgfw
jklkxkhgx klmlylihy lmnmzmjiz mnonankja nopobolkb
opqpcpmlc pqrqdqnmd qrsrerone rstsfspof stutgtqpg
tuvuhurqh uvwvivsri vwxwjwtsj wxyxkxutk xyzylyvul
yzazmzwvm zabanaxwn abcbobyxo bcdcpczyp cdedqdazq

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: deferebar
Cipher: wvuvivyzi

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: deferebar
Cipher: AAABB AABAA AABAB AABAA BAAAA AABAA AAAAB AAAAA BAAAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: deferebar
cipher variations:
efgfsfcbsknqnanebaqvavivgbiwdkdqdibqclulylkbyitetgtmbgujyjwjqbwarirersbe
gzszmzubmmhchuhwbuspmpcpybcyxwxkxabkfghgtgdctlorobofcbrwbwjwhcjxelerejcr
dmvmzmlczjufuhunchvkzkxkrcxbsjsfstcfhatanavcnnidivixcvtqnqdqzcdzyxylybcl
ghihuhedumpspcpgdcsxcxkxidkyfmfsfkdsenwnanmdakvgvivodiwlalylsdyctktgtudg
ibubobwdoojejwjydwuroreradeazyzmzcdmhijivifevnqtqdqhedtydylyjelzgngtglet
foxoboneblwhwjwpejxmbmzmtezduluhuvehjcvcpcxeppkfkxkzexvspsfsbefbazanaden
ijkjwjgfworurerifeuzezmzkfmahohuhmfugpypcpofcmxixkxqfkyncnanufaevmvivwfi
kdwdqdyfqqlglylafywtqtgtcfgcbabobefojklkxkhgxpsvsfsjgfvafanalgnbipivingv
hqzqdqpgdnyjylyrglzodobovgbfwnwjwxgjlexerezgrrmhmzmbgzxuruhudghdcbcpcfgp
klmlylihyqtwtgtkhgwbgbobmhocjqjwjohwirarerqheozkzmzshmapepcpwhcgxoxkxyhk
mfyfsfahssninanchayvsvivehiedcdqdghqlmnmzmjizruxuhulihxchcpcnipdkrkxkpix
jsbsfsrifpalanatinbqfqdqxidhypylyzilngzgtgbittojobodibzwtwjwfijfederehir
mnonankjasvyvivmjiydidqdojqelslylqjyktctgtsjgqbmbobujocrgreryjeizqzmzajm
ohahuhcjuupkpcpejcaxuxkxgjkgfefsfijsnopobolkbtwzwjwnkjzejerepkrfmtmzmrkz
luduhutkhrcncpcvkpdshsfszkfjaranabknpibividkvvqlqdqfkdbyvylyhklhgfgtgjkt
opqpcpmlcuxaxkxolkafkfsfqlsgnunanslamvevivulisdodqdwlqetitgtalgkbsbobclo
qjcjwjelwwrmrergleczwzmzilmihghuhklupqrqdqnmdvybylypmlbglgtgrmthovobotmb
nwfwjwvmjteperexmrfujuhubmhlctcpcdmprkdkxkfmxxsnsfshmfdaxanajmnjihivilmv
qrsreronewzczmzqnmchmhuhsnuipwpcpuncoxgxkxwnkufqfsfynsgvkvivcnimdudqdenq
slelylgnyytotgtingebybobknokjijwjmnwrstsfspofxadanarondinivitovjqxqdqvod
pyhylyxolvgrgtgzothwlwjwdojneverefortmfmzmhozzupuhujohfczcpcloplkjkxknox
stutgtqpgybebobspoejojwjupwkryrerwpeqzizmzypmwhshuhapuixmxkxepkofwfsfgps
ungnanipaavqvivkpigdadqdmpqmlklylopytuvuhurqhzcfcpctqpfkpkxkvqxlszsfsxqf
rajanazqnxitivibqvjynylyfqlpgxgtghqtvohobojqbbwrwjwlqjheberenqrnmlmzmpqz
uvwvivsriadgdqdurqglqlylwrymtatgtyrgsbkbobaroyjujwjcrwkzozmzgrmqhyhuhiru
wpipcpkrccxsxkxmrkifcfsforsonmnanqravwxwjwtsjbeherevsrhmrmzmxsznubuhuzsh
tclcpcbspzkvkxkdsxlapanahsnrizivijsvxqjqdqlsddytylynsljgdgtgpstponoborsb
wxyxkxutkcfifsfwtsinsnanytaovcvivatiudmdqdctqalwlyletymbqbobitosjajwjktw
yrkrermteezuzmzotmkhehuhqtuqpopcpstcxyzylyvuldgjgtgxutjotobozubpwdwjwbuj
veneredurbmxmzmfuzncrcpcjuptkbkxkluxzslsfsnuffavanapunlifiviruvrqpqdqtud
yzazmzwvmehkhuhyvukpupcpavcqxexkxcvkwfofsfevscnynangvaodsdqdkvqulclylmvy
atmtgtovggbwbobqvomjgjwjsvwsrqreruvezabanaxwnfilivizwvlqvqdqbwdryfylydwl
xgpgtgfwtdozobohwbpeterelwrvmdmzmnwzbunuhupwhhcxcpcrwpnkhkxktwxtsrsfsvwf
abcbobyxogjmjwjaxwmrwrercxeszgzmzexmyhqhuhgxuepapcpixcqfufsfmxswnenanoxa
cvovivqxiidydqdsxqolilyluxyutstgtwxgbcdcpczyphknkxkbyxnsxsfsdyftahanafyn
zirivihyvfqbqdqjydrgvgtgnytxofobopybdwpwjwryjjezeretyrpmjmzmvyzvutuhuxyh
cdedqdazqilolylczyotytgtezgubibobgzoajsjwjizwgrcrerkzeshwhuhozuypgpcpqzc
exqxkxszkkfafsfuzsqnknanwzawvuvivyzideferebarjmpmzmdazpuzuhufahvcjcpchap
bktkxkjaxhsdsfslaftixivipavzqhqdqradfyrylytallgbgtgvatroloboxabxwvwjwzaj

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: deferebar
Cipher: qrsrerone

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: deferebar
Cipher: 415112512451211124

Extended Methods:
Method #1

Plaintext: deferebar
method variations:
iklkwkgfwopqpbpmlbtuvugurqgyzazmzwvm

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
d e f e r e b a r 
4 5 1 5 2 5 2 1 2 
1 1 2 1 4 1 1 1 4 
They are then read out in rows:
451525212112141114
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: deferebar
Cipher: yvwbbfqaq

Read more ...
