easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

locabitis

endeavoring

forefeel

sighing

wamuses

callipered

maspec

decanters

shaksheer

triphibious

unhygienically

recolonizing

quadrifurcate

nutriamus

nopinene

thorntail

toeplitz

pulvil


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: decursuque
cipher variations:
efdvstvrvf fgewtuwswg ghfxuvxtxh higyvwyuyi ijhzwxzvzj
jkiaxyawak kljbyzbxbl lmkczacycm mnldabdzdn nomebceaeo
opnfcdfbfp pqogdegcgq qrphefhdhr rsqifgieis strjghjfjt
tuskhikgku uvtlijlhlv vwumjkmimw wxvnklnjnx xywolmokoy
yzxpmnplpz zayqnoqmqa abzroprnrb bcaspqsosc cdbtqrtptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: decursuque
Cipher: wvxfihfjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: decursuque
Cipher: AAABB AABAA AAABA BAABB BAAAA BAAAB BAABB ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: decursuque
cipher variations:
efdvstvrvfknhjadjxjnqvlxinxdxvwdplqxljldcltzyhzpzlitxngrnvntujfpwlphpjarjdevdndr
gznrmfrtrzmhrfupfzfhspvtcztftpyxzhkjhlhxfgewtuwswgloikbekykorwmyjoyeywxeqmrymkme
dmuaziaqamjuyohsowouvkgqxmqiqkbskefweoeshaosngsusanisgvqgagitqwudauguqzyailkimiy
ghfxuvxtxhmpjlcflzlpsxnzkpzfzxyfrnsznlnfenvbajbrbnkvzpitpxpvwlhrynrjrlctlfgxfpft
ibptohtvtbojthwrhbhjurxvebvhvrazbjmljnjzhigyvwyuyinqkmdgmamqtyoalqagayzgsotaomog
fowcbkcscolwaqjuqyqwxmiszosksmdumghygqgujcqupiuwucpkuixsicikvsywfcwiwsbacknmkoka
ijhzwxzvzjorlnehnbnruzpbmrbhbzahtpubpnphgpxdcldtdpmxbrkvrzrxynjtaptltnevnhizhrhv
kdrvqjvxvdqlvjytjdjlwtzxgdxjxtcbdlonlplbjkiaxyawakpsmofiocosvaqcnscicabiuqvcqoqi
hqyedmeueqnycslwsasyzokubqumuofwoijaisiwleswrkwywermwkzukekmxuayheykyudcempomqmc
kljbyzbxblqtnpgjpdptwbrdotdjdbcjvrwdrprjirzfenfvfrozdtmxtbtzaplvcrvnvpgxpjkbjtjx
mftxslxzxfsnxlavlflnyvbzifzlzvedfnqpnrndlmkczacycmruoqhkqequxcsepuekecdkwsxesqsk
jsagfogwgspaeunyucuabqmwdswowqhyqklckukynguytmyaygtoymbwmgmozwcajgamawfegorqosoe
mnldabdzdnsvprilrfrvydtfqvflfdelxtyftrtlktbhgphxhtqbfvozvdvbcrnxetxpxrizrlmdlvlz
ohvzunzbzhupzncxnhnpaxdbkhbnbxgfhpsrptpfnomebceaeotwqsjmsgswzeugrwgmgefmyuzgusum
lucihqiyiurcgwpawewcdsoyfuyqysjasmnemwmapiwavoacaivqaodyoioqbyeclicocyhgiqtsquqg
opnfcdfbfpuxrtknthtxafvhsxhnhfgnzvahvtvnmvdjirjzjvsdhxqbxfxdetpzgvzrztkbtnofnxnb
qjxbwpbdbjwrbpezpjprczfdmjdpdzihjrutrvrhpqogdegcgqvysulouiuybgwityioighoawbiwuwo
nwekjskakwteiyrcygyefuqahwasaulcuopgoyocrkycxqceckxscqfaqkqsdagenkeqeajiksvuswsi
qrphefhdhrwztvmpvjvzchxjuzjpjhipbxcjxvxpoxflktlblxufjzsdzhzfgvrbixbtbvmdvpqhpzpd
slzdyrdfdlytdrgbrlrtebhfolfrfbkjltwvtxtjrsqifgieisxauwnqwkwadiykvakqkijqcydkywyq
pygmlumcmyvgkateaiaghwscjycucwnewqriqaqetmaezsegemzueshcsmsufcigpmgsgclkmuxwuyuk
strjghjfjtybvxorxlxbejzlwblrljkrdzelzxzrqzhnmvndnzwhlbufbjbhixtdkzdvdxofxrsjrbrf
unbfatfhfnavftidtntvgdjhqnhthdmlnvyxvzvltuskhikgkuzcwypsymycfkamxcmsmklseafmayas
raionwoeoaximcvgckcijyuelaeweypgystkscsgvocgbugigobwgujeuouwhekiroiuienmowzywawm
uvtlijlhlvadxzqtznzdglbnydntnlmtfbgnbzbtsbjpoxpfpbyjndwhdldjkzvfmbfxfzqhztultdth
wpdhcvhjhpcxhvkfvpvxifljspjvjfonpxazxbxnvwumjkmimwbeyaruaoaehmcozeouomnugchocacu
tckqpyqgqczkoexiemeklawgncgygariauvmueuixqeidwikiqdyiwlgwqwyjgmktqkwkgpoqybaycyo
wxvnklnjnxcfzbsvbpbfindpafpvpnovhdipdbdvudlrqzrhrdalpfyjfnflmbxhodhzhbsjbvwnvfvj
yrfjexjljrezjxmhxrxzkhnlurlxlhqprzcbzdzpxywolmokoydgactwcqcgjoeqbgqwqopwiejqecew
vemsrasisebmqgzkgogmncyipeiaictkcwxowgwkzsgkfykmksfakyniysyaliomvsmymirqsadcaeaq
yzxpmnplpzehbduxdrdhkpfrchrxrpqxjfkrfdfxwfntsbtjtfcnrhalhphnodzjqfjbjduldxypxhxl
athlgzlnltgblzojztzbmjpnwtnznjsrtbedbfbrzayqnoqmqaficevyeseilqgsdisysqrykglsgegy
xgoutcukugdosibmiqiopeakrgkckevmeyzqyiymbuimhamomuhcmapkauacnkqoxuoaoktsucfecgcs
abzroprnrbgjdfwzftfjmrhtejtztrszlhmthfhzyhpvudvlvheptjcnjrjpqfblshldlfwnfzarzjzn
cvjnibnpnvidnbqlbvbdolrpyvpbplutvdgfdhdtbcaspqsoschkegxagugknsiufkuaustaminuigia
ziqwvewmwifqukdokskqrgcmtimemgxogabsakaodwkojcoqowjeocrmcwcepmsqzwqcqmvuwehgeieu
cdbtqrtptdilfhybhvhlotjvglvbvtubnjovjhjbajrxwfxnxjgrvlepltlrshdnujnfnhyphbctblbp
exlpkdprpxkfpdsndxdfqntraxrdrnwvxfihfjfvdecursuquejmgizciwimpukwhmwcwuvcokpwkikc
bksyxgyoykhswmfqmumstieovkogoizqicducmcqfymqleqsqylgqetoeyegrousbysesoxwygjigkgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: decursuque
Cipher: qrphefhdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: decursuque
Cipher: 41513154243454145451

Extended Methods:
Method #1

Plaintext: decursuque
method variations:
ikhzwxzvzkopnebceaeptuskghkfkuyzxpmnplpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
d e c u r s u q u e 
4 5 3 5 2 3 5 1 5 5 
1 1 1 4 4 4 4 4 4 1 
They are then read out in rows:
45352351551114444441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: decursuque
Cipher: yxmezaqttd

Read more ...
Method #3

Plaintext: decursuque
method variations:
vlvioydyyq lvioydyyqv vioydyyqvl
ioydyyqvlv oydyyqvlvi ydyyqvlvio
dyyqvlvioy yyqvlvioyd yqvlvioydy
qvlvioydyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: decursuque

