easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

pulsantque

juvenescent

unact

mosfet

jalal

menschenfrauen

athyreosis

acutated

heureuses

chelub

abdideram

christadelphianism

unthistle

etherifying

accingiebatisque

laundromat

auersosque

offscour


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: daggett
cipher variations:
ebhhfuu fciigvv gdjjhww hekkixx iflljyy
jgmmkzz khnnlaa lioombb mjppncc nkqqodd
olrrpee pmssqff qnttrgg rouushh spvvtii
tqwwujj urxxvkk vsyywll wtzzxmm xuaaynn
yvbbzoo zwccapp axddbqq byeecrr czffdss

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: daggett
Cipher: wzttvgg

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: daggett
Cipher: AAABB AAAAA AABBA AABBA AABAA BAABA BAABA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: daggett
cipher variations:
ebhhfuukbttnggqbffvsswbrrdeecbddlqqibpptccubnnjaaabzzrmm
gbllzyymbxxhkksbjjpwwybvvxiifciigvvlcuuohhrcggwttxcsseff
dceemrrjcqquddvcookbbbcaasnnhcmmazzncyyilltckkqxxzcwwyjj
gdjjhwwmdvvpiisdhhxuuydttfggedffnsskdrrveewdpplcccdbbtoo
idnnbaaodzzjmmudllryyadxxzkkhekkixxnewwqjjteiiyvvzeuughh
feggottlesswffxeqqmdddeccuppjeoocbbpeaaknnvemmszzbeyyall
iflljyyofxxrkkufjjzwwafvvhiigfhhpuumfttxggyfrrneeefddvqq
kfppdccqfbbloowfnntaacfzzbmmjgmmkzzpgyysllvgkkaxxbgwwijj
hgiiqvvnguuyhhzgssofffgeewrrlgqqeddrgccmppxgooubbdgaacnn
khnnlaaqhzztmmwhllbyychxxjkkihjjrwwohvvziiahttpggghffxss
mhrrfeeshddnqqyhppvccehbbdoolioombbriaaunnximmczzdiyykll
jikksxxpiwwajjbiuuqhhhiggyttnissgfftieeorrziqqwddficcepp
mjppnccsjbbvooyjnndaaejzzlmmkjlltyyqjxxbkkcjvvriiijhhzuu
ojtthggujffpssajrrxeegjddfqqnkqqoddtkccwppzkooebbfkaamnn
lkmmuzzrkyyclldkwwsjjjkiiavvpkuuihhvkggqttbkssyffhkeegrr
olrrpeeulddxqqalppfccglbbnoomlnnvaaslzzdmmelxxtkkkljjbww
qlvvjiiwlhhruuclttzggilffhsspmssqffvmeeyrrbmqqgddhmccopp
nmoowbbtmaaennfmyyulllmkkcxxrmwwkjjxmiisvvdmuuahhjmggitt
qnttrggwnffzsscnrrheeinddpqqonppxccunbbfoognzzvmmmnlldyy
snxxlkkynjjtwwenvvbiiknhhjuurouushhxoggattdossiffjoeeqrr
poqqyddvoccgpphoaawnnnommezztoyymllzokkuxxfowwcjjloiikvv
spvvtiiyphhbuuepttjggkpffrssqprrzeewpddhqqipbbxooopnnfaa
upzznmmapllvyygpxxdkkmpjjlwwtqwwujjzqiicvvfquukhhlqggstt
rqssaffxqeeirrjqccypppqoogbbvqaaonnbqmmwzzhqyyellnqkkmxx
urxxvkkarjjdwwgrvvliimrhhtuusrttbggyrffjsskrddzqqqrpphcc
wrbbpoocrnnxaairzzfmmorllnyyvsyywllbskkexxhswwmjjnsiiuvv
tsuuchhzsggkttlseearrrsqqiddxsccqppdsooybbjsaagnnpsmmozz
wtzzxmmctllfyyitxxnkkotjjvwwutvvdiiathhluumtffbssstrrjee
ytddrqqetppzccktbbhooqtnnpaaxuaaynndummgzzjuyyollpukkwxx
vuwwejjbuiimvvnuggctttusskffzueesrrfuqqaddluccippruooqbb
yvbbzooevnnhaakvzzpmmqvllxyywvxxfkkcvjjnwwovhhduuuvttlgg
avfftssgvrrbeemvddjqqsvpprcczwccappfwooibblwaaqnnrwmmyzz
xwyyglldwkkoxxpwiievvvwuumhhbwggutthwsscffnweekrrtwqqsdd
axddbqqgxppjccmxbbroosxnnzaayxzzhmmexllpyyqxjjfwwwxvvnii
cxhhvuuixttdggoxfflssuxrrteebyeecrrhyqqkddnyccspptyooabb
zyaainnfymmqzzrykkgxxxywwojjdyiiwvvjyuuehhpyggmttvyssuff
czffdssizrrleeozddtqquzppbccazbbjoogznnraaszllhyyyzxxpkk
ezjjxwwkzvvfiiqzhhnuuwzttvggdaggettjassmffpaeeurrvaqqcdd
bacckpphaoosbbtammizzzayyqllfakkyxxlawwgjjraiiovvxauuwhh