Method #3

Plaintext: deferebar
method variations:
vawfyfaft awfyfaftv wfyfaftva
fyfaftvaw yfaftvawf faftvawfy
aftvawfyf ftvawfyfa tvawfyfaf

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: deferebar

first 5040 cipher variations(362880 total)
deferebar deferebra defereabr deferearb defererab defererba deferbear deferbera deferbaer deferbare deferbrae
deferbrea deferaber deferabre deferaebr deferaerb deferareb deferarbe deferrbae deferrbea deferrabe deferraeb
deferreab deferreba defeerbar defeerbra defeerabr defeerarb defeerrab defeerrba defeebrar defeebrra defeebarr
defeebarr defeebrar defeebrra defeeabrr defeeabrr defeearbr defeearrb defeearrb defeearbr defeerbar defeerbra
defeerabr defeerarb defeerrab defeerrba defeberar defeberra defebearr defebearr defeberar defeberra defebrear
defebrera defebraer defebrare defebrrae defebrrea defebarer defebarre defebaerr defebaerr defebarer defebarre
defebrrae defebrrea defebrare defebraer defebrear defebrera defeaebrr defeaebrr defeaerbr defeaerrb defeaerrb
defeaerbr defeaberr defeaberr defeabrer defeabrre defeabrre defeabrer defearber defearbre defearebr defearerb
defearreb defearrbe defearbre defearber defearrbe defearreb defearerb defearebr deferebar deferebra defereabr
deferearb defererab defererba deferbear deferbera deferbaer deferbare deferbrae deferbrea deferaber deferabre
deferaebr deferaerb deferareb deferarbe deferrbae deferrbea deferrabe deferraeb deferreab deferreba defreebar
defreebra defreeabr defreearb defreerab defreerba defrebear defrebera defrebaer defrebare defrebrae defrebrea
defreaber defreabre defreaebr defreaerb defreareb defrearbe defrerbae defrerbea defrerabe defreraeb defrereab
defrereba defreebar defreebra defreeabr defreearb defreerab defreerba defrebear defrebera defrebaer defrebare
defrebrae defrebrea defreaber defreabre defreaebr defreaerb defreareb defrearbe defrerbae defrerbea defrerabe
defreraeb defrereab defrereba defrbeear defrbeera defrbeaer defrbeare defrberae defrberea defrbeear defrbeera
defrbeaer defrbeare defrberae defrberea defrbaeer defrbaere defrbaeer defrbaere defrbaree defrbaree defrbreae
defrbreea defrbraee defrbraee defrbreae defrbreea defraeber defraebre defraeebr defraeerb defraereb defraerbe
defrabeer defrabere defrabeer defrabere defrabree defrabree defraeber defraebre defraeebr defraeerb defraereb
defraerbe defrarbee defrarbee defrarebe defrareeb defrareeb defrarebe defrrebae defrrebea defrreabe defrreaeb
defrreeab defrreeba defrrbeae defrrbeea defrrbaee defrrbaee defrrbeae defrrbeea defrrabee defrrabee defrraebe
defrraeeb defrraeeb defrraebe defrrebae defrrebea defrreabe defrreaeb defrreeab defrreeba deferebar deferebra
defereabr deferearb defererab defererba deferbear deferbera deferbaer deferbare deferbrae deferbrea deferaber
deferabre deferaebr deferaerb deferareb deferarbe deferrbae deferrbea deferrabe deferraeb deferreab deferreba
defeerbar defeerbra defeerabr defeerarb defeerrab defeerrba defeebrar defeebrra defeebarr defeebarr defeebrar
defeebrra defeeabrr defeeabrr defeearbr defeearrb defeearrb defeearbr defeerbar defeerbra defeerabr defeerarb
defeerrab defeerrba defeberar defeberra defebearr defebearr defeberar defeberra defebrear defebrera defebraer
defebrare defebrrae defebrrea defebarer defebarre defebaerr defebaerr defebarer defebarre defebrrae defebrrea
defebrare defebraer defebrear defebrera defeaebrr defeaebrr defeaerbr defeaerrb defeaerrb defeaerbr defeaberr
defeaberr defeabrer defeabrre defeabrre defeabrer defearber defearbre defearebr defearerb defearreb defearrbe
defearbre defearber defearrbe defearreb defearerb defearebr deferebar deferebra defereabr deferearb defererab
defererba deferbear deferbera deferbaer deferbare deferbrae deferbrea deferaber deferabre deferaebr deferaerb
deferareb deferarbe deferrbae deferrbea deferrabe deferraeb deferreab deferreba defbreear defbreera defbreaer
defbreare defbrerae defbrerea defbreear defbreera defbreaer defbreare defbrerae defbrerea defbraeer defbraere
defbraeer defbraere defbraree defbraree defbrreae defbrreea defbrraee defbrraee defbrreae defbrreea defberear
defberera defberaer defberare defberrae defberrea defbeerar defbeerra defbeearr defbeearr defbeerar defbeerra
defbeaerr defbeaerr defbearer defbearre defbearre defbearer defberear defberera defberaer defberare defberrae
defberrea defbeerar defbeerra defbeearr defbeearr defbeerar defbeerra defberear defberera defberaer defberare
defberrae defberrea defbearer defbearre defbeaerr defbeaerr defbearer defbearre defberrae defberrea defberare
defberaer defberear defberera defbaeerr defbaeerr defbaerer defbaerre defbaerre defbaerer defbaeerr defbaeerr
defbaerer defbaerre defbaerre defbaerer defbareer defbarere defbareer defbarere defbarree defbarree defbarere
defbareer defbarree defbarree defbarere defbareer defbreear defbreera defbreaer defbreare defbrerae defbrerea
defbreear defbreera defbreaer defbreare defbrerae defbrerea defbraeer defbraere defbraeer defbraere defbraree
defbraree defbrreae defbrreea defbrraee defbrraee defbrreae defbrreea defareber defarebre defareebr defareerb
defarereb defarerbe defarbeer defarbere defarbeer defarbere defarbree defarbree defareber defarebre defareebr
defareerb defarereb defarerbe defarrbee defarrbee defarrebe defarreeb defarreeb defarrebe defaerber defaerbre
defaerebr defaererb defaerreb defaerrbe defaebrer defaebrre defaeberr defaeberr defaebrer defaebrre defaeebrr
defaeebrr defaeerbr defaeerrb defaeerrb defaeerbr defaerber defaerbre defaerebr defaererb defaerreb defaerrbe
defaberer defaberre defabeerr defabeerr defaberer defaberre defabreer defabrere defabreer defabrere defabrree
defabrree defaberer defaberre defabeerr defabeerr defaberer defaberre defabrree defabrree defabrere defabreer
defabreer defabrere defaeebrr defaeebrr defaeerbr defaeerrb defaeerrb defaeerbr defaeberr defaeberr defaebrer
defaebrre defaebrre defaebrer defaerber defaerbre defaerebr defaererb defaerreb defaerrbe defaerbre defaerber
defaerrbe defaerreb defaererb defaerebr defareber defarebre defareebr defareerb defarereb defarerbe defarbeer
defarbere defarbeer defarbere defarbree defarbree defareber defarebre defareebr defareerb defarereb defarerbe
defarrbee defarrbee defarrebe defarreeb defarreeb defarrebe defrrebae defrrebea defrreabe defrreaeb defrreeab
defrreeba defrrbeae defrrbeea defrrbaee defrrbaee defrrbeae defrrbeea defrrabee defrrabee defrraebe defrraeeb
defrraeeb defrraebe defrrebae defrrebea defrreabe defrreaeb defrreeab defrreeba defrerbae defrerbea defrerabe
defreraeb defrereab defrereba defrebrae defrebrea defrebare defrebaer defrebear defrebera defreabre defreaber
defrearbe defreareb defreaerb defreaebr defreebar defreebra defreeabr defreearb defreerab defreerba defrberae
defrberea defrbeare defrbeaer defrbeear defrbeera defrbreae defrbreea defrbraee defrbraee defrbreae defrbreea
defrbaree defrbaree defrbaere defrbaeer defrbaeer defrbaere defrberae defrberea defrbeare defrbeaer defrbeear
defrbeera defraebre defraeber defraerbe defraereb defraeerb defraeebr defrabere defrabeer defrabree defrabree
defrabere defrabeer defrarbee defrarbee defrarebe defrareeb defrareeb defrarebe defraebre defraeber defraerbe
defraereb defraeerb defraeebr defreebar defreebra defreeabr defreearb defreerab defreerba defrebear defrebera