first 5040 cipher variations(3628800 total)
decursuque decursuqeu decursuuqe decursuueq decursueuq decursuequ decursquue decursqueu decursquue decursqueu decursqeuu
decursqeuu decursuque decursuqeu decursuuqe decursuueq decursueuq decursuequ decursequu decursequu decurseuqu decurseuuq
decurseuuq decurseuqu decurusque decurusqeu decurusuqe decurusueq decuruseuq decurusequ decuruqsue decuruqseu decuruquse
decuruques decuruqeus decuruqesu decuruuqse decuruuqes decuruusqe decuruuseq decuruuesq decuruueqs decuruequs decurueqsu
decurueuqs decurueusq decuruesuq decuruesqu decurqusue decurquseu decurquuse decurquues decurqueus decurquesu decurqsuue
decurqsueu decurqsuue decurqsueu decurqseuu decurqseuu decurqusue decurquseu decurquuse decurquues decurqueus decurquesu
decurqesuu decurqesuu decurqeusu decurqeuus decurqeuus decurqeusu decuruuqse decuruuqes decuruusqe decuruuseq decuruuesq
decuruueqs decuruquse decuruques decuruqsue decuruqseu decuruqesu decuruqeus decurusque decurusqeu decurusuqe decurusueq
decuruseuq decurusequ decurueqsu decuruequs decuruesqu decuruesuq decurueusq decurueuqs decureuqus decureuqsu decureuuqs
decureuusq decureusuq decureusqu decurequus decurequsu decurequus decurequsu decureqsuu decureqsuu decureuqus decureuqsu
decureuuqs decureuusq decureusuq decureusqu decuresquu decuresquu decuresuqu decuresuuq decuresuuq decuresuqu decusruque
decusruqeu decusruuqe decusruueq decusrueuq decusruequ decusrquue decusrqueu decusrquue decusrqueu decusrqeuu decusrqeuu
decusruque decusruqeu decusruuqe decusruueq decusrueuq decusruequ decusrequu decusrequu decusreuqu decusreuuq decusreuuq
decusreuqu decusurque decusurqeu decusuruqe decusurueq decusureuq decusurequ decusuqrue decusuqreu decusuqure decusuquer
decusuqeur decusuqeru decusuuqre decusuuqer decusuurqe decusuureq decusuuerq decusuueqr decusuequr decusueqru decusueuqr
decusueurq decusueruq decusuerqu decusqurue decusqureu decusquure decusquuer decusqueur decusqueru decusqruue decusqrueu
decusqruue decusqrueu decusqreuu decusqreuu decusqurue decusqureu decusquure decusquuer decusqueur decusqueru decusqeruu
decusqeruu decusqeuru decusqeuur decusqeuur decusqeuru decusuuqre decusuuqer decusuurqe decusuureq decusuuerq decusuueqr
decusuqure decusuquer decusuqrue decusuqreu decusuqeru decusuqeur decusurque decusurqeu decusuruqe decusurueq decusureuq
decusurequ decusueqru decusuequr decusuerqu decusueruq decusueurq decusueuqr decuseuqur decuseuqru decuseuuqr decuseuurq
decuseuruq decuseurqu decusequur decusequru decusequur decusequru decuseqruu decuseqruu decuseuqur decuseuqru decuseuuqr
decuseuurq decuseuruq decuseurqu decuserquu decuserquu decuseruqu decuseruuq decuseruuq decuseruqu decuusrque decuusrqeu
decuusruqe decuusrueq decuusreuq decuusrequ decuusqrue decuusqreu decuusqure decuusquer decuusqeur decuusqeru decuusuqre
decuusuqer decuusurqe decuusureq decuusuerq decuusueqr decuusequr decuuseqru decuuseuqr decuuseurq decuuseruq decuuserqu
decuursque decuursqeu decuursuqe decuursueq decuurseuq decuursequ decuurqsue decuurqseu decuurquse decuurques decuurqeus
decuurqesu decuuruqse decuuruqes decuurusqe decuuruseq decuuruesq decuurueqs decuurequs decuureqsu decuureuqs decuureusq
decuuresuq decuuresqu decuuqrsue decuuqrseu decuuqruse decuuqrues decuuqreus decuuqresu decuuqsrue decuuqsreu decuuqsure
decuuqsuer decuuqseur decuuqseru decuuqusre decuuquser decuuqurse decuuqures decuuquers decuuquesr decuuqesur decuuqesru
decuuqeusr decuuqeurs decuuqerus decuuqersu decuuurqse decuuurqes decuuursqe decuuurseq decuuuresq decuuureqs decuuuqrse
decuuuqres decuuuqsre decuuuqser decuuuqesr decuuuqers decuuusqre decuuusqer decuuusrqe decuuusreq decuuuserq decuuuseqr
decuuueqsr decuuueqrs decuuuesqr decuuuesrq decuuuersq decuuuerqs decuuerqus decuuerqsu decuueruqs decuuerusq decuuersuq
decuuersqu decuueqrus decuueqrsu decuuequrs decuuequsr decuueqsur decuueqsru decuueuqrs decuueuqsr decuueurqs decuueursq
decuueusrq decuueusqr decuuesqur decuuesqru decuuesuqr decuuesurq decuuesruq decuuesrqu decuqsurue decuqsureu decuqsuure
decuqsuuer decuqsueur decuqsueru decuqsruue decuqsrueu decuqsruue decuqsrueu decuqsreuu decuqsreuu decuqsurue decuqsureu
decuqsuure decuqsuuer decuqsueur decuqsueru decuqseruu decuqseruu decuqseuru decuqseuur decuqseuur decuqseuru decuqusrue
decuqusreu decuqusure decuqusuer decuquseur decuquseru decuqursue decuqurseu decuquruse decuqurues decuqureus decuquresu
decuquurse decuquures decuquusre decuquuser decuquuesr decuquuers decuquerus decuquersu decuqueurs decuqueusr decuquesur
decuquesru decuqrusue decuqruseu decuqruuse decuqruues decuqrueus decuqruesu decuqrsuue decuqrsueu decuqrsuue decuqrsueu
decuqrseuu decuqrseuu decuqrusue decuqruseu decuqruuse decuqruues decuqrueus decuqruesu decuqresuu decuqresuu decuqreusu
decuqreuus decuqreuus decuqreusu decuquurse decuquures decuquusre decuquuser decuquuesr decuquuers decuquruse decuqurues
decuqursue decuqurseu decuquresu decuqureus decuqusrue decuqusreu decuqusure decuqusuer decuquseur decuquseru decuquersu
decuquerus decuquesru decuquesur decuqueusr decuqueurs decuqeurus decuqeursu decuqeuurs decuqeuusr decuqeusur decuqeusru
decuqeruus decuqerusu decuqeruus decuqerusu decuqersuu decuqersuu decuqeurus decuqeursu decuqeuurs decuqeuusr decuqeusur
decuqeusru decuqesruu decuqesruu decuqesuru decuqesuur decuqesuur decuqesuru decuusuqre decuusuqer decuusurqe decuusureq
decuusuerq decuusueqr decuusqure decuusquer decuusqrue decuusqreu decuusqeru decuusqeur decuusrque decuusrqeu decuusruqe
decuusrueq decuusreuq decuusrequ decuuseqru decuusequr decuuserqu decuuseruq decuuseurq decuuseuqr decuuusqre decuuusqer
decuuusrqe decuuusreq decuuuserq decuuuseqr decuuuqsre decuuuqser decuuuqrse decuuuqres decuuuqers decuuuqesr decuuurqse
decuuurqes decuuursqe decuuurseq decuuuresq decuuureqs decuuueqrs decuuueqsr decuuuerqs decuuuersq decuuuesrq decuuuesqr
decuuqusre decuuquser decuuqurse decuuqures decuuquers decuuquesr decuuqsure decuuqsuer decuuqsrue decuuqsreu decuuqseru
decuuqseur decuuqrsue decuuqrseu decuuqruse decuuqrues decuuqreus decuuqresu decuuqesru decuuqesur decuuqersu decuuqerus
decuuqeurs decuuqeusr decuuruqse decuuruqes decuurusqe decuuruseq decuuruesq decuurueqs decuurquse decuurques decuurqsue
decuurqseu decuurqesu decuurqeus decuursque decuursqeu decuursuqe decuursueq decuurseuq decuursequ decuureqsu decuurequs
decuuresqu decuuresuq decuureusq decuureuqs decuueuqrs decuueuqsr decuueurqs decuueursq decuueusrq decuueusqr decuuequrs
decuuequsr decuueqrus decuueqrsu decuueqsru decuueqsur decuuerqus decuuerqsu decuueruqs decuuerusq decuuersuq decuuersqu
decuuesqru decuuesqur decuuesrqu decuuesruq decuuesurq decuuesuqr decuesuqur decuesuqru decuesuuqr decuesuurq decuesuruq
decuesurqu decuesquur decuesquru decuesquur decuesquru decuesqruu decuesqruu decuesuqur decuesuqru decuesuuqr decuesuurq
decuesuruq decuesurqu decuesrquu decuesrquu decuesruqu decuesruuq decuesruuq decuesruqu decueusqur decueusqru decueusuqr
decueusurq decueusruq decueusrqu decueuqsur decueuqsru decueuqusr decueuqurs decueuqrus decueuqrsu decueuuqsr decueuuqrs
decueuusqr decueuusrq decueuursq decueuurqs decueurqus decueurqsu decueuruqs decueurusq decueursuq decueursqu decuequsur
decuequsru decuequusr decuequurs decuequrus decueqursu decueqsuur decueqsuru decueqsuur decueqsuru decueqsruu decueqsruu
decuequsur decuequsru decuequusr decuequurs decuequrus decueqursu decueqrsuu decueqrsuu decueqrusu decueqruus decueqruus
decueqrusu decueuuqsr decueuuqrs decueuusqr decueuusrq decueuursq decueuurqs decueuqusr decueuqurs decueuqsur decueuqsru
decueuqrsu decueuqrus decueusqur decueusqru decueusuqr decueusurq decueusruq decueusrqu decueurqsu decueurqus decueursqu
decueursuq decueurusq decueuruqs decueruqus decueruqsu decueruuqs decueruusq decuerusuq decuerusqu decuerquus decuerqusu
decuerquus decuerqusu decuerqsuu decuerqsuu decueruqus decueruqsu decueruuqs decueruusq decuerusuq decuerusqu decuersquu