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: daggett
Cipher: qnttrgg

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: daggett
Cipher: 41112222514444

Extended Methods:
Method #1

Plaintext: daggett
method variations:
ifmmkyyolrrpddtqwwuiiyvbbzoo

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
d a g g e t t 
4 1 2 2 5 4 4 
1 1 2 2 1 4 4 
They are then read out in rows:
41225441122144
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: daggett
Cipher: dgudfbt

Read more ...
Method #3

Plaintext: daggett
method variations:
afgwqtt fgwqtta gwqttaf
wqttafg qttafgw ttafgwq
tafgwqt

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: daggett

all 5040 cipher variations:
daggett daggett daggtet daggtte daggtte daggtet dagegtt dagegtt dagetgt dagettg dagettg
dagetgt dagtegt dagtetg dagtget dagtgte dagttge dagtteg dagtetg dagtegt dagtteg dagttge
dagtgte dagtget daggett daggett daggtet daggtte daggtte daggtet dagegtt dagegtt dagetgt
dagettg dagettg dagetgt dagtegt dagtetg dagtget dagtgte dagttge dagtteg dagtetg dagtegt
dagtteg dagttge dagtgte dagtget daeggtt daeggtt daegtgt daegttg daegttg daegtgt daeggtt
daeggtt daegtgt daegttg daegttg daegtgt daetggt daetgtg daetggt daetgtg daettgg daettgg
daetgtg daetggt daettgg daettgg daetgtg daetggt datgegt datgetg datgget datggte datgtge
datgteg dateggt dategtg dateggt dategtg datetgg datetgg datgegt datgetg datgget datggte
datgtge datgteg dattegg dattegg dattgeg dattgge dattgge dattgeg datgetg datgegt datgteg
datgtge datggte datgget dategtg dateggt datetgg datetgg dategtg dateggt dattegg dattegg
dattgeg dattgge dattgge dattgeg datgetg datgegt datgteg datgtge datggte datgget dgagett
dgagett dgagtet dgagtte dgagtte dgagtet dgaegtt dgaegtt dgaetgt dgaettg dgaettg dgaetgt
dgategt dgatetg dgatget dgatgte dgattge dgatteg dgatetg dgategt dgatteg dgattge dgatgte
dgatget dggaett dggaett dggatet dggatte dggatte dggatet dggeatt dggeatt dggetat dggetta
dggetta dggetat dggteat dggteta dggtaet dggtate dggttae dggttea dggteta dggteat dggttea
dggttae dggtate dggtaet dgegatt dgegatt dgegtat dgegtta dgegtta dgegtat dgeagtt dgeagtt
dgeatgt dgeattg dgeattg dgeatgt dgetagt dgetatg dgetgat dgetgta dgettga dgettag dgetatg
dgetagt dgettag dgettga dgetgta dgetgat dgtgeat dgtgeta