defrebaer defrebare defrebrae defrebrea defreaber defreabre defreaebr defreaerb defreareb defrearbe defrerbae
defrerbea defrerabe defreraeb defrereab defrereba deefrebar deefrebra deefreabr deefrearb deefrerab deefrerba
deefrbear deefrbera deefrbaer deefrbare deefrbrae deefrbrea deefraber deefrabre deefraebr deefraerb deefrareb
deefrarbe deefrrbae deefrrbea deefrrabe deefrraeb deefrreab deefrreba deeferbar deeferbra deeferabr deeferarb
deeferrab deeferrba deefebrar deefebrra deefebarr deefebarr deefebrar deefebrra deefeabrr deefeabrr deefearbr
deefearrb deefearrb deefearbr deeferbar deeferbra deeferabr deeferarb deeferrab deeferrba deefberar deefberra
deefbearr deefbearr deefberar deefberra deefbrear deefbrera deefbraer deefbrare deefbrrae deefbrrea deefbarer
deefbarre deefbaerr deefbaerr deefbarer deefbarre deefbrrae deefbrrea deefbrare deefbraer deefbrear deefbrera
deefaebrr deefaebrr deefaerbr deefaerrb deefaerrb deefaerbr deefaberr deefaberr deefabrer deefabrre deefabrre
deefabrer deefarber deefarbre deefarebr deefarerb deefarreb deefarrbe deefarbre deefarber deefarrbe deefarreb
deefarerb deefarebr deefrebar deefrebra deefreabr deefrearb deefrerab deefrerba deefrbear deefrbera deefrbaer
deefrbare deefrbrae deefrbrea deefraber deefrabre deefraebr deefraerb deefrareb deefrarbe deefrrbae deefrrbea
deefrrabe deefrraeb deefrreab deefrreba deerfebar deerfebra deerfeabr deerfearb deerferab deerferba deerfbear
deerfbera deerfbaer deerfbare deerfbrae deerfbrea deerfaber deerfabre deerfaebr deerfaerb deerfareb deerfarbe
deerfrbae deerfrbea deerfrabe deerfraeb deerfreab deerfreba deerefbar deerefbra deerefabr deerefarb deerefrab
deerefrba deerebfar deerebfra deerebafr deerebarf deerebraf deerebrfa deereabfr deereabrf deereafbr deereafrb
deerearfb deerearbf deererbaf deererbfa deererabf deererafb deererfab deererfba deerbefar deerbefra deerbeafr
deerbearf deerberaf deerberfa deerbfear deerbfera deerbfaer deerbfare deerbfrae deerbfrea deerbafer deerbafre
deerbaefr deerbaerf deerbaref deerbarfe deerbrfae deerbrfea deerbrafe deerbraef deerbreaf deerbrefa deeraebfr
deeraebrf deeraefbr deeraefrb deeraerfb deeraerbf deerabefr deeraberf deerabfer deerabfre deerabrfe deerabref
deerafber deerafbre deerafebr deeraferb deerafreb deerafrbe deerarbfe deerarbef deerarfbe deerarfeb deerarefb
deerarebf deerrebaf deerrebfa deerreabf deerreafb deerrefab deerrefba deerrbeaf deerrbefa deerrbaef deerrbafe
deerrbfae deerrbfea deerrabef deerrabfe deerraebf deerraefb deerrafeb deerrafbe deerrfbae deerrfbea deerrfabe
deerrfaeb deerrfeab deerrfeba deeerfbar deeerfbra deeerfabr deeerfarb deeerfrab deeerfrba deeerbfar deeerbfra
deeerbafr deeerbarf deeerbraf deeerbrfa deeerabfr deeerabrf deeerafbr deeerafrb deeerarfb deeerarbf deeerrbaf
deeerrbfa deeerrabf deeerrafb deeerrfab deeerrfba deeefrbar deeefrbra deeefrabr deeefrarb deeefrrab deeefrrba
deeefbrar deeefbrra deeefbarr deeefbarr deeefbrar deeefbrra deeefabrr deeefabrr deeefarbr deeefarrb deeefarrb
deeefarbr deeefrbar deeefrbra deeefrabr deeefrarb deeefrrab deeefrrba deeebfrar deeebfrra deeebfarr deeebfarr
deeebfrar deeebfrra deeebrfar deeebrfra deeebrafr deeebrarf deeebrraf deeebrrfa deeebarfr deeebarrf deeebafrr
deeebafrr deeebarfr deeebarrf deeebrraf deeebrrfa deeebrarf deeebrafr deeebrfar deeebrfra deeeafbrr deeeafbrr
deeeafrbr deeeafrrb deeeafrrb deeeafrbr deeeabfrr deeeabfrr deeeabrfr deeeabrrf deeeabrrf deeeabrfr deeearbfr
deeearbrf deeearfbr deeearfrb deeearrfb deeearrbf deeearbrf deeearbfr deeearrbf deeearrfb deeearfrb deeearfbr
deeerfbar deeerfbra deeerfabr deeerfarb deeerfrab deeerfrba deeerbfar deeerbfra deeerbafr deeerbarf deeerbraf
deeerbrfa deeerabfr deeerabrf deeerafbr deeerafrb deeerarfb deeerarbf deeerrbaf deeerrbfa deeerrabf deeerrafb
deeerrfab deeerrfba deebrefar deebrefra deebreafr deebrearf deebreraf deebrerfa deebrfear deebrfera deebrfaer
deebrfare deebrfrae deebrfrea deebrafer deebrafre deebraefr deebraerf deebraref deebrarfe deebrrfae deebrrfea
deebrrafe deebrraef deebrreaf deebrrefa deeberfar deeberfra deeberafr deeberarf deeberraf deeberrfa deebefrar
deebefrra deebefarr deebefarr deebefrar deebefrra deebeafrr deebeafrr deebearfr deebearrf deebearrf deebearfr
deeberfar deeberfra deeberafr deeberarf deeberraf deeberrfa deebferar deebferra deebfearr deebfearr deebferar
deebferra deebfrear deebfrera deebfraer deebfrare deebfrrae deebfrrea deebfarer deebfarre deebfaerr deebfaerr
deebfarer deebfarre deebfrrae deebfrrea deebfrare deebfraer deebfrear deebfrera deebaefrr deebaefrr deebaerfr
deebaerrf deebaerrf deebaerfr deebaferr deebaferr deebafrer deebafrre deebafrre deebafrer deebarfer deebarfre
deebarefr deebarerf deebarref deebarrfe deebarfre deebarfer deebarrfe deebarref deebarerf deebarefr deebrefar
deebrefra deebreafr deebrearf deebreraf deebrerfa deebrfear deebrfera deebrfaer deebrfare deebrfrae deebrfrea
deebrafer deebrafre deebraefr deebraerf deebraref deebrarfe deebrrfae deebrrfea deebrrafe deebrraef deebrreaf
deebrrefa deearebfr deearebrf deearefbr deearefrb deearerfb deearerbf deearbefr deearberf deearbfer deearbfre
deearbrfe deearbref deearfber deearfbre deearfebr deearferb deearfreb deearfrbe deearrbfe deearrbef deearrfbe
deearrfeb deearrefb deearrebf deeaerbfr deeaerbrf deeaerfbr deeaerfrb deeaerrfb deeaerrbf deeaebrfr deeaebrrf
deeaebfrr deeaebfrr deeaebrfr deeaebrrf deeaefbrr deeaefbrr deeaefrbr deeaefrrb deeaefrrb deeaefrbr deeaerbfr
deeaerbrf deeaerfbr deeaerfrb deeaerrfb deeaerrbf deeaberfr deeaberrf deeabefrr deeabefrr deeaberfr deeaberrf
deeabrefr deeabrerf deeabrfer deeabrfre deeabrrfe deeabrref deeabfrer deeabfrre deeabferr deeabferr deeabfrer
deeabfrre deeabrrfe deeabrref deeabrfre deeabrfer deeabrefr deeabrerf deeafebrr deeafebrr deeaferbr deeaferrb
deeaferrb deeaferbr deeafberr deeafberr deeafbrer deeafbrre deeafbrre deeafbrer deeafrber deeafrbre deeafrebr
deeafrerb deeafrreb deeafrrbe deeafrbre deeafrber deeafrrbe deeafrreb deeafrerb deeafrebr deearebfr deearebrf
deearefbr deearefrb deearerfb deearerbf deearbefr deearberf deearbfer deearbfre deearbrfe deearbref deearfber
deearfbre deearfebr deearferb deearfreb deearfrbe deearrbfe deearrbef deearrfbe deearrfeb deearrefb deearrebf
deerrebaf deerrebfa deerreabf deerreafb deerrefab deerrefba deerrbeaf deerrbefa deerrbaef deerrbafe deerrbfae
deerrbfea deerrabef deerrabfe deerraebf deerraefb deerrafeb deerrafbe deerrfbae deerrfbea deerrfabe deerrfaeb
deerrfeab deerrfeba deererbaf deererbfa deererabf deererafb deererfab deererfba deerebraf deerebrfa deerebarf
deerebafr deerebfar deerebfra deereabrf deereabfr deerearbf deerearfb deereafrb deereafbr deerefbar deerefbra
deerefabr deerefarb deerefrab deerefrba deerberaf deerberfa deerbearf deerbeafr deerbefar deerbefra deerbreaf
deerbrefa deerbraef deerbrafe deerbrfae deerbrfea deerbaref deerbarfe deerbaerf deerbaefr deerbafer deerbafre
deerbfrae deerbfrea deerbfare deerbfaer deerbfear deerbfera deeraebrf deeraebfr deeraerbf deeraerfb deeraefrb
deeraefbr deeraberf deerabefr deerabref deerabrfe deerabfre deerabfer deerarbef deerarbfe deerarebf deerarefb
deerarfeb deerarfbe deerafbre deerafber deerafrbe deerafreb deeraferb deerafebr deerfebar deerfebra deerfeabr