decuersquu decuersuqu decuersuuq decuersuuq decuersuqu decrusuque decrusuqeu decrusuuqe decrusuueq decrusueuq decrusuequ
decrusquue decrusqueu decrusquue decrusqueu decrusqeuu decrusqeuu decrusuque decrusuqeu decrusuuqe decrusuueq decrusueuq
decrusuequ decrusequu decrusequu decruseuqu decruseuuq decruseuuq decruseuqu decruusque decruusqeu decruusuqe decruusueq
decruuseuq decruusequ decruuqsue decruuqseu decruuquse decruuques decruuqeus decruuqesu decruuuqse decruuuqes decruuusqe
decruuuseq decruuuesq decruuueqs decruuequs decruueqsu decruueuqs decruueusq decruuesuq decruuesqu decruqusue decruquseu
decruquuse decruquues decruqueus decruquesu decruqsuue decruqsueu decruqsuue decruqsueu decruqseuu decruqseuu decruqusue
decruquseu decruquuse decruquues decruqueus decruquesu decruqesuu decruqesuu decruqeusu decruqeuus decruqeuus decruqeusu
decruuuqse decruuuqes decruuusqe decruuuseq decruuuesq decruuueqs decruuquse decruuques decruuqsue decruuqseu decruuqesu
decruuqeus decruusque decruusqeu decruusuqe decruusueq decruuseuq decruusequ decruueqsu decruuequs decruuesqu decruuesuq
decruueusq decruueuqs decrueuqus decrueuqsu decrueuuqs decrueuusq decrueusuq decrueusqu decruequus decruequsu decruequus
decruequsu decrueqsuu decrueqsuu decrueuqus decrueuqsu decrueuuqs decrueuusq decrueusuq decrueusqu decruesquu decruesquu
decruesuqu decruesuuq decruesuuq decruesuqu decrsuuque decrsuuqeu decrsuuuqe decrsuuueq decrsuueuq decrsuuequ decrsuquue
decrsuqueu decrsuquue decrsuqueu decrsuqeuu decrsuqeuu decrsuuque decrsuuqeu decrsuuuqe decrsuuueq decrsuueuq decrsuuequ
decrsuequu decrsuequu decrsueuqu decrsueuuq decrsueuuq decrsueuqu decrsuuque decrsuuqeu decrsuuuqe decrsuuueq decrsuueuq
decrsuuequ decrsuquue decrsuqueu decrsuquue decrsuqueu decrsuqeuu decrsuqeuu decrsuuque decrsuuqeu decrsuuuqe decrsuuueq
decrsuueuq decrsuuequ decrsuequu decrsuequu decrsueuqu decrsueuuq decrsueuuq decrsueuqu decrsquuue decrsquueu decrsquuue
decrsquueu decrsqueuu decrsqueuu decrsquuue decrsquueu decrsquuue decrsquueu decrsqueuu decrsqueuu decrsquuue decrsquueu
decrsquuue decrsquueu decrsqueuu decrsqueuu decrsqeuuu decrsqeuuu decrsqeuuu decrsqeuuu decrsqeuuu decrsqeuuu decrsuuque
decrsuuqeu decrsuuuqe decrsuuueq decrsuueuq decrsuuequ decrsuquue decrsuqueu decrsuquue decrsuqueu decrsuqeuu decrsuqeuu
decrsuuque decrsuuqeu decrsuuuqe decrsuuueq decrsuueuq decrsuuequ decrsuequu decrsuequu decrsueuqu decrsueuuq decrsueuuq
decrsueuqu decrseuquu decrseuquu decrseuuqu decrseuuuq decrseuuuq decrseuuqu decrsequuu decrsequuu decrsequuu decrsequuu
decrsequuu decrsequuu decrseuquu decrseuquu decrseuuqu decrseuuuq decrseuuuq decrseuuqu decrseuquu decrseuquu decrseuuqu
decrseuuuq decrseuuuq decrseuuqu decrusuque decrusuqeu decrusuuqe decrusuueq decrusueuq decrusuequ decrusquue decrusqueu
decrusquue decrusqueu decrusqeuu decrusqeuu decrusuque decrusuqeu decrusuuqe decrusuueq decrusueuq decrusuequ decrusequu
decrusequu decruseuqu decruseuuq decruseuuq decruseuqu decruusque decruusqeu decruusuqe decruusueq decruuseuq decruusequ
decruuqsue decruuqseu decruuquse decruuques decruuqeus decruuqesu decruuuqse decruuuqes decruuusqe decruuuseq decruuuesq
decruuueqs decruuequs decruueqsu decruueuqs decruueusq decruuesuq decruuesqu decruqusue decruquseu decruquuse decruquues
decruqueus decruquesu decruqsuue decruqsueu decruqsuue decruqsueu decruqseuu decruqseuu decruqusue decruquseu decruquuse
decruquues decruqueus decruquesu decruqesuu decruqesuu decruqeusu decruqeuus decruqeuus decruqeusu decruuuqse decruuuqes
decruuusqe decruuuseq decruuuesq decruuueqs decruuquse decruuques decruuqsue decruuqseu decruuqesu decruuqeus decruusque
decruusqeu decruusuqe decruusueq decruuseuq decruusequ decruueqsu decruuequs decruuesqu decruuesuq decruueusq decruueuqs
decrueuqus decrueuqsu decrueuuqs decrueuusq decrueusuq decrueusqu decruequus decruequsu decruequus decruequsu decrueqsuu
decrueqsuu decrueuqus decrueuqsu decrueuuqs decrueuusq decrueusuq decrueusqu decruesquu decruesquu decruesuqu decruesuuq
decruesuuq decruesuqu decrqsuuue decrqsuueu decrqsuuue decrqsuueu decrqsueuu decrqsueuu decrqsuuue decrqsuueu decrqsuuue
decrqsuueu decrqsueuu decrqsueuu decrqsuuue decrqsuueu decrqsuuue decrqsuueu decrqsueuu decrqsueuu decrqseuuu decrqseuuu
decrqseuuu decrqseuuu decrqseuuu decrqseuuu decrqusuue decrqusueu decrqusuue decrqusueu decrquseuu decrquseuu decrquusue
decrquuseu decrquuuse decrquuues decrquueus decrquuesu decrquuuse decrquuues decrquusue decrquuseu decrquuesu decrquueus
decrqueuus decrqueusu decrqueuus decrqueusu decrquesuu decrquesuu decrquusue decrquuseu decrquuuse decrquuues decrquueus
decrquuesu decrqusuue decrqusueu decrqusuue decrqusueu decrquseuu decrquseuu decrquusue decrquuseu decrquuuse decrquuues
decrquueus decrquuesu decrquesuu decrquesuu decrqueusu decrqueuus decrqueuus decrqueusu decrquuuse decrquuues decrquusue
decrquuseu decrquuesu decrquueus decrquuuse decrquuues decrquusue decrquuseu decrquuesu decrquueus decrqusuue decrqusueu
decrqusuue decrqusueu decrquseuu decrquseuu decrqueusu decrqueuus decrquesuu decrquesuu decrqueusu decrqueuus decrqeuuus
decrqeuusu decrqeuuus decrqeuusu decrqeusuu decrqeusuu decrqeuuus decrqeuusu decrqeuuus decrqeuusu decrqeusuu decrqeusuu
decrqeuuus decrqeuusu decrqeuuus decrqeuusu decrqeusuu decrqeusuu decrqesuuu decrqesuuu decrqesuuu decrqesuuu decrqesuuu
decrqesuuu decrusuque decrusuqeu decrusuuqe decrusuueq decrusueuq decrusuequ decrusquue decrusqueu decrusquue decrusqueu
decrusqeuu decrusqeuu decrusuque decrusuqeu decrusuuqe decrusuueq decrusueuq decrusuequ decrusequu decrusequu decruseuqu
decruseuuq decruseuuq decruseuqu decruusque decruusqeu decruusuqe decruusueq decruuseuq decruusequ decruuqsue decruuqseu
decruuquse decruuques decruuqeus decruuqesu decruuuqse decruuuqes decruuusqe decruuuseq decruuuesq decruuueqs decruuequs
decruueqsu decruueuqs decruueusq decruuesuq decruuesqu decruqusue decruquseu decruquuse decruquues decruqueus decruquesu
decruqsuue decruqsueu decruqsuue decruqsueu decruqseuu decruqseuu decruqusue decruquseu decruquuse decruquues decruqueus
decruquesu decruqesuu decruqesuu decruqeusu decruqeuus decruqeuus decruqeusu decruuuqse decruuuqes decruuusqe decruuuseq
decruuuesq decruuueqs decruuquse decruuques decruuqsue decruuqseu decruuqesu decruuqeus decruusque decruusqeu decruusuqe
decruusueq decruuseuq decruusequ decruueqsu decruuequs decruuesqu decruuesuq decruueusq decruueuqs decrueuqus decrueuqsu
decrueuuqs decrueuusq decrueusuq decrueusqu decruequus decruequsu decruequus decruequsu decrueqsuu decrueqsuu decrueuqus
decrueuqsu decrueuuqs decrueuusq decrueusuq decrueusqu decruesquu decruesquu decruesuqu decruesuuq decruesuuq decruesuqu
decresuquu decresuquu decresuuqu decresuuuq decresuuuq decresuuqu decresquuu decresquuu decresquuu decresquuu decresquuu
decresquuu decresuquu decresuquu decresuuqu decresuuuq decresuuuq decresuuqu decresuquu decresuquu decresuuqu decresuuuq
decresuuuq decresuuqu decreusquu decreusquu decreusuqu decreusuuq decreusuuq decreusuqu decreuqsuu decreuqsuu decreuqusu
decreuquus decreuquus decreuqusu decreuuqsu decreuuqus decreuusqu decreuusuq decreuuusq decreuuuqs decreuuqus decreuuqsu
decreuuuqs decreuuusq decreuusuq decreuusqu decrequsuu decrequsuu decrequusu decrequuus decrequuus decrequusu decreqsuuu
decreqsuuu decreqsuuu decreqsuuu decreqsuuu decreqsuuu decrequsuu decrequsuu decrequusu decrequuus decrequuus decrequusu
decrequsuu decrequsuu decrequusu decrequuus decrequuus decrequusu decreuuqsu decreuuqus decreuusqu decreuusuq decreuuusq
decreuuuqs decreuqusu decreuquus decreuqsuu decreuqsuu decreuqusu decreuquus decreusquu decreusquu decreusuqu decreusuuq
decreusuuq decreusuqu decreuuqsu decreuuqus decreuusqu decreuusuq decreuuusq decreuuuqs decreuuqus decreuuqsu decreuuuqs
decreuuusq decreuusuq decreuusqu decreuquus decreuqusu decreuquus decreuqusu decreuqsuu decreuqsuu decreuuqus decreuuqsu
decreuuuqs decreuuusq decreuusuq decreuusqu decreusquu decreusquu decreusuqu decreusuuq decreusuuq decreusuqu decsruuque