deerfearb deerferab deerferba deerfbear deerfbera deerfbaer deerfbare deerfbrae deerfbrea deerfaber deerfabre
deerfaebr deerfaerb deerfareb deerfarbe deerfrbae deerfrbea deerfrabe deerfraeb deerfreab deerfreba derefebar
derefebra derefeabr derefearb dereferab dereferba derefbear derefbera derefbaer derefbare derefbrae derefbrea
derefaber derefabre derefaebr derefaerb derefareb derefarbe derefrbae derefrbea derefrabe derefraeb derefreab
derefreba dereefbar dereefbra dereefabr dereefarb dereefrab dereefrba dereebfar dereebfra dereebafr dereebarf
dereebraf dereebrfa dereeabfr dereeabrf dereeafbr dereeafrb dereearfb dereearbf dereerbaf dereerbfa dereerabf
dereerafb dereerfab dereerfba derebefar derebefra derebeafr derebearf dereberaf dereberfa derebfear derebfera
derebfaer derebfare derebfrae derebfrea derebafer derebafre derebaefr derebaerf derebaref derebarfe derebrfae
derebrfea derebrafe derebraef derebreaf derebrefa dereaebfr dereaebrf dereaefbr dereaefrb dereaerfb dereaerbf
dereabefr dereaberf dereabfer dereabfre dereabrfe dereabref dereafber dereafbre dereafebr dereaferb dereafreb
dereafrbe derearbfe derearbef derearfbe derearfeb derearefb derearebf dererebaf dererebfa derereabf derereafb
dererefab dererefba dererbeaf dererbefa dererbaef dererbafe dererbfae dererbfea dererabef dererabfe dereraebf
dereraefb dererafeb dererafbe dererfbae dererfbea dererfabe dererfaeb dererfeab dererfeba derfeebar derfeebra
derfeeabr derfeearb derfeerab derfeerba derfebear derfebera derfebaer derfebare derfebrae derfebrea derfeaber
derfeabre derfeaebr derfeaerb derfeareb derfearbe derferbae derferbea derferabe derferaeb derfereab derfereba
derfeebar derfeebra derfeeabr derfeearb derfeerab derfeerba derfebear derfebera derfebaer derfebare derfebrae
derfebrea derfeaber derfeabre derfeaebr derfeaerb derfeareb derfearbe derferbae derferbea derferabe derferaeb
derfereab derfereba derfbeear derfbeera derfbeaer derfbeare derfberae derfberea derfbeear derfbeera derfbeaer
derfbeare derfberae derfberea derfbaeer derfbaere derfbaeer derfbaere derfbaree derfbaree derfbreae derfbreea
derfbraee derfbraee derfbreae derfbreea derfaeber derfaebre derfaeebr derfaeerb derfaereb derfaerbe derfabeer
derfabere derfabeer derfabere derfabree derfabree derfaeber derfaebre derfaeebr derfaeerb derfaereb derfaerbe
derfarbee derfarbee derfarebe derfareeb derfareeb derfarebe derfrebae derfrebea derfreabe derfreaeb derfreeab
derfreeba derfrbeae derfrbeea derfrbaee derfrbaee derfrbeae derfrbeea derfrabee derfrabee derfraebe derfraeeb
derfraeeb derfraebe derfrebae derfrebea derfreabe derfreaeb derfreeab derfreeba derefebar derefebra derefeabr
derefearb dereferab dereferba derefbear derefbera derefbaer derefbare derefbrae derefbrea derefaber derefabre
derefaebr derefaerb derefareb derefarbe derefrbae derefrbea derefrabe derefraeb derefreab derefreba dereefbar
dereefbra dereefabr dereefarb dereefrab dereefrba dereebfar dereebfra dereebafr dereebarf dereebraf dereebrfa
dereeabfr dereeabrf dereeafbr dereeafrb dereearfb dereearbf dereerbaf dereerbfa dereerabf dereerafb dereerfab
dereerfba derebefar derebefra derebeafr derebearf dereberaf dereberfa derebfear derebfera derebfaer derebfare
derebfrae derebfrea derebafer derebafre derebaefr derebaerf derebaref derebarfe derebrfae derebrfea derebrafe
derebraef derebreaf derebrefa dereaebfr dereaebrf dereaefbr dereaefrb dereaerfb dereaerbf dereabefr dereaberf
dereabfer dereabfre dereabrfe dereabref dereafber dereafbre dereafebr dereaferb dereafreb dereafrbe derearbfe
derearbef derearfbe derearfeb derearefb derearebf dererebaf dererebfa derereabf derereafb dererefab dererefba
dererbeaf dererbefa dererbaef dererbafe dererbfae dererbfea dererabef dererabfe dereraebf dereraefb dererafeb
dererafbe dererfbae dererfbea dererfabe dererfaeb dererfeab dererfeba derbfeear derbfeera derbfeaer derbfeare
derbferae derbferea derbfeear derbfeera derbfeaer derbfeare derbferae derbferea derbfaeer derbfaere derbfaeer
derbfaere derbfaree derbfaree derbfreae derbfreea derbfraee derbfraee derbfreae derbfreea derbefear derbefera
derbefaer derbefare derbefrae derbefrea derbeefar derbeefra derbeeafr derbeearf derbeeraf derbeerfa derbeaefr
derbeaerf derbeafer derbeafre derbearfe derbearef derbereaf derberefa derberaef derberafe derberfae derberfea
derbeefar derbeefra derbeeafr derbeearf derbeeraf derbeerfa derbefear derbefera derbefaer derbefare derbefrae
derbefrea derbeafer derbeafre derbeaefr derbeaerf derbearef derbearfe derberfae derberfea derberafe derberaef
derbereaf derberefa derbaeefr derbaeerf derbaefer derbaefre derbaerfe derbaeref derbaeefr derbaeerf derbaefer
derbaefre derbaerfe derbaeref derbafeer derbafere derbafeer derbafere derbafree derbafree derbarefe derbareef
derbarfee derbarfee derbarefe derbareef derbreeaf derbreefa derbreaef derbreafe derbrefae derbrefea derbreeaf
derbreefa derbreaef derbreafe derbrefae derbrefea derbraeef derbraefe derbraeef derbraefe derbrafee derbrafee
derbrfeae derbrfeea derbrfaee derbrfaee derbrfeae derbrfeea derafeber derafebre derafeebr derafeerb derafereb
deraferbe derafbeer derafbere derafbeer derafbere derafbree derafbree derafeber derafebre derafeebr derafeerb
derafereb deraferbe derafrbee derafrbee derafrebe derafreeb derafreeb derafrebe deraefber deraefbre deraefebr
deraeferb deraefreb deraefrbe deraebfer deraebfre deraebefr deraeberf deraebref deraebrfe deraeebfr deraeebrf
deraeefbr deraeefrb deraeerfb deraeerbf deraerbef deraerbfe deraerebf deraerefb deraerfeb deraerfbe derabefer
derabefre derabeefr derabeerf deraberef deraberfe derabfeer derabfere derabfeer derabfere derabfree derabfree
derabefer derabefre derabeefr derabeerf deraberef deraberfe derabrfee derabrfee derabrefe derabreef derabreef
derabrefe deraeebfr deraeebrf deraeefbr deraeefrb deraeerfb deraeerbf deraebefr deraeberf deraebfer deraebfre
deraebrfe deraebref deraefber deraefbre deraefebr deraeferb deraefreb deraefrbe deraerbfe deraerbef deraerfbe
deraerfeb deraerefb deraerebf derarebef derarebfe derareebf derareefb derarefeb derarefbe derarbeef derarbefe
derarbeef derarbefe derarbfee derarbfee derarebef derarebfe derareebf derareefb derarefeb derarefbe derarfbee
derarfbee derarfebe derarfeeb derarfeeb derarfebe derrfebae derrfebea derrfeabe derrfeaeb derrfeeab derrfeeba
derrfbeae derrfbeea derrfbaee derrfbaee derrfbeae derrfbeea derrfabee derrfabee derrfaebe derrfaeeb derrfaeeb
derrfaebe derrfebae derrfebea derrfeabe derrfeaeb derrfeeab derrfeeba derrefbae derrefbea derrefabe derrefaeb
derrefeab derrefeba derrebfae derrebfea derrebafe derrebaef derrebeaf derrebefa derreabfe derreabef derreafbe
derreafeb derreaefb derreaebf derreebaf derreebfa derreeabf derreeafb derreefab derreefba derrbefae derrbefea
derrbeafe derrbeaef derrbeeaf derrbeefa derrbfeae derrbfeea derrbfaee derrbfaee derrbfeae derrbfeea derrbafee
derrbafee derrbaefe derrbaeef derrbaeef derrbaefe derrbefae derrbefea derrbeafe derrbeaef derrbeeaf derrbeefa
derraebfe derraebef derraefbe derraefeb derraeefb derraeebf derrabefe derrabeef derrabfee derrabfee derrabefe
derrabeef derrafbee derrafbee derrafebe derrafeeb derrafeeb derrafebe derraebfe derraebef derraefbe derraefeb
derraeefb derraeebf derreebaf derreebfa derreeabf derreeafb derreefab derreefba derrebeaf derrebefa derrebaef
derrebafe derrebfae derrebfea derreabef derreabfe derreaebf derreaefb derreafeb derreafbe derrefbae derrefbea
derrefabe derrefaeb derrefeab derrefeba deeerfbar deeerfbra deeerfabr deeerfarb deeerfrab deeerfrba deeerbfar
deeerbfra deeerbafr deeerbarf deeerbraf deeerbrfa deeerabfr deeerabrf deeerafbr deeerafrb deeerarfb deeerarbf
deeerrbaf deeerrbfa deeerrabf deeerrafb deeerrfab deeerrfba deeefrbar deeefrbra deeefrabr deeefrarb deeefrrab
deeefrrba deeefbrar deeefbrra deeefbarr deeefbarr deeefbrar deeefbrra deeefabrr deeefabrr deeefarbr deeefarrb
deeefarrb deeefarbr deeefrbar deeefrbra deeefrabr deeefrarb deeefrrab deeefrrba deeebfrar deeebfrra deeebfarr
deeebfarr deeebfrar deeebfrra deeebrfar deeebrfra deeebrafr deeebrarf deeebrraf deeebrrfa deeebarfr deeebarrf
deeebafrr deeebafrr deeebarfr deeebarrf deeebrraf deeebrrfa deeebrarf deeebrafr deeebrfar deeebrfra deeeafbrr
deeeafbrr deeeafrbr deeeafrrb deeeafrrb deeeafrbr deeeabfrr deeeabfrr deeeabrfr deeeabrrf deeeabrrf deeeabrfr
deeearbfr deeearbrf deeearfbr deeearfrb deeearrfb deeearrbf deeearbrf deeearbfr deeearrbf deeearrfb deeearfrb
deeearfbr deeerfbar deeerfbra deeerfabr deeerfarb deeerfrab deeerfrba deeerbfar deeerbfra deeerbafr deeerbarf
deeerbraf deeerbrfa deeerabfr deeerabrf deeerafbr deeerafrb deeerarfb deeerarbf deeerrbaf deeerrbfa deeerrabf
deeerrafb deeerrfab deeerrfba deerefbar deerefbra deerefabr deerefarb deerefrab deerefrba deerebfar deerebfra
deerebafr deerebarf deerebraf deerebrfa deereabfr deereabrf deereafbr deereafrb deerearfb deerearbf deererbaf
deererbfa deererabf deererafb deererfab deererfba deerfebar deerfebra deerfeabr deerfearb deerferab deerferba
deerfbear deerfbera deerfbaer deerfbare deerfbrae deerfbrea deerfaber deerfabre deerfaebr deerfaerb deerfareb
deerfarbe deerfrbae deerfrbea deerfrabe deerfraeb deerfreab deerfreba deerbfear deerbfera deerbfaer deerbfare
deerbfrae deerbfrea deerbefar deerbefra deerbeafr deerbearf deerberaf deerberfa deerbaefr deerbaerf deerbafer
deerbafre deerbarfe deerbaref deerbreaf deerbrefa deerbraef deerbrafe deerbrfae deerbrfea deerafber deerafbre
deerafebr deeraferb deerafreb deerafrbe deerabfer deerabfre deerabefr deeraberf deerabref deerabrfe deeraebfr
deeraebrf deeraefbr deeraefrb deeraerfb deeraerbf deerarbef deerarbfe deerarebf deerarefb deerarfeb deerarfbe
deerrfbae deerrfbea deerrfabe deerrfaeb deerrfeab deerrfeba deerrbfae deerrbfea deerrbafe deerrbaef deerrbeaf
deerrbefa deerrabfe deerrabef deerrafbe deerrafeb deerraefb deerraebf deerrebaf deerrebfa deerreabf deerreafb
deerrefab deerrefba deefrebar deefrebra deefreabr deefrearb deefrerab deefrerba deefrbear deefrbera deefrbaer
deefrbare deefrbrae deefrbrea deefraber deefrabre deefraebr deefraerb deefrareb deefrarbe deefrrbae deefrrbea
deefrrabe deefrraeb deefrreab deefrreba deeferbar deeferbra deeferabr deeferarb deeferrab deeferrba deefebrar
deefebrra deefebarr deefebarr deefebrar deefebrra deefeabrr deefeabrr deefearbr deefearrb deefearrb deefearbr
deeferbar deeferbra deeferabr deeferarb deeferrab deeferrba deefberar deefberra deefbearr deefbearr deefberar
deefberra deefbrear deefbrera deefbraer deefbrare deefbrrae deefbrrea deefbarer deefbarre deefbaerr deefbaerr
deefbarer deefbarre deefbrrae deefbrrea deefbrare deefbraer deefbrear deefbrera deefaebrr deefaebrr deefaerbr
deefaerrb deefaerrb deefaerbr deefaberr deefaberr deefabrer deefabrre deefabrre deefabrer deefarber deefarbre
deefarebr deefarerb deefarreb deefarrbe deefarbre deefarber deefarrbe deefarreb deefarerb deefarebr deefrebar
deefrebra deefreabr deefrearb deefrerab deefrerba deefrbear deefrbera deefrbaer deefrbare deefrbrae deefrbrea
deefraber deefrabre deefraebr deefraerb deefrareb deefrarbe deefrrbae deefrrbea deefrrabe deefrraeb deefrreab
deefrreba deebrfear deebrfera deebrfaer deebrfare deebrfrae deebrfrea deebrefar deebrefra deebreafr deebrearf
deebreraf deebrerfa deebraefr deebraerf deebrafer deebrafre deebrarfe deebraref deebrreaf deebrrefa deebrraef
deebrrafe deebrrfae deebrrfea deebfrear deebfrera deebfraer deebfrare deebfrrae deebfrrea deebferar deebferra
deebfearr deebfearr deebferar deebferra deebfaerr deebfaerr deebfarer deebfarre deebfarre deebfarer deebfrear
deebfrera deebfraer deebfrare deebfrrae deebfrrea deebefrar deebefrra deebefarr deebefarr deebefrar deebefrra
deeberfar deeberfra deeberafr deeberarf deeberraf deeberrfa deebearfr deebearrf deebeafrr deebeafrr deebearfr
deebearrf deeberraf deeberrfa deeberarf deeberafr deeberfar deeberfra deebaferr deebaferr deebafrer deebafrre
deebafrre deebafrer deebaefrr deebaefrr deebaerfr deebaerrf deebaerrf deebaerfr deebarefr deebarerf deebarfer
deebarfre deebarrfe deebarref deebarerf deebarefr deebarref deebarrfe deebarfre deebarfer deebrfear deebrfera
deebrfaer deebrfare deebrfrae deebrfrea deebrefar deebrefra deebreafr deebrearf deebreraf deebrerfa deebraefr
deebraerf deebrafer deebrafre deebrarfe deebraref deebrreaf deebrrefa deebrraef deebrrafe deebrrfae deebrrfea
deearfber deearfbre deearfebr deearferb deearfreb deearfrbe deearbfer deearbfre deearbefr deearberf deearbref
deearbrfe deearebfr deearebrf deearefbr deearefrb deearerfb deearerbf deearrbef deearrbfe deearrebf deearrefb
deearrfeb deearrfbe deeafrber deeafrbre deeafrebr deeafrerb deeafrreb deeafrrbe deeafbrer deeafbrre deeafberr
deeafberr deeafbrer deeafbrre deeafebrr deeafebrr deeaferbr deeaferrb deeaferrb deeaferbr deeafrber deeafrbre
deeafrebr deeafrerb deeafrreb deeafrrbe deeabfrer deeabfrre deeabferr deeabferr deeabfrer deeabfrre deeabrfer
deeabrfre deeabrefr deeabrerf deeabrref deeabrrfe deeaberfr deeaberrf deeabefrr deeabefrr deeaberfr deeaberrf
deeabrref deeabrrfe deeabrerf deeabrefr deeabrfer deeabrfre deeaefbrr deeaefbrr deeaefrbr deeaefrrb deeaefrrb
deeaefrbr deeaebfrr deeaebfrr deeaebrfr deeaebrrf deeaebrrf deeaebrfr deeaerbfr deeaerbrf deeaerfbr deeaerfrb
deeaerrfb deeaerrbf deeaerbrf deeaerbfr deeaerrbf deeaerrfb deeaerfrb deeaerfbr deearfber deearfbre deearfebr
deearferb deearfreb deearfrbe deearbfer deearbfre deearbefr deearberf deearbref deearbrfe deearebfr deearebrf
deearefbr deearefrb deearerfb deearerbf deearrbef deearrbfe deearrebf deearrefb deearrfeb deearrfbe deerrfbae
deerrfbea deerrfabe deerrfaeb deerrfeab deerrfeba deerrbfae deerrbfea deerrbafe deerrbaef deerrbeaf deerrbefa
deerrabfe deerrabef deerrafbe deerrafeb deerraefb deerraebf deerrebaf deerrebfa deerreabf deerreafb deerrefab
deerrefba deerfrbae deerfrbea deerfrabe deerfraeb deerfreab deerfreba deerfbrae deerfbrea deerfbare deerfbaer
deerfbear deerfbera deerfabre deerfaber deerfarbe deerfareb deerfaerb deerfaebr deerfebar deerfebra deerfeabr
deerfearb deerferab deerferba deerbfrae deerbfrea deerbfare deerbfaer deerbfear deerbfera deerbrfae deerbrfea
deerbrafe deerbraef deerbreaf deerbrefa deerbarfe deerbaref deerbafre deerbafer deerbaefr deerbaerf deerberaf
deerberfa deerbearf deerbeafr deerbefar deerbefra deerafbre deerafber deerafrbe deerafreb deeraferb deerafebr
deerabfre deerabfer deerabrfe deerabref deeraberf deerabefr deerarbfe deerarbef deerarfbe deerarfeb deerarefb
deerarebf deeraebrf deeraebfr deeraerbf deeraerfb deeraefrb deeraefbr deerefbar deerefbra deerefabr deerefarb
deerefrab deerefrba deerebfar deerebfra deerebafr deerebarf deerebraf deerebrfa deereabfr deereabrf deereafbr