decsruuqeu decsruuuqe decsruuueq decsruueuq decsruuequ decsruquue decsruqueu decsruquue decsruqueu decsruqeuu decsruqeuu
decsruuque decsruuqeu decsruuuqe decsruuueq decsruueuq decsruuequ decsruequu decsruequu decsrueuqu decsrueuuq decsrueuuq
decsrueuqu decsruuque decsruuqeu decsruuuqe decsruuueq decsruueuq decsruuequ decsruquue decsruqueu decsruquue decsruqueu
decsruqeuu decsruqeuu decsruuque decsruuqeu decsruuuqe decsruuueq decsruueuq decsruuequ decsruequu decsruequu decsrueuqu
decsrueuuq decsrueuuq decsrueuqu decsrquuue decsrquueu decsrquuue decsrquueu decsrqueuu decsrqueuu decsrquuue decsrquueu
decsrquuue decsrquueu decsrqueuu decsrqueuu decsrquuue decsrquueu decsrquuue decsrquueu decsrqueuu decsrqueuu decsrqeuuu
decsrqeuuu decsrqeuuu decsrqeuuu decsrqeuuu decsrqeuuu decsruuque decsruuqeu decsruuuqe decsruuueq decsruueuq decsruuequ
decsruquue decsruqueu decsruquue decsruqueu decsruqeuu decsruqeuu decsruuque decsruuqeu decsruuuqe decsruuueq decsruueuq
decsruuequ decsruequu decsruequu decsrueuqu decsrueuuq decsrueuuq decsrueuqu decsreuquu decsreuquu decsreuuqu decsreuuuq
decsreuuuq decsreuuqu decsrequuu decsrequuu decsrequuu decsrequuu decsrequuu decsrequuu decsreuquu decsreuquu decsreuuqu
decsreuuuq decsreuuuq decsreuuqu decsreuquu decsreuquu decsreuuqu decsreuuuq decsreuuuq decsreuuqu decsuruque decsuruqeu
decsuruuqe decsuruueq decsurueuq decsuruequ decsurquue decsurqueu decsurquue decsurqueu decsurqeuu decsurqeuu decsuruque
decsuruqeu decsuruuqe decsuruueq decsurueuq decsuruequ decsurequu decsurequu decsureuqu decsureuuq decsureuuq decsureuqu
decsuurque decsuurqeu decsuuruqe decsuurueq decsuureuq decsuurequ decsuuqrue decsuuqreu decsuuqure decsuuquer decsuuqeur
decsuuqeru decsuuuqre decsuuuqer decsuuurqe decsuuureq decsuuuerq decsuuueqr decsuuequr decsuueqru decsuueuqr decsuueurq
decsuueruq decsuuerqu decsuqurue decsuqureu decsuquure decsuquuer decsuqueur decsuqueru decsuqruue decsuqrueu decsuqruue
decsuqrueu decsuqreuu decsuqreuu decsuqurue decsuqureu decsuquure decsuquuer decsuqueur decsuqueru decsuqeruu decsuqeruu
decsuqeuru decsuqeuur decsuqeuur decsuqeuru decsuuuqre decsuuuqer decsuuurqe decsuuureq decsuuuerq decsuuueqr decsuuqure
decsuuquer decsuuqrue decsuuqreu decsuuqeru decsuuqeur decsuurque decsuurqeu decsuuruqe decsuurueq decsuureuq decsuurequ
decsuueqru decsuuequr decsuuerqu decsuueruq decsuueurq decsuueuqr decsueuqur decsueuqru decsueuuqr decsueuurq decsueuruq
decsueurqu decsuequur decsuequru decsuequur decsuequru decsueqruu decsueqruu decsueuqur decsueuqru decsueuuqr decsueuurq
decsueuruq decsueurqu decsuerquu decsuerquu decsueruqu decsueruuq decsueruuq decsueruqu decsuurque decsuurqeu decsuuruqe
decsuurueq decsuureuq decsuurequ decsuuqrue decsuuqreu decsuuqure decsuuquer decsuuqeur decsuuqeru decsuuuqre decsuuuqer
decsuuurqe decsuuureq decsuuuerq decsuuueqr decsuuequr decsuueqru decsuueuqr decsuueurq decsuueruq decsuuerqu decsuruque
decsuruqeu decsuruuqe decsuruueq decsurueuq decsuruequ decsurquue decsurqueu decsurquue decsurqueu decsurqeuu decsurqeuu
decsuruque decsuruqeu decsuruuqe decsuruueq decsurueuq decsuruequ decsurequu decsurequu decsureuqu decsureuuq decsureuuq
decsureuqu decsuqruue decsuqrueu decsuqruue decsuqrueu decsuqreuu decsuqreuu decsuqurue decsuqureu decsuquure decsuquuer
decsuqueur decsuqueru decsuquure decsuquuer decsuqurue decsuqureu decsuqueru decsuqueur decsuqeuur decsuqeuru decsuqeuur
decsuqeuru decsuqeruu decsuqeruu decsuurque decsuurqeu decsuuruqe decsuurueq decsuureuq decsuurequ decsuuqrue decsuuqreu
decsuuqure decsuuquer decsuuqeur decsuuqeru decsuuuqre decsuuuqer decsuuurqe decsuuureq decsuuuerq decsuuueqr decsuuequr
decsuueqru decsuueuqr decsuueurq decsuueruq decsuuerqu decsuerquu decsuerquu decsueruqu decsueruuq decsueruuq decsueruqu
decsueqruu decsueqruu decsuequru decsuequur decsuequur decsuequru decsueuqru decsueuqur decsueurqu decsueuruq decsueuurq
decsueuuqr decsueuqur decsueuqru decsueuuqr decsueuurq decsueuruq decsueurqu decsquurue decsquureu decsquuure decsquuuer
decsquueur decsquueru decsquruue decsqurueu decsquruue decsqurueu decsqureuu decsqureuu decsquurue decsquureu decsquuure
decsquuuer decsquueur decsquueru decsqueruu decsqueruu decsqueuru decsqueuur decsqueuur decsqueuru decsquurue decsquureu
decsquuure decsquuuer decsquueur decsquueru decsquruue decsqurueu decsquruue decsqurueu decsqureuu decsqureuu decsquurue
decsquureu decsquuure decsquuuer decsquueur decsquueru decsqueruu decsqueruu decsqueuru decsqueuur decsqueuur decsqueuru
decsqruuue decsqruueu decsqruuue decsqruueu decsqrueuu decsqrueuu decsqruuue decsqruueu decsqruuue decsqruueu decsqrueuu
decsqrueuu decsqruuue decsqruueu decsqruuue decsqruueu decsqrueuu decsqrueuu decsqreuuu decsqreuuu decsqreuuu decsqreuuu
decsqreuuu decsqreuuu decsquurue decsquureu decsquuure decsquuuer decsquueur decsquueru decsquruue decsqurueu decsquruue
decsqurueu decsqureuu decsqureuu decsquurue decsquureu decsquuure decsquuuer decsquueur decsquueru decsqueruu decsqueruu
decsqueuru decsqueuur decsqueuur decsqueuru decsqeuruu decsqeuruu decsqeuuru decsqeuuur decsqeuuur decsqeuuru decsqeruuu
decsqeruuu decsqeruuu decsqeruuu decsqeruuu decsqeruuu decsqeuruu decsqeuruu decsqeuuru decsqeuuur decsqeuuur decsqeuuru
decsqeuruu decsqeuruu decsqeuuru decsqeuuur decsqeuuur decsqeuuru decsuuuqre decsuuuqer decsuuurqe decsuuureq decsuuuerq
decsuuueqr decsuuqure decsuuquer decsuuqrue decsuuqreu decsuuqeru decsuuqeur decsuurque decsuurqeu decsuuruqe decsuurueq
decsuureuq decsuurequ decsuueqru decsuuequr decsuuerqu decsuueruq decsuueurq decsuueuqr decsuuuqre decsuuuqer decsuuurqe
decsuuureq decsuuuerq decsuuueqr decsuuqure decsuuquer decsuuqrue decsuuqreu decsuuqeru decsuuqeur decsuurque decsuurqeu
decsuuruqe decsuurueq decsuureuq decsuurequ decsuueqru decsuuequr decsuuerqu decsuueruq decsuueurq decsuueuqr decsuquure
decsuquuer decsuqurue decsuqureu decsuqueru decsuqueur decsuquure decsuquuer decsuqurue decsuqureu decsuqueru decsuqueur
decsuqruue decsuqrueu decsuqruue decsuqrueu decsuqreuu decsuqreuu decsuqeuru decsuqeuur decsuqeruu decsuqeruu decsuqeuru
decsuqeuur decsuruque decsuruqeu decsuruuqe decsuruueq decsurueuq decsuruequ decsurquue decsurqueu decsurquue decsurqueu
decsurqeuu decsurqeuu decsuruque decsuruqeu decsuruuqe decsuruueq decsurueuq decsuruequ decsurequu decsurequu decsureuqu
decsureuuq decsureuuq decsureuqu decsueuqru decsueuqur decsueurqu decsueuruq decsueuurq decsueuuqr decsuequru decsuequur
decsueqruu decsueqruu decsuequru decsuequur decsuerquu decsuerquu decsueruqu decsueruuq decsueruuq decsueruqu decsueuqru
decsueuqur decsueurqu decsueuruq decsueuurq decsueuuqr decseuuqur decseuuqru decseuuuqr decseuuurq decseuuruq decseuurqu
decseuquur decseuquru decseuquur decseuquru decseuqruu decseuqruu decseuuqur decseuuqru decseuuuqr decseuuurq decseuuruq
decseuurqu decseurquu decseurquu decseuruqu decseuruuq decseuruuq decseuruqu decseuuqur decseuuqru decseuuuqr decseuuurq
decseuuruq decseuurqu decseuquur decseuquru decseuquur decseuquru decseuqruu decseuqruu decseuuqur decseuuqru decseuuuqr
decseuuurq decseuuruq decseuurqu decseurquu decseurquu decseuruqu decseuruuq decseuruuq decseuruqu decsequuur decsequuru
decsequuur decsequuru decsequruu decsequruu decsequuur decsequuru decsequuur decsequuru decsequruu decsequruu decsequuur
decsequuru decsequuur decsequuru decsequruu decsequruu decseqruuu decseqruuu decseqruuu decseqruuu decseqruuu decseqruuu
decseuuqur decseuuqru decseuuuqr decseuuurq decseuuruq decseuurqu decseuquur decseuquru decseuquur decseuquru decseuqruu
decseuqruu decseuuqur decseuuqru decseuuuqr decseuuurq decseuuruq decseuurqu decseurquu decseurquu decseuruqu decseuruuq
decseuruuq decseuruqu decseruquu decseruquu decseruuqu decseruuuq decseruuuq decseruuqu decserquuu decserquuu decserquuu
decserquuu decserquuu decserquuu decseruquu decseruquu decseruuqu decseruuuq decseruuuq decseruuqu decseruquu decseruquu
decseruuqu decseruuuq decseruuuq decseruuqu decursuque decursuqeu decursuuqe decursuueq decursueuq decursuequ decursquue
decursqueu decursquue decursqueu decursqeuu decursqeuu decursuque decursuqeu decursuuqe decursuueq decursueuq decursuequ
decursequu decursequu decurseuqu decurseuuq decurseuuq decurseuqu decurusque decurusqeu decurusuqe decurusueq decuruseuq
decurusequ decuruqsue decuruqseu decuruquse decuruques decuruqeus decuruqesu decuruuqse decuruuqes decuruusqe decuruuseq
decuruuesq decuruueqs decuruequs decurueqsu decurueuqs decurueusq decuruesuq decuruesqu decurqusue decurquseu decurquuse
decurquues decurqueus decurquesu decurqsuue decurqsueu decurqsuue decurqsueu decurqseuu decurqseuu decurqusue decurquseu
decurquuse decurquues decurqueus decurquesu decurqesuu decurqesuu decurqeusu decurqeuus decurqeuus decurqeusu decuruuqse
decuruuqes decuruusqe decuruuseq decuruuesq decuruueqs decuruquse decuruques decuruqsue decuruqseu decuruqesu decuruqeus
decurusque decurusqeu decurusuqe decurusueq decuruseuq decurusequ decurueqsu decuruequs decuruesqu decuruesuq decurueusq
decurueuqs decureuqus decureuqsu decureuuqs decureuusq decureusuq decureusqu decurequus decurequsu decurequus decurequsu
decureqsuu decureqsuu decureuqus decureuqsu decureuuqs decureuusq decureusuq decureusqu decuresquu decuresquu decuresuqu
decuresuuq decuresuuq decuresuqu decusruque decusruqeu decusruuqe decusruueq decusrueuq decusruequ decusrquue decusrqueu
decusrquue decusrqueu decusrqeuu decusrqeuu decusruque decusruqeu decusruuqe decusruueq decusrueuq decusruequ decusrequu
decusrequu decusreuqu decusreuuq decusreuuq decusreuqu decusurque decusurqeu decusuruqe decusurueq decusureuq decusurequ
decusuqrue decusuqreu decusuqure decusuquer decusuqeur decusuqeru decusuuqre decusuuqer decusuurqe decusuureq decusuuerq
decusuueqr decusuequr decusueqru decusueuqr decusueurq decusueruq decusuerqu decusqurue decusqureu decusquure decusquuer
decusqueur decusqueru decusqruue decusqrueu decusqruue decusqrueu decusqreuu decusqreuu decusqurue decusqureu decusquure
decusquuer decusqueur decusqueru decusqeruu decusqeruu decusqeuru decusqeuur decusqeuur decusqeuru decusuuqre decusuuqer
decusuurqe decusuureq decusuuerq decusuueqr decusuqure decusuquer decusuqrue decusuqreu decusuqeru decusuqeur decusurque
decusurqeu decusuruqe decusurueq decusureuq decusurequ decusueqru decusuequr decusuerqu decusueruq decusueurq decusueuqr
decuseuqur decuseuqru decuseuuqr decuseuurq decuseuruq decuseurqu decusequur decusequru decusequur decusequru decuseqruu
decuseqruu decuseuqur decuseuqru decuseuuqr decuseuurq decuseuruq decuseurqu decuserquu decuserquu decuseruqu decuseruuq
decuseruuq decuseruqu decuusrque decuusrqeu decuusruqe decuusrueq decuusreuq decuusrequ decuusqrue decuusqreu decuusqure
decuusquer decuusqeur decuusqeru decuusuqre decuusuqer decuusurqe decuusureq decuusuerq decuusueqr decuusequr decuuseqru
decuuseuqr decuuseurq decuuseruq decuuserqu decuursque decuursqeu decuursuqe decuursueq decuurseuq decuursequ decuurqsue
decuurqseu decuurquse decuurques decuurqeus decuurqesu decuuruqse decuuruqes decuurusqe decuuruseq decuuruesq decuurueqs
decuurequs decuureqsu decuureuqs decuureusq decuuresuq decuuresqu decuuqrsue decuuqrseu decuuqruse decuuqrues decuuqreus
decuuqresu decuuqsrue decuuqsreu decuuqsure decuuqsuer decuuqseur decuuqseru decuuqusre decuuquser decuuqurse decuuqures
decuuquers decuuquesr decuuqesur decuuqesru decuuqeusr decuuqeurs decuuqerus decuuqersu decuuurqse decuuurqes decuuursqe
decuuurseq decuuuresq decuuureqs decuuuqrse decuuuqres decuuuqsre decuuuqser decuuuqesr decuuuqers decuuusqre decuuusqer
decuuusrqe decuuusreq decuuuserq decuuuseqr decuuueqsr decuuueqrs decuuuesqr decuuuesrq decuuuersq decuuuerqs decuuerqus
decuuerqsu decuueruqs decuuerusq decuuersuq decuuersqu decuueqrus decuueqrsu decuuequrs decuuequsr decuueqsur decuueqsru
decuueuqrs decuueuqsr decuueurqs decuueursq decuueusrq decuueusqr decuuesqur decuuesqru decuuesuqr decuuesurq decuuesruq
decuuesrqu decuqsurue decuqsureu decuqsuure decuqsuuer decuqsueur decuqsueru decuqsruue decuqsrueu decuqsruue decuqsrueu
decuqsreuu decuqsreuu decuqsurue decuqsureu decuqsuure decuqsuuer decuqsueur decuqsueru decuqseruu decuqseruu decuqseuru
decuqseuur decuqseuur decuqseuru decuqusrue decuqusreu decuqusure decuqusuer decuquseur decuquseru decuqursue decuqurseu
decuquruse decuqurues decuqureus decuquresu decuquurse decuquures decuquusre decuquuser decuquuesr decuquuers decuquerus
decuquersu decuqueurs decuqueusr decuquesur decuquesru decuqrusue decuqruseu decuqruuse decuqruues decuqrueus decuqruesu
decuqrsuue decuqrsueu decuqrsuue decuqrsueu decuqrseuu decuqrseuu decuqrusue decuqruseu decuqruuse decuqruues decuqrueus
decuqruesu decuqresuu decuqresuu decuqreusu decuqreuus decuqreuus decuqreusu decuquurse decuquures decuquusre decuquuser
decuquuesr decuquuers decuquruse decuqurues decuqursue decuqurseu decuquresu decuqureus decuqusrue decuqusreu decuqusure
decuqusuer decuquseur decuquseru decuquersu decuquerus decuquesru decuquesur decuqueusr decuqueurs decuqeurus decuqeursu
decuqeuurs decuqeuusr decuqeusur decuqeusru decuqeruus decuqerusu decuqeruus decuqerusu decuqersuu decuqersuu decuqeurus
decuqeursu decuqeuurs decuqeuusr decuqeusur decuqeusru decuqesruu decuqesruu decuqesuru decuqesuur decuqesuur decuqesuru
decuusuqre decuusuqer decuusurqe decuusureq decuusuerq decuusueqr decuusqure decuusquer decuusqrue decuusqreu decuusqeru
decuusqeur decuusrque decuusrqeu decuusruqe decuusrueq decuusreuq decuusrequ decuuseqru decuusequr decuuserqu decuuseruq
decuuseurq decuuseuqr decuuusqre decuuusqer decuuusrqe decuuusreq decuuuserq decuuuseqr decuuuqsre decuuuqser decuuuqrse
decuuuqres decuuuqers decuuuqesr decuuurqse decuuurqes decuuursqe decuuurseq decuuuresq decuuureqs decuuueqrs decuuueqsr
decuuuerqs decuuuersq decuuuesrq decuuuesqr decuuqusre decuuquser decuuqurse decuuqures decuuquers decuuquesr decuuqsure
decuuqsuer decuuqsrue decuuqsreu decuuqseru decuuqseur decuuqrsue decuuqrseu decuuqruse decuuqrues decuuqreus decuuqresu
decuuqesru decuuqesur decuuqersu decuuqerus decuuqeurs decuuqeusr decuuruqse decuuruqes decuurusqe decuuruseq decuuruesq
decuurueqs decuurquse decuurques decuurqsue decuurqseu decuurqesu decuurqeus decuursque decuursqeu decuursuqe decuursueq
decuurseuq decuursequ decuureqsu decuurequs decuuresqu decuuresuq decuureusq decuureuqs decuueuqrs decuueuqsr decuueurqs
decuueursq decuueusrq decuueusqr decuuequrs decuuequsr decuueqrus decuueqrsu decuueqsru decuueqsur decuuerqus decuuerqsu
decuueruqs decuuerusq decuuersuq decuuersqu decuuesqru decuuesqur decuuesrqu decuuesruq decuuesurq decuuesuqr decuesuqur
decuesuqru decuesuuqr decuesuurq decuesuruq decuesurqu decuesquur decuesquru decuesquur decuesquru decuesqruu decuesqruu
decuesuqur decuesuqru decuesuuqr decuesuurq decuesuruq decuesurqu decuesrquu decuesrquu decuesruqu decuesruuq decuesruuq
decuesruqu decueusqur decueusqru decueusuqr decueusurq decueusruq decueusrqu decueuqsur decueuqsru decueuqusr decueuqurs
decueuqrus decueuqrsu decueuuqsr decueuuqrs decueuusqr decueuusrq decueuursq decueuurqs decueurqus decueurqsu decueuruqs
decueurusq decueursuq decueursqu decuequsur decuequsru decuequusr decuequurs decuequrus decueqursu decueqsuur decueqsuru
decueqsuur decueqsuru decueqsruu decueqsruu decuequsur decuequsru decuequusr decuequurs decuequrus decueqursu decueqrsuu
decueqrsuu decueqrusu decueqruus decueqruus decueqrusu decueuuqsr decueuuqrs decueuusqr decueuusrq decueuursq decueuurqs
decueuqusr decueuqurs decueuqsur decueuqsru decueuqrsu decueuqrus decueusqur decueusqru decueusuqr decueusurq decueusruq
decueusrqu decueurqsu decueurqus decueursqu decueursuq decueurusq decueuruqs decueruqus decueruqsu decueruuqs decueruusq
decuerusuq decuerusqu decuerquus decuerqusu decuerquus decuerqusu decuerqsuu decuerqsuu decueruqus decueruqsu decueruuqs
decueruusq decuerusuq decuerusqu decuersquu decuersquu decuersuqu decuersuuq decuersuuq decuersuqu decqrsuuue decqrsuueu