deereafrb deerearfb deerearbf deererbaf deererbfa deererabf deererafb deererfab deererfba deberefar deberefra
debereafr deberearf debereraf debererfa deberfear deberfera deberfaer deberfare deberfrae deberfrea deberafer
deberafre deberaefr deberaerf deberaref deberarfe deberrfae deberrfea deberrafe deberraef deberreaf deberrefa
debeerfar debeerfra debeerafr debeerarf debeerraf debeerrfa debeefrar debeefrra debeefarr debeefarr debeefrar
debeefrra debeeafrr debeeafrr debeearfr debeearrf debeearrf debeearfr debeerfar debeerfra debeerafr debeerarf
debeerraf debeerrfa debeferar debeferra debefearr debefearr debeferar debeferra debefrear debefrera debefraer
debefrare debefrrae debefrrea debefarer debefarre debefaerr debefaerr debefarer debefarre debefrrae debefrrea
debefrare debefraer debefrear debefrera debeaefrr debeaefrr debeaerfr debeaerrf debeaerrf debeaerfr debeaferr
debeaferr debeafrer debeafrre debeafrre debeafrer debearfer debearfre debearefr debearerf debearref debearrfe
debearfre debearfer debearrfe debearref debearerf debearefr deberefar deberefra debereafr deberearf debereraf
debererfa deberfear deberfera deberfaer deberfare deberfrae deberfrea deberafer deberafre deberaefr deberaerf
deberaref deberarfe deberrfae deberrfea deberrafe deberraef deberreaf deberrefa debreefar debreefra debreeafr
debreearf debreeraf debreerfa debrefear debrefera debrefaer debrefare debrefrae debrefrea debreafer debreafre
debreaefr debreaerf debrearef debrearfe debrerfae debrerfea debrerafe debreraef debrereaf debrerefa debreefar
debreefra debreeafr debreearf debreeraf debreerfa debrefear debrefera debrefaer debrefare debrefrae debrefrea
debreafer debreafre debreaefr debreaerf debrearef debrearfe debrerfae debrerfea debrerafe debreraef debrereaf
debrerefa debrfeear debrfeera debrfeaer debrfeare debrferae debrferea debrfeear debrfeera debrfeaer debrfeare
debrferae debrferea debrfaeer debrfaere debrfaeer debrfaere debrfaree debrfaree debrfreae debrfreea debrfraee
debrfraee debrfreae debrfreea debraefer debraefre debraeefr debraeerf debraeref debraerfe debrafeer debrafere
debrafeer debrafere debrafree debrafree debraefer debraefre debraeefr debraeerf debraeref debraerfe debrarfee
debrarfee debrarefe debrareef debrareef debrarefe debrrefae debrrefea debrreafe debrreaef debrreeaf debrreefa
debrrfeae debrrfeea debrrfaee debrrfaee debrrfeae debrrfeea debrrafee debrrafee debrraefe debrraeef debrraeef
debrraefe debrrefae debrrefea debrreafe debrreaef debrreeaf debrreefa deberefar deberefra debereafr deberearf
debereraf debererfa deberfear deberfera deberfaer deberfare deberfrae deberfrea deberafer deberafre deberaefr
deberaerf deberaref deberarfe deberrfae deberrfea deberrafe deberraef deberreaf deberrefa debeerfar debeerfra
debeerafr debeerarf debeerraf debeerrfa debeefrar debeefrra debeefarr debeefarr debeefrar debeefrra debeeafrr
debeeafrr debeearfr debeearrf debeearrf debeearfr debeerfar debeerfra debeerafr debeerarf debeerraf debeerrfa
debeferar debeferra debefearr debefearr debeferar debeferra debefrear debefrera debefraer debefrare debefrrae
debefrrea debefarer debefarre debefaerr debefaerr debefarer debefarre debefrrae debefrrea debefrare debefraer
debefrear debefrera debeaefrr debeaefrr debeaerfr debeaerrf debeaerrf debeaerfr debeaferr debeaferr debeafrer
debeafrre debeafrre debeafrer debearfer debearfre debearefr debearerf debearref debearrfe debearfre debearfer
debearrfe debearref debearerf debearefr deberefar deberefra debereafr deberearf debereraf debererfa deberfear
deberfera deberfaer deberfare deberfrae deberfrea deberafer deberafre deberaefr deberaerf deberaref deberarfe
deberrfae deberrfea deberrafe deberraef deberreaf deberrefa debfreear debfreera debfreaer debfreare debfrerae
debfrerea debfreear debfreera debfreaer debfreare debfrerae debfrerea debfraeer debfraere debfraeer debfraere
debfraree debfraree debfrreae debfrreea debfrraee debfrraee debfrreae debfrreea debferear debferera debferaer
debferare debferrae debferrea debfeerar debfeerra debfeearr debfeearr debfeerar debfeerra debfeaerr debfeaerr
debfearer debfearre debfearre debfearer debferear debferera debferaer debferare debferrae debferrea debfeerar
debfeerra debfeearr debfeearr debfeerar debfeerra debferear debferera debferaer debferare debferrae debferrea
debfearer debfearre debfeaerr debfeaerr debfearer debfearre debferrae debferrea debferare debferaer debferear
debferera debfaeerr debfaeerr debfaerer debfaerre debfaerre debfaerer debfaeerr debfaeerr debfaerer debfaerre
debfaerre debfaerer debfareer debfarere debfareer debfarere debfarree debfarree debfarere debfareer debfarree
debfarree debfarere debfareer debfreear debfreera debfreaer debfreare debfrerae debfrerea debfreear debfreera
debfreaer debfreare debfrerae debfrerea debfraeer debfraere debfraeer debfraere debfraree debfraree debfrreae
debfrreea debfrraee debfrraee debfrreae debfrreea debarefer debarefre debareefr debareerf debareref debarerfe
debarfeer debarfere debarfeer debarfere debarfree debarfree debarefer debarefre debareefr debareerf debareref
debarerfe debarrfee debarrfee debarrefe debarreef debarreef debarrefe debaerfer debaerfre debaerefr debaererf
debaerref debaerrfe debaefrer debaefrre debaeferr debaeferr debaefrer debaefrre debaeefrr debaeefrr debaeerfr
debaeerrf debaeerrf debaeerfr debaerfer debaerfre debaerefr debaererf debaerref debaerrfe debaferer debaferre
debafeerr debafeerr debaferer debaferre debafreer debafrere debafreer debafrere debafrree debafrree debaferer
debaferre debafeerr debafeerr debaferer debaferre debafrree debafrree debafrere debafreer debafreer debafrere
debaeefrr debaeefrr debaeerfr debaeerrf debaeerrf debaeerfr debaeferr debaeferr debaefrer debaefrre debaefrre
debaefrer debaerfer debaerfre debaerefr debaererf debaerref debaerrfe debaerfre debaerfer debaerrfe debaerref
debaererf debaerefr debarefer debarefre debareefr debareerf debareref debarerfe debarfeer debarfere debarfeer
debarfere debarfree debarfree debarefer debarefre debareefr debareerf debareref debarerfe debarrfee debarrfee
debarrefe debarreef debarreef debarrefe debrrefae debrrefea debrreafe debrreaef debrreeaf debrreefa debrrfeae
debrrfeea debrrfaee debrrfaee debrrfeae debrrfeea debrrafee debrrafee debrraefe debrraeef debrraeef debrraefe
debrrefae debrrefea debrreafe debrreaef debrreeaf debrreefa debrerfae debrerfea debrerafe debreraef debrereaf
debrerefa debrefrae debrefrea debrefare debrefaer debrefear debrefera debreafre debreafer debrearfe debrearef
debreaerf debreaefr debreefar debreefra debreeafr debreearf debreeraf debreerfa debrferae debrferea debrfeare
debrfeaer debrfeear debrfeera debrfreae debrfreea debrfraee debrfraee debrfreae debrfreea debrfaree debrfaree
debrfaere debrfaeer debrfaeer debrfaere debrferae debrferea debrfeare debrfeaer debrfeear debrfeera debraefre
debraefer debraerfe debraeref debraeerf debraeefr debrafere debrafeer debrafree debrafree debrafere debrafeer
debrarfee debrarfee debrarefe debrareef debrareef debrarefe debraefre debraefer debraerfe debraeref debraeerf
debraeefr debreefar debreefra debreeafr debreearf debreeraf debreerfa debrefear debrefera debrefaer debrefare
debrefrae debrefrea debreafer debreafre debreaefr debreaerf debrearef debrearfe debrerfae debrerfea debrerafe