decqrsuuue decqrsuueu decqrsueuu decqrsueuu decqrsuuue decqrsuueu decqrsuuue decqrsuueu decqrsueuu decqrsueuu decqrsuuue
decqrsuueu decqrsuuue decqrsuueu decqrsueuu decqrsueuu decqrseuuu decqrseuuu decqrseuuu decqrseuuu decqrseuuu decqrseuuu
decqrusuue decqrusueu decqrusuue decqrusueu decqruseuu decqruseuu decqruusue decqruuseu decqruuuse decqruuues decqruueus
decqruuesu decqruuuse decqruuues decqruusue decqruuseu decqruuesu decqruueus decqrueuus decqrueusu decqrueuus decqrueusu
decqruesuu decqruesuu decqruusue decqruuseu decqruuuse decqruuues decqruueus decqruuesu decqrusuue decqrusueu decqrusuue
decqrusueu decqruseuu decqruseuu decqruusue decqruuseu decqruuuse decqruuues decqruueus decqruuesu decqruesuu decqruesuu
decqrueusu decqrueuus decqrueuus decqrueusu decqruuuse decqruuues decqruusue decqruuseu decqruuesu decqruueus decqruuuse
decqruuues decqruusue decqruuseu decqruuesu decqruueus decqrusuue decqrusueu decqrusuue decqrusueu decqruseuu decqruseuu
decqrueusu decqrueuus decqruesuu decqruesuu decqrueusu decqrueuus decqreuuus decqreuusu decqreuuus decqreuusu decqreusuu
decqreusuu decqreuuus decqreuusu decqreuuus decqreuusu decqreusuu decqreusuu decqreuuus decqreuusu decqreuuus decqreuusu
decqreusuu decqreusuu decqresuuu decqresuuu decqresuuu decqresuuu decqresuuu decqresuuu decqsruuue decqsruueu decqsruuue
decqsruueu decqsrueuu decqsrueuu decqsruuue decqsruueu decqsruuue decqsruueu decqsrueuu decqsrueuu decqsruuue decqsruueu
decqsruuue decqsruueu decqsrueuu decqsrueuu decqsreuuu decqsreuuu decqsreuuu decqsreuuu decqsreuuu decqsreuuu decqsuruue
decqsurueu decqsuruue decqsurueu decqsureuu decqsureuu decqsuurue decqsuureu decqsuuure decqsuuuer decqsuueur decqsuueru
decqsuuure decqsuuuer decqsuurue decqsuureu decqsuueru decqsuueur decqsueuur decqsueuru decqsueuur decqsueuru decqsueruu
decqsueruu decqsuurue decqsuureu decqsuuure decqsuuuer decqsuueur decqsuueru decqsuruue decqsurueu decqsuruue decqsurueu
decqsureuu decqsureuu decqsuurue decqsuureu decqsuuure decqsuuuer decqsuueur decqsuueru decqsueruu decqsueruu decqsueuru
decqsueuur decqsueuur decqsueuru decqsuuure decqsuuuer decqsuurue decqsuureu decqsuueru decqsuueur decqsuuure decqsuuuer
decqsuurue decqsuureu decqsuueru decqsuueur decqsuruue decqsurueu decqsuruue decqsurueu decqsureuu decqsureuu decqsueuru
decqsueuur decqsueruu decqsueruu decqsueuru decqsueuur decqseuuur decqseuuru decqseuuur decqseuuru decqseuruu decqseuruu
decqseuuur decqseuuru decqseuuur decqseuuru decqseuruu decqseuruu decqseuuur decqseuuru decqseuuur decqseuuru decqseuruu
decqseuruu decqseruuu decqseruuu decqseruuu decqseruuu decqseruuu decqseruuu decqusruue decqusrueu decqusruue decqusrueu
decqusreuu decqusreuu decqusurue decqusureu decqusuure decqusuuer decqusueur decqusueru decqusuure decqusuuer decqusurue
decqusureu decqusueru decqusueur decquseuur decquseuru decquseuur decquseuru decquseruu decquseruu decqursuue decqursueu
decqursuue decqursueu decqurseuu decqurseuu decqurusue decquruseu decquruuse decquruues decqurueus decquruesu decquruuse
decquruues decqurusue decquruseu decquruesu decqurueus decqureuus decqureusu decqureuus decqureusu decquresuu decquresuu
decquursue decquurseu decquuruse decquurues decquureus decquuresu decquusrue decquusreu decquusure decquusuer decquuseur
decquuseru decquuusre decquuuser decquuurse decquuures decquuuers decquuuesr decquuesur decquuesru decquueusr decquueurs
decquuerus decquuersu decquuruse decquurues decquursue decquurseu decquuresu decquureus decquuurse decquuures decquuusre
decquuuser decquuuesr decquuuers decquusure decquusuer decquusrue decquusreu decquuseru decquuseur decquueusr decquueurs
decquuesur decquuesru decquuersu decquuerus decqueruus decquerusu decqueruus decquerusu decquersuu decquersuu decqueurus
decqueursu decqueuurs decqueuusr decqueusur decqueusru decqueuurs decqueuusr decqueurus decqueursu decqueusru decqueusur
decquesuur decquesuru decquesuur decquesuru decquesruu decquesruu decqusurue decqusureu decqusuure decqusuuer decqusueur
decqusueru decqusruue decqusrueu decqusruue decqusrueu decqusreuu decqusreuu decqusurue decqusureu decqusuure decqusuuer
decqusueur decqusueru decquseruu decquseruu decquseuru decquseuur decquseuur decquseuru decquusrue decquusreu decquusure
decquusuer decquuseur decquuseru decquursue decquurseu decquuruse decquurues decquureus decquuresu decquuurse decquuures
decquuusre decquuuser decquuuesr decquuuers decquuerus decquuersu decquueurs decquueusr decquuesur decquuesru decqurusue
decquruseu decquruuse decquruues decqurueus decquruesu decqursuue decqursueu decqursuue decqursueu decqurseuu decqurseuu
decqurusue decquruseu decquruuse decquruues decqurueus decquruesu decquresuu decquresuu decqureusu decqureuus decqureuus
decqureusu decquuurse decquuures decquuusre decquuuser decquuuesr decquuuers decquuruse decquurues decquursue decquurseu
decquuresu decquureus decquusrue decquusreu decquusure decquusuer decquuseur decquuseru decquuersu decquuerus decquuesru
decquuesur decquueusr decquueurs decqueurus decqueursu decqueuurs decqueuusr decqueusur decqueusru decqueruus decquerusu
decqueruus decquerusu decquersuu decquersuu decqueurus decqueursu decqueuurs decqueuusr decqueusur decqueusru decquesruu
decquesruu decquesuru decquesuur decquesuur decquesuru decqusuure decqusuuer decqusurue decqusureu decqusueru decqusueur
decqusuure decqusuuer decqusurue decqusureu decqusueru decqusueur decqusruue decqusrueu decqusruue decqusrueu decqusreuu
decqusreuu decquseuru decquseuur decquseruu decquseruu decquseuru decquseuur decquusure decquusuer decquusrue decquusreu
decquuseru decquuseur decquuusre decquuuser decquuurse decquuures decquuuers decquuuesr decquuruse decquurues decquursue
decquurseu decquuresu decquureus decquueurs decquueusr decquuerus decquuersu decquuesru decquuesur decquuusre decquuuser
decquuurse decquuures decquuuers decquuuesr decquusure decquusuer decquusrue decquusreu decquuseru decquuseur decquursue
decquurseu decquuruse decquurues decquureus decquuresu decquuesru decquuesur decquuersu decquuerus decquueurs decquueusr
decquruuse decquruues decqurusue decquruseu decquruesu decqurueus decquruuse decquruues decqurusue decquruseu decquruesu
decqurueus decqursuue decqursueu decqursuue decqursueu decqurseuu decqurseuu decqureusu decqureuus decquresuu decquresuu
decqureusu decqureuus decqueuurs decqueuusr decqueurus decqueursu decqueusru decqueusur decqueuurs decqueuusr decqueurus
decqueursu decqueusru decqueusur decqueruus decquerusu decqueruus decquerusu decquersuu decquersuu decquesuru decquesuur
decquesruu decquesruu decquesuru decquesuur decqesuuur decqesuuru decqesuuur decqesuuru decqesuruu decqesuruu decqesuuur
decqesuuru decqesuuur decqesuuru decqesuruu decqesuruu decqesuuur decqesuuru decqesuuur decqesuuru decqesuruu decqesuruu
decqesruuu decqesruuu decqesruuu decqesruuu decqesruuu decqesruuu decqeusuur decqeusuru decqeusuur decqeusuru decqeusruu
decqeusruu decqeuusur decqeuusru decqeuuusr decqeuuurs decqeuurus decqeuursu decqeuuusr decqeuuurs decqeuusur decqeuusru
decqeuursu decqeuurus decqeuruus decqeurusu decqeuruus decqeurusu decqeursuu decqeursuu decqeuusur decqeuusru decqeuuusr
decqeuuurs decqeuurus decqeuursu decqeusuur decqeusuru decqeusuur decqeusuru decqeusruu decqeusruu decqeuusur decqeuusru
decqeuuusr decqeuuurs decqeuurus decqeuursu decqeursuu decqeursuu decqeurusu decqeuruus decqeuruus decqeurusu decqeuuusr
decqeuuurs decqeuusur decqeuusru decqeuursu decqeuurus decqeuuusr decqeuuurs decqeuusur decqeuusru decqeuursu decqeuurus
decqeusuur decqeusuru decqeusuur decqeusuru decqeusruu decqeusruu decqeurusu decqeuruus decqeursuu decqeursuu decqeurusu
decqeuruus decqeruuus decqeruusu decqeruuus decqeruusu decqerusuu decqerusuu decqeruuus decqeruusu decqeruuus decqeruusu
decqerusuu decqerusuu decqeruuus decqeruusu decqeruuus decqeruusu decqerusuu decqerusuu decqersuuu decqersuuu decqersuuu