debreraef debrereaf debrerefa deaerebfr deaerebrf deaerefbr deaerefrb deaererfb deaererbf deaerbefr deaerberf
deaerbfer deaerbfre deaerbrfe deaerbref deaerfber deaerfbre deaerfebr deaerferb deaerfreb deaerfrbe deaerrbfe
deaerrbef deaerrfbe deaerrfeb deaerrefb deaerrebf deaeerbfr deaeerbrf deaeerfbr deaeerfrb deaeerrfb deaeerrbf
deaeebrfr deaeebrrf deaeebfrr deaeebfrr deaeebrfr deaeebrrf deaeefbrr deaeefbrr deaeefrbr deaeefrrb deaeefrrb
deaeefrbr deaeerbfr deaeerbrf deaeerfbr deaeerfrb deaeerrfb deaeerrbf deaeberfr deaeberrf deaebefrr deaebefrr
deaeberfr deaeberrf deaebrefr deaebrerf deaebrfer deaebrfre deaebrrfe deaebrref deaebfrer deaebfrre deaebferr
deaebferr deaebfrer deaebfrre deaebrrfe deaebrref deaebrfre deaebrfer deaebrefr deaebrerf deaefebrr deaefebrr
deaeferbr deaeferrb deaeferrb deaeferbr deaefberr deaefberr deaefbrer deaefbrre deaefbrre deaefbrer deaefrber
deaefrbre deaefrebr deaefrerb deaefrreb deaefrrbe deaefrbre deaefrber deaefrrbe deaefrreb deaefrerb deaefrebr
deaerebfr deaerebrf deaerefbr deaerefrb deaererfb deaererbf deaerbefr deaerberf deaerbfer deaerbfre deaerbrfe
deaerbref deaerfber deaerfbre deaerfebr deaerferb deaerfreb deaerfrbe deaerrbfe deaerrbef deaerrfbe deaerrfeb
deaerrefb deaerrebf deareebfr deareebrf deareefbr deareefrb deareerfb deareerbf dearebefr deareberf dearebfer
dearebfre dearebrfe dearebref dearefber dearefbre dearefebr deareferb dearefreb dearefrbe dearerbfe dearerbef
dearerfbe dearerfeb dearerefb dearerebf deareebfr deareebrf deareefbr deareefrb deareerfb deareerbf dearebefr
deareberf dearebfer dearebfre dearebrfe dearebref dearefber dearefbre dearefebr deareferb dearefreb dearefrbe
dearerbfe dearerbef dearerfbe dearerfeb dearerefb dearerebf dearbeefr dearbeerf dearbefer dearbefre dearberfe
dearberef dearbeefr dearbeerf dearbefer dearbefre dearberfe dearberef dearbfeer dearbfere dearbfeer dearbfere
dearbfree dearbfree dearbrefe dearbreef dearbrfee dearbrfee dearbrefe dearbreef dearfeber dearfebre dearfeebr
dearfeerb dearfereb dearferbe dearfbeer dearfbere dearfbeer dearfbere dearfbree dearfbree dearfeber dearfebre
dearfeebr dearfeerb dearfereb dearferbe dearfrbee dearfrbee dearfrebe dearfreeb dearfreeb dearfrebe dearrebfe
dearrebef dearrefbe dearrefeb dearreefb dearreebf dearrbefe dearrbeef dearrbfee dearrbfee dearrbefe dearrbeef
dearrfbee dearrfbee dearrfebe dearrfeeb dearrfeeb dearrfebe dearrebfe dearrebef dearrefbe dearrefeb dearreefb
dearreebf deaerebfr deaerebrf deaerefbr deaerefrb deaererfb deaererbf deaerbefr deaerberf deaerbfer deaerbfre
deaerbrfe deaerbref deaerfber deaerfbre deaerfebr deaerferb deaerfreb deaerfrbe deaerrbfe deaerrbef deaerrfbe
deaerrfeb deaerrefb deaerrebf deaeerbfr deaeerbrf deaeerfbr deaeerfrb deaeerrfb deaeerrbf deaeebrfr deaeebrrf
deaeebfrr deaeebfrr deaeebrfr deaeebrrf deaeefbrr deaeefbrr deaeefrbr deaeefrrb deaeefrrb deaeefrbr deaeerbfr
deaeerbrf deaeerfbr deaeerfrb deaeerrfb deaeerrbf deaeberfr deaeberrf deaebefrr deaebefrr deaeberfr deaeberrf
deaebrefr deaebrerf deaebrfer deaebrfre deaebrrfe deaebrref deaebfrer deaebfrre deaebferr deaebferr deaebfrer
deaebfrre deaebrrfe deaebrref deaebrfre deaebrfer deaebrefr deaebrerf deaefebrr deaefebrr deaeferbr deaeferrb
deaeferrb deaeferbr deaefberr deaefberr deaefbrer deaefbrre deaefbrre deaefbrer deaefrber deaefrbre deaefrebr
deaefrerb deaefrreb deaefrrbe deaefrbre deaefrber deaefrrbe deaefrreb deaefrerb deaefrebr deaerebfr deaerebrf
deaerefbr deaerefrb deaererfb deaererbf deaerbefr deaerberf deaerbfer deaerbfre deaerbrfe deaerbref deaerfber
deaerfbre deaerfebr deaerferb deaerfreb deaerfrbe deaerrbfe deaerrbef deaerrfbe deaerrfeb deaerrefb deaerrebf
deabreefr deabreerf deabrefer deabrefre deabrerfe deabreref deabreefr deabreerf deabrefer deabrefre deabrerfe
deabreref deabrfeer deabrfere deabrfeer deabrfere deabrfree deabrfree deabrrefe deabrreef deabrrfee deabrrfee
deabrrefe deabrreef deaberefr deabererf deaberfer deaberfre deaberrfe deaberref deabeerfr deabeerrf deabeefrr
deabeefrr deabeerfr deabeerrf deabeferr deabeferr deabefrer deabefrre deabefrre deabefrer deaberefr deabererf
deaberfer deaberfre deaberrfe deaberref deabeerfr deabeerrf deabeefrr deabeefrr deabeerfr deabeerrf deaberefr
deabererf deaberfer deaberfre deaberrfe deaberref deabefrer deabefrre deabeferr deabeferr deabefrer deabefrre
deaberrfe deaberref deaberfre deaberfer deaberefr deabererf deabfeerr deabfeerr deabferer deabferre deabferre
deabferer deabfeerr deabfeerr deabferer deabferre deabferre deabferer deabfreer deabfrere deabfreer deabfrere
deabfrree deabfrree deabfrere deabfreer deabfrree deabfrree deabfrere deabfreer deabreefr deabreerf deabrefer
deabrefre deabrerfe deabreref deabreefr deabreerf deabrefer deabrefre deabrerfe deabreref deabrfeer deabrfere
deabrfeer deabrfere deabrfree deabrfree deabrrefe deabrreef deabrrfee deabrrfee deabrrefe deabrreef deafreber
deafrebre deafreebr deafreerb deafrereb deafrerbe deafrbeer deafrbere deafrbeer deafrbere deafrbree deafrbree
deafreber deafrebre deafreebr deafreerb deafrereb deafrerbe deafrrbee deafrrbee deafrrebe deafrreeb deafrreeb
deafrrebe deaferber deaferbre deaferebr deafererb deaferreb deaferrbe deafebrer deafebrre deafeberr deafeberr
deafebrer deafebrre deafeebrr deafeebrr deafeerbr deafeerrb deafeerrb deafeerbr deaferber deaferbre deaferebr
deafererb deaferreb deaferrbe deafberer deafberre deafbeerr deafbeerr deafberer deafberre deafbreer deafbrere
deafbreer deafbrere deafbrree deafbrree deafberer deafberre deafbeerr deafbeerr deafberer deafberre deafbrree
deafbrree deafbrere deafbreer deafbreer deafbrere deafeebrr deafeebrr deafeerbr deafeerrb deafeerrb deafeerbr
deafeberr deafeberr deafebrer deafebrre deafebrre deafebrer deaferber deaferbre deaferebr deafererb deaferreb
deaferrbe deaferbre deaferber deaferrbe deaferreb deafererb deaferebr deafreber deafrebre deafreebr deafreerb
deafrereb deafrerbe deafrbeer deafrbere deafrbeer deafrbere deafrbree deafrbree deafreber deafrebre deafreebr
deafreerb deafrereb deafrerbe deafrrbee deafrrbee deafrrebe deafrreeb deafrreeb deafrrebe dearrebfe dearrebef
dearrefbe dearrefeb dearreefb dearreebf dearrbefe dearrbeef dearrbfee dearrbfee dearrbefe dearrbeef dearrfbee
dearrfbee dearrfebe dearrfeeb dearrfeeb dearrfebe dearrebfe dearrebef dearrefbe dearrefeb dearreefb dearreebf
dearerbfe dearerbef dearerfbe dearerfeb dearerefb dearerebf dearebrfe dearebref dearebfre dearebfer dearebefr
deareberf dearefbre dearefber dearefrbe dearefreb deareferb dearefebr deareebfr deareebrf deareefbr deareefrb
deareerfb deareerbf dearberfe dearberef dearbefre dearbefer dearbeefr dearbeerf dearbrefe dearbreef dearbrfee
dearbrfee dearbrefe dearbreef dearbfree dearbfree dearbfere dearbfeer dearbfeer dearbfere dearberfe dearberef
dearbefre dearbefer dearbeefr dearbeerf dearfebre dearfeber dearferbe dearfereb dearfeerb dearfeebr dearfbere
dearfbeer dearfbree dearfbree dearfbere dearfbeer dearfrbee dearfrbee dearfrebe dearfreeb dearfreeb dearfrebe
dearfebre dearfeber dearferbe dearfereb dearfeerb dearfeebr deareebfr deareebrf deareefbr deareefrb deareerfb
deareerbf dearebefr deareberf dearebfer dearebfre dearebrfe dearebref dearefber dearefbre dearefebr deareferb
dearefreb dearefrbe dearerbfe dearerbef dearerfbe dearerfeb dearerefb dearerebf dererebaf dererebfa derereabf
derereafb dererefab dererefba dererbeaf dererbefa dererbaef dererbafe dererbfae dererbfea dererabef dererabfe
dereraebf dereraefb dererafeb dererafbe dererfbae dererfbea dererfabe dererfaeb dererfeab dererfeba dereerbaf
dereerbfa dereerabf dereerafb dereerfab dereerfba dereebraf dereebrfa dereebarf dereebafr dereebfar dereebfra
dereeabrf dereeabfr dereearbf dereearfb dereeafrb dereeafbr dereefbar dereefbra dereefabr dereefarb dereefrab
dereefrba dereberaf dereberfa derebearf derebeafr derebefar derebefra derebreaf derebrefa derebraef derebrafe
derebrfae derebrfea derebaref derebarfe derebaerf derebaefr derebafer derebafre derebfrae derebfrea derebfare
derebfaer derebfear derebfera dereaebrf dereaebfr dereaerbf dereaerfb dereaefrb dereaefbr dereaberf dereabefr
dereabref dereabrfe dereabfre dereabfer derearbef derearbfe derearebf derearefb derearfeb derearfbe dereafbre
dereafber dereafrbe dereafreb dereaferb dereafebr derefebar derefebra derefeabr derefearb dereferab dereferba
derefbear derefbera derefbaer derefbare derefbrae derefbrea derefaber derefabre derefaebr derefaerb derefareb
derefarbe derefrbae derefrbea derefrabe derefraeb derefreab derefreba derreebaf derreebfa derreeabf derreeafb
derreefab derreefba derrebeaf derrebefa derrebaef derrebafe derrebfae derrebfea derreabef derreabfe derreaebf
derreaefb derreafeb derreafbe derrefbae derrefbea derrefabe derrefaeb derrefeab derrefeba derreebaf derreebfa
derreeabf derreeafb derreefab derreefba derrebeaf derrebefa derrebaef derrebafe derrebfae derrebfea derreabef
derreabfe derreaebf derreaefb derreafeb derreafbe derrefbae derrefbea derrefabe derrefaeb derrefeab derrefeba
derrbeeaf derrbeefa derrbeaef derrbeafe derrbefae derrbefea derrbeeaf derrbeefa derrbeaef derrbeafe derrbefae
derrbefea derrbaeef derrbaefe derrbaeef derrbaefe derrbafee derrbafee derrbfeae derrbfeea derrbfaee derrbfaee
derrbfeae derrbfeea derraebef derraebfe derraeebf derraeefb derraefeb derraefbe derrabeef derrabefe derrabeef
derrabefe derrabfee derrabfee derraebef derraebfe derraeebf derraeefb derraefeb derraefbe derrafbee derrafbee
derrafebe derrafeeb derrafeeb derrafebe derrfebae derrfebea derrfeabe derrfeaeb derrfeeab derrfeeba derrfbeae
derrfbeea derrfbaee derrfbaee derrfbeae derrfbeea derrfabee derrfabee derrfaebe derrfaeeb derrfaeeb derrfaebe
derrfebae derrfebea derrfeabe derrfeaeb derrfeeab derrfeeba dererebaf dererebfa derereabf derereafb dererefab
dererefba dererbeaf dererbefa dererbaef dererbafe dererbfae dererbfea dererabef dererabfe dereraebf dereraefb
dererafeb dererafbe dererfbae dererfbea dererfabe dererfaeb dererfeab dererfeba dereerbaf dereerbfa dereerabf
dereerafb dereerfab dereerfba dereebraf dereebrfa dereebarf dereebafr dereebfar dereebfra dereeabrf dereeabfr
dereearbf dereearfb dereeafrb dereeafbr dereefbar dereefbra dereefabr dereefarb dereefrab dereefrba dereberaf
dereberfa derebearf derebeafr derebefar derebefra derebreaf derebrefa derebraef derebrafe derebrfae derebrfea
derebaref derebarfe derebaerf derebaefr derebafer derebafre derebfrae derebfrea derebfare derebfaer derebfear
derebfera dereaebrf dereaebfr dereaerbf dereaerfb dereaefrb dereaefbr dereaberf dereabefr dereabref dereabrfe
dereabfre dereabfer derearbef derearbfe derearebf derearefb derearfeb derearfbe dereafbre dereafber dereafrbe
dereafreb dereaferb dereafebr derefebar derefebra derefeabr derefearb dereferab dereferba derefbear derefbera
derefbaer derefbare derefbrae derefbrea derefaber derefabre derefaebr derefaerb derefareb derefarbe derefrbae
derefrbea derefrabe derefraeb derefreab derefreba derbreeaf derbreefa derbreaef derbreafe derbrefae derbrefea
derbreeaf derbreefa derbreaef derbreafe derbrefae derbrefea derbraeef derbraefe derbraeef derbraefe derbrafee
derbrafee derbrfeae derbrfeea derbrfaee derbrfaee derbrfeae derbrfeea derbereaf derberefa derberaef derberafe
derberfae derberfea derbeeraf derbeerfa derbeearf derbeeafr derbeefar derbeefra derbeaerf derbeaefr derbearef
derbearfe derbeafre derbeafer derbefear derbefera derbefaer derbefare derbefrae derbefrea derbeeraf derbeerfa
derbeearf derbeeafr derbeefar derbeefra derbereaf derberefa derberaef derberafe derberfae derberfea derbearef
derbearfe derbeaerf derbeaefr derbeafer derbeafre derbefrae derbefrea derbefare derbefaer derbefear derbefera
derbaeerf derbaeefr derbaeref derbaerfe derbaefre derbaefer derbaeerf derbaeefr derbaeref derbaerfe derbaefre
derbaefer derbareef derbarefe derbareef derbarefe derbarfee derbarfee derbafere derbafeer derbafree derbafree
derbafere derbafeer derbfeear derbfeera derbfeaer derbfeare derbferae derbferea derbfeear derbfeera derbfeaer
derbfeare derbferae derbferea derbfaeer derbfaere derbfaeer derbfaere derbfaree derbfaree derbfreae derbfreea
derbfraee derbfraee derbfreae derbfreea derarebef derarebfe derareebf derareefb derarefeb derarefbe derarbeef
derarbefe derarbeef derarbefe derarbfee derarbfee derarebef derarebfe derareebf derareefb derarefeb derarefbe
derarfbee derarfbee derarfebe derarfeeb derarfeeb derarfebe deraerbef deraerbfe deraerebf deraerefb deraerfeb
deraerfbe deraebref deraebrfe deraeberf deraebefr deraebfer deraebfre deraeebrf deraeebfr deraeerbf deraeerfb
deraeefrb deraeefbr deraefber deraefbre deraefebr deraeferb deraefreb deraefrbe deraberef deraberfe derabeerf
derabeefr derabefer derabefre derabreef derabrefe derabreef derabrefe derabrfee derabrfee deraberef deraberfe
derabeerf derabeefr derabefer derabefre derabfree derabfree derabfere derabfeer derabfeer derabfere deraeebrf
deraeebfr deraeerbf deraeerfb deraeefrb deraeefbr deraeberf deraebefr deraebref deraebrfe deraebfre deraebfer
deraerbef deraerbfe deraerebf deraerefb deraerfeb deraerfbe deraefbre deraefber deraefrbe deraefreb deraeferb
deraefebr derafeber derafebre derafeebr derafeerb derafereb deraferbe derafbeer derafbere derafbeer derafbere
derafbree derafbree derafeber derafebre derafeebr derafeerb derafereb deraferbe derafrbee derafrbee derafrebe
derafreeb derafreeb derafrebe derfrebae derfrebea derfreabe derfreaeb derfreeab derfreeba derfrbeae derfrbeea
derfrbaee derfrbaee derfrbeae derfrbeea derfrabee derfrabee derfraebe derfraeeb derfraeeb derfraebe derfrebae
derfrebea derfreabe derfreaeb derfreeab derfreeba derferbae derferbea derferabe derferaeb derfereab derfereba
derfebrae derfebrea derfebare derfebaer derfebear derfebera derfeabre derfeaber derfearbe derfeareb derfeaerb
derfeaebr derfeebar derfeebra derfeeabr derfeearb derfeerab derfeerba derfberae derfberea derfbeare derfbeaer
derfbeear derfbeera derfbreae derfbreea derfbraee derfbraee derfbreae derfbreea derfbaree derfbaree derfbaere
derfbaeer derfbaeer derfbaere derfberae derfberea derfbeare derfbeaer derfbeear derfbeera derfaebre derfaeber
derfaerbe derfaereb derfaeerb derfaeebr derfabere derfabeer derfabree derfabree derfabere derfabeer derfarbee
derfarbee derfarebe derfareeb derfareeb derfarebe derfaebre derfaeber derfaerbe derfaereb derfaeerb derfaeebr
derfeebar derfeebra derfeeabr derfeearb derfeerab derfeerba derfebear derfebera derfebaer derfebare derfebrae
derfebrea derfeaber derfeabre derfeaebr derfeaerb derfeareb derfearbe derferbae derferbea derferabe derferaeb
derfereab derfereba

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us