decqersuuu decqersuuu decqersuuu decursuque decursuqeu decursuuqe decursuueq decursueuq decursuequ decursquue decursqueu
decursquue decursqueu decursqeuu decursqeuu decursuque decursuqeu decursuuqe decursuueq decursueuq decursuequ decursequu
decursequu decurseuqu decurseuuq decurseuuq decurseuqu decurusque decurusqeu decurusuqe decurusueq decuruseuq decurusequ
decuruqsue decuruqseu decuruquse decuruques decuruqeus decuruqesu decuruuqse decuruuqes decuruusqe decuruuseq decuruuesq
decuruueqs decuruequs decurueqsu decurueuqs decurueusq decuruesuq decuruesqu decurqusue decurquseu decurquuse decurquues
decurqueus decurquesu decurqsuue decurqsueu decurqsuue decurqsueu decurqseuu decurqseuu decurqusue decurquseu decurquuse
decurquues decurqueus decurquesu decurqesuu decurqesuu decurqeusu decurqeuus decurqeuus decurqeusu decuruuqse decuruuqes
decuruusqe decuruuseq decuruuesq decuruueqs decuruquse decuruques decuruqsue decuruqseu decuruqesu decuruqeus decurusque
decurusqeu decurusuqe decurusueq decuruseuq decurusequ decurueqsu decuruequs decuruesqu decuruesuq decurueusq decurueuqs
decureuqus decureuqsu decureuuqs decureuusq decureusuq decureusqu decurequus decurequsu decurequus decurequsu decureqsuu
decureqsuu decureuqus decureuqsu decureuuqs decureuusq decureusuq decureusqu decuresquu decuresquu decuresuqu decuresuuq
decuresuuq decuresuqu decusruque decusruqeu decusruuqe decusruueq decusrueuq decusruequ decusrquue decusrqueu decusrquue
decusrqueu decusrqeuu decusrqeuu decusruque decusruqeu decusruuqe decusruueq decusrueuq decusruequ decusrequu decusrequu
decusreuqu decusreuuq decusreuuq decusreuqu decusurque decusurqeu decusuruqe decusurueq decusureuq decusurequ decusuqrue
decusuqreu decusuqure decusuquer decusuqeur decusuqeru decusuuqre decusuuqer decusuurqe decusuureq decusuuerq decusuueqr
decusuequr decusueqru decusueuqr decusueurq decusueruq decusuerqu decusqurue decusqureu decusquure decusquuer decusqueur
decusqueru decusqruue decusqrueu decusqruue decusqrueu decusqreuu decusqreuu decusqurue decusqureu decusquure decusquuer
decusqueur decusqueru decusqeruu decusqeruu decusqeuru decusqeuur decusqeuur decusqeuru decusuuqre decusuuqer decusuurqe
decusuureq decusuuerq decusuueqr decusuqure decusuquer decusuqrue decusuqreu decusuqeru decusuqeur decusurque decusurqeu
decusuruqe decusurueq decusureuq decusurequ decusueqru decusuequr decusuerqu decusueruq decusueurq decusueuqr decuseuqur
decuseuqru decuseuuqr decuseuurq decuseuruq decuseurqu decusequur decusequru decusequur decusequru decuseqruu decuseqruu
decuseuqur decuseuqru decuseuuqr decuseuurq decuseuruq decuseurqu decuserquu decuserquu decuseruqu decuseruuq decuseruuq
decuseruqu decuusrque decuusrqeu decuusruqe decuusrueq decuusreuq decuusrequ decuusqrue decuusqreu decuusqure decuusquer
decuusqeur decuusqeru decuusuqre decuusuqer decuusurqe decuusureq decuusuerq decuusueqr decuusequr decuuseqru decuuseuqr
decuuseurq decuuseruq decuuserqu decuursque decuursqeu decuursuqe decuursueq decuurseuq decuursequ decuurqsue decuurqseu
decuurquse decuurques decuurqeus decuurqesu decuuruqse decuuruqes decuurusqe decuuruseq decuuruesq decuurueqs decuurequs
decuureqsu decuureuqs decuureusq decuuresuq decuuresqu decuuqrsue decuuqrseu decuuqruse decuuqrues decuuqreus decuuqresu
decuuqsrue decuuqsreu decuuqsure decuuqsuer decuuqseur decuuqseru decuuqusre decuuquser decuuqurse decuuqures decuuquers
decuuquesr decuuqesur decuuqesru decuuqeusr decuuqeurs decuuqerus decuuqersu decuuurqse decuuurqes decuuursqe decuuurseq
decuuuresq decuuureqs decuuuqrse decuuuqres decuuuqsre decuuuqser decuuuqesr decuuuqers decuuusqre decuuusqer decuuusrqe
decuuusreq decuuuserq decuuuseqr decuuueqsr decuuueqrs decuuuesqr decuuuesrq decuuuersq decuuuerqs decuuerqus decuuerqsu
decuueruqs decuuerusq decuuersuq decuuersqu decuueqrus decuueqrsu decuuequrs decuuequsr decuueqsur decuueqsru decuueuqrs
decuueuqsr decuueurqs decuueursq decuueusrq decuueusqr decuuesqur decuuesqru decuuesuqr decuuesurq decuuesruq decuuesrqu
decuqsurue decuqsureu decuqsuure decuqsuuer decuqsueur decuqsueru decuqsruue decuqsrueu decuqsruue decuqsrueu decuqsreuu
decuqsreuu decuqsurue decuqsureu decuqsuure decuqsuuer decuqsueur decuqsueru decuqseruu decuqseruu decuqseuru decuqseuur
decuqseuur decuqseuru decuqusrue decuqusreu decuqusure decuqusuer decuquseur decuquseru decuqursue decuqurseu decuquruse
decuqurues decuqureus decuquresu decuquurse decuquures decuquusre decuquuser decuquuesr decuquuers decuquerus decuquersu
decuqueurs decuqueusr decuquesur decuquesru decuqrusue decuqruseu decuqruuse decuqruues decuqrueus decuqruesu decuqrsuue
decuqrsueu decuqrsuue decuqrsueu decuqrseuu decuqrseuu decuqrusue decuqruseu decuqruuse decuqruues decuqrueus decuqruesu
decuqresuu decuqresuu decuqreusu decuqreuus decuqreuus decuqreusu decuquurse decuquures decuquusre decuquuser decuquuesr
decuquuers decuquruse decuqurues decuqursue decuqurseu decuquresu decuqureus decuqusrue decuqusreu decuqusure decuqusuer
decuquseur decuquseru decuquersu decuquerus decuquesru decuquesur decuqueusr decuqueurs decuqeurus decuqeursu decuqeuurs
decuqeuusr decuqeusur decuqeusru decuqeruus decuqerusu decuqeruus decuqerusu decuqersuu decuqersuu decuqeurus decuqeursu
decuqeuurs decuqeuusr decuqeusur decuqeusru decuqesruu decuqesruu decuqesuru decuqesuur decuqesuur decuqesuru decuusuqre
decuusuqer decuusurqe decuusureq decuusuerq decuusueqr decuusqure decuusquer decuusqrue decuusqreu decuusqeru decuusqeur
decuusrque decuusrqeu decuusruqe decuusrueq decuusreuq decuusrequ decuuseqru decuusequr decuuserqu decuuseruq decuuseurq
decuuseuqr decuuusqre decuuusqer decuuusrqe decuuusreq decuuuserq decuuuseqr decuuuqsre decuuuqser decuuuqrse decuuuqres
decuuuqers decuuuqesr decuuurqse decuuurqes decuuursqe decuuurseq decuuuresq decuuureqs decuuueqrs decuuueqsr decuuuerqs
decuuuersq decuuuesrq decuuuesqr decuuqusre decuuquser decuuqurse decuuqures decuuquers decuuquesr decuuqsure decuuqsuer
decuuqsrue decuuqsreu decuuqseru decuuqseur decuuqrsue decuuqrseu decuuqruse decuuqrues decuuqreus decuuqresu decuuqesru
decuuqesur decuuqersu decuuqerus decuuqeurs decuuqeusr decuuruqse decuuruqes decuurusqe decuuruseq decuuruesq decuurueqs
decuurquse decuurques decuurqsue decuurqseu decuurqesu decuurqeus decuursque decuursqeu decuursuqe decuursueq decuurseuq
decuursequ decuureqsu decuurequs decuuresqu decuuresuq decuureusq decuureuqs decuueuqrs decuueuqsr decuueurqs decuueursq
decuueusrq decuueusqr decuuequrs decuuequsr decuueqrus decuueqrsu decuueqsru decuueqsur decuuerqus decuuerqsu decuueruqs
decuuerusq decuuersuq decuuersqu decuuesqru decuuesqur decuuesrqu decuuesruq decuuesurq decuuesuqr decuesuqur decuesuqru
decuesuuqr decuesuurq decuesuruq decuesurqu decuesquur decuesquru decuesquur decuesquru decuesqruu decuesqruu decuesuqur
decuesuqru decuesuuqr decuesuurq decuesuruq decuesurqu decuesrquu decuesrquu decuesruqu decuesruuq decuesruuq decuesruqu
decueusqur decueusqru decueusuqr decueusurq decueusruq decueusrqu decueuqsur decueuqsru decueuqusr decueuqurs decueuqrus
decueuqrsu decueuuqsr decueuuqrs decueuusqr decueuusrq decueuursq decueuurqs decueurqus decueurqsu decueuruqs decueurusq
decueursuq decueursqu decuequsur decuequsru decuequusr decuequurs decuequrus decueqursu decueqsuur decueqsuru decueqsuur
decueqsuru decueqsruu decueqsruu decuequsur decuequsru decuequusr decuequurs decuequrus decueqursu decueqrsuu decueqrsuu
decueqrusu decueqruus decueqruus decueqrusu decueuuqsr decueuuqrs decueuusqr decueuusrq decueuursq decueuurqs decueuqusr
decueuqurs decueuqsur decueuqsru decueuqrsu decueuqrus decueusqur decueusqru decueusuqr decueusurq decueusruq decueusrqu
decueurqsu decueurqus decueursqu decueursuq decueurusq decueuruqs decueruqus decueruqsu decueruuqs decueruusq decuerusuq
decuerusqu decuerquus decuerqusu decuerquus decuerqusu decuerqsuu decuerqsuu decueruqus decueruqsu decueruuqs decueruusq
decuerusuq decuerusqu decuersquu decuersquu decuersuqu decuersuuq decuersuuq decuersuqu decersuquu decersuquu decersuuqu
decersuuuq decersuuuq decersuuqu decersquuu decersquuu decersquuu decersquuu decersquuu decersquuu decersuquu decersuquu
decersuuqu decersuuuq decersuuuq decersuuqu decersuquu decersuquu decersuuqu decersuuuq decersuuuq decersuuqu decerusquu
decerusquu decerusuqu decerusuuq decerusuuq decerusuqu deceruqsuu deceruqsuu deceruqusu deceruquus deceruquus deceruqusu
deceruuqsu deceruuqus deceruusqu deceruusuq deceruuusq deceruuuqs deceruuqus deceruuqsu deceruuuqs deceruuusq deceruusuq
deceruusqu decerqusuu decerqusuu decerquusu decerquuus decerquuus decerquusu decerqsuuu decerqsuuu decerqsuuu decerqsuuu
decerqsuuu decerqsuuu decerqusuu decerqusuu decerquusu decerquuus decerquuus decerquusu decerqusuu decerqusuu decerquusu
decerquuus decerquuus decerquusu deceruuqsu deceruuqus deceruusqu deceruusuq deceruuusq deceruuuqs deceruqusu deceruquus
deceruqsuu deceruqsuu deceruqusu deceruquus decerusquu decerusquu decerusuqu decerusuuq decerusuuq decerusuqu deceruuqsu
deceruuqus deceruusqu deceruusuq deceruuusq deceruuuqs deceruuqus deceruuqsu deceruuuqs deceruuusq deceruusuq deceruusqu
deceruquus deceruqusu deceruquus deceruqusu deceruqsuu deceruqsuu deceruuqus deceruuqsu deceruuuqs deceruuusq deceruusuq
deceruusqu decerusquu decerusquu decerusuqu decerusuuq decerusuuq decerusuqu decesruquu decesruquu decesruuqu decesruuuq
decesruuuq decesruuqu decesrquuu decesrquuu decesrquuu decesrquuu decesrquuu decesrquuu decesruquu decesruquu decesruuqu
decesruuuq decesruuuq decesruuqu decesruquu decesruquu decesruuqu decesruuuq decesruuuq decesruuqu decesurquu decesurquu
decesuruqu decesuruuq decesuruuq decesuruqu decesuqruu decesuqruu decesuquru decesuquur decesuquur decesuquru decesuuqru
decesuuqur decesuurqu decesuuruq decesuuurq decesuuuqr decesuuqur decesuuqru decesuuuqr decesuuurq decesuuruq decesuurqu
decesquruu decesquruu decesquuru decesquuur decesquuur decesquuru decesqruuu decesqruuu decesqruuu decesqruuu decesqruuu
decesqruuu decesquruu decesquruu decesquuru decesquuur decesquuur decesquuru decesquruu decesquruu decesquuru decesquuur
decesquuur decesquuru decesuuqru decesuuqur decesuurqu decesuuruq decesuuurq decesuuuqr decesuquru decesuquur decesuqruu
decesuqruu decesuquru decesuquur decesurquu decesurquu decesuruqu decesuruuq decesuruuq decesuruqu decesuuqru decesuuqur
decesuurqu decesuuruq decesuuurq decesuuuqr decesuuqur decesuuqru decesuuuqr decesuuurq decesuuruq decesuurqu decesuquur
decesuquru decesuquur decesuquru decesuqruu decesuqruu decesuuqur decesuuqru decesuuuqr decesuuurq decesuuruq decesuurqu
decesurquu decesurquu decesuruqu decesuruuq decesuruuq decesuruqu deceusrquu deceusrquu deceusruqu deceusruuq deceusruuq
deceusruqu deceusqruu deceusqruu deceusquru deceusquur deceusquur deceusquru deceusuqru deceusuqur deceusurqu deceusuruq
deceusuurq deceusuuqr deceusuqur deceusuqru deceusuuqr deceusuurq deceusuruq deceusurqu deceursquu deceursquu deceursuqu
deceursuuq deceursuuq deceursuqu deceurqsuu deceurqsuu deceurqusu deceurquus deceurquus deceurqusu deceuruqsu deceuruqus
deceurusqu deceurusuq deceuruusq deceuruuqs deceuruqus deceuruqsu deceuruuqs deceuruusq deceurusuq deceurusqu deceuqrsuu
deceuqrsuu deceuqrusu deceuqruus deceuqruus deceuqrusu deceuqsruu deceuqsruu deceuqsuru deceuqsuur deceuqsuur deceuqsuru
deceuqusru deceuqusur deceuqursu deceuqurus deceuquurs deceuquusr deceuqusur deceuqusru deceuquusr deceuquurs deceuqurus
deceuqursu deceuurqsu deceuurqus deceuursqu deceuursuq deceuurusq deceuuruqs deceuuqrsu deceuuqrus deceuuqsru deceuuqsur
deceuuqusr deceuuqurs deceuusqru deceuusqur deceuusrqu deceuusruq deceuusurq deceuusuqr deceuuuqsr deceuuuqrs deceuuusqr
deceuuusrq deceuuursq deceuuurqs deceuurqus deceuurqsu deceuuruqs deceuurusq deceuursuq deceuursqu deceuuqrus deceuuqrsu
deceuuqurs deceuuqusr deceuuqsur deceuuqsru deceuuuqrs deceuuuqsr deceuuurqs deceuuursq deceuuusrq deceuuusqr deceuusqur
deceuusqru deceuusuqr deceuusurq deceuusruq deceuusrqu deceqsuruu deceqsuruu deceqsuuru deceqsuuur deceqsuuur deceqsuuru
deceqsruuu deceqsruuu deceqsruuu deceqsruuu deceqsruuu deceqsruuu deceqsuruu deceqsuruu deceqsuuru deceqsuuur deceqsuuur
deceqsuuru deceqsuruu deceqsuruu deceqsuuru deceqsuuur deceqsuuur deceqsuuru decequsruu decequsruu decequsuru decequsuur
decequsuur decequsuru deceqursuu deceqursuu decequrusu decequruus decequruus decequrusu decequursu decequurus decequusru
decequusur decequuusr decequuurs decequurus decequursu decequuurs decequuusr decequusur decequusru deceqrusuu deceqrusuu
deceqruusu deceqruuus deceqruuus deceqruusu deceqrsuuu deceqrsuuu deceqrsuuu deceqrsuuu deceqrsuuu deceqrsuuu deceqrusuu
deceqrusuu deceqruusu deceqruuus deceqruuus deceqruusu deceqrusuu deceqrusuu deceqruusu deceqruuus deceqruuus deceqruusu
decequursu decequurus decequusru decequusur decequuusr decequuurs decequrusu decequruus deceqursuu deceqursuu decequrusu
decequruus decequsruu decequsruu decequsuru decequsuur decequsuur decequsuru decequursu decequurus decequusru decequusur
decequuusr decequuurs decequurus decequursu decequuurs decequuusr decequusur decequusru decequruus decequrusu decequruus
decequrusu deceqursuu deceqursuu decequurus decequursu decequuurs decequuusr decequusur decequusru decequsruu decequsruu
decequsuru decequsuur decequsuur decequsuru deceusuqru deceusuqur deceusurqu deceusuruq deceusuurq deceusuuqr deceusquru
deceusquur deceusqruu deceusqruu deceusquru deceusquur deceusrquu deceusrquu deceusruqu deceusruuq deceusruuq deceusruqu
deceusuqru deceusuqur deceusurqu deceusuruq deceusuurq deceusuuqr deceuusqru deceuusqur deceuusrqu deceuusruq deceuusurq
deceuusuqr deceuuqsru deceuuqsur deceuuqrsu deceuuqrus deceuuqurs deceuuqusr deceuurqsu deceuurqus deceuursqu deceuursuq
deceuurusq deceuuruqs deceuuuqrs deceuuuqsr deceuuurqs deceuuursq deceuuusrq deceuuusqr deceuqusru deceuqusur deceuqursu
deceuqurus deceuquurs deceuquusr deceuqsuru deceuqsuur deceuqsruu deceuqsruu deceuqsuru deceuqsuur deceuqrsuu deceuqrsuu
deceuqrusu deceuqruus deceuqruus deceuqrusu deceuqusru deceuqusur deceuqursu deceuqurus deceuquurs deceuquusr deceuruqsu
deceuruqus deceurusqu deceurusuq deceuruusq deceuruuqs deceurqusu deceurquus deceurqsuu deceurqsuu deceurqusu deceurquus
deceursquu deceursquu deceursuqu deceursuuq deceursuuq deceursuqu deceuruqsu deceuruqus deceurusqu deceurusuq deceuruusq
deceuruuqs deceuuuqrs deceuuuqsr deceuuurqs deceuuursq deceuuusrq deceuuusqr deceuuqurs deceuuqusr deceuuqrus deceuuqrsu
deceuuqsru deceuuqsur deceuurqus deceuurqsu deceuuruqs deceuurusq deceuursuq deceuursqu deceuusqru deceuusqur deceuusrqu
deceuusruq deceuusurq deceuusuqr deceusuqur deceusuqru deceusuuqr deceusuurq deceusuruq deceusurqu deceusquur deceusquru
deceusquur deceusquru deceusqruu deceusqruu deceusuqur deceusuqru deceusuuqr deceusuurq deceusuruq deceusurqu deceusrquu
deceusrquu deceusruqu deceusruuq deceusruuq deceusruqu deceuusqur deceuusqru deceuusuqr deceuusurq deceuusruq deceuusrqu
deceuuqsur deceuuqsru deceuuqusr deceuuqurs deceuuqrus deceuuqrsu deceuuuqsr deceuuuqrs deceuuusqr deceuuusrq deceuuursq
deceuuurqs deceuurqus deceuurqsu deceuuruqs deceuurusq deceuursuq deceuursqu deceuqusur deceuqusru deceuquusr deceuquurs
deceuqurus deceuqursu deceuqsuur deceuqsuru deceuqsuur deceuqsuru deceuqsruu deceuqsruu deceuqusur deceuqusru deceuquusr
deceuquurs deceuqurus deceuqursu deceuqrsuu deceuqrsuu deceuqrusu deceuqruus deceuqruus deceuqrusu deceuuuqsr deceuuuqrs
deceuuusqr deceuuusrq deceuuursq deceuuurqs deceuuqusr deceuuqurs deceuuqsur deceuuqsru deceuuqrsu deceuuqrus deceuusqur
deceuusqru deceuusuqr deceuusurq deceuusruq deceuusrqu deceuurqsu deceuurqus deceuursqu deceuursuq deceuurusq deceuuruqs
deceuruqus deceuruqsu deceuruuqs deceuruusq deceurusuq deceurusqu deceurquus deceurqusu deceurquus deceurqusu deceurqsuu
deceurqsuu deceuruqus deceuruqsu deceuruuqs deceuruusq deceurusuq deceurusqu deceursquu deceursquu deceursuqu deceursuuq
deceursuuq deceursuqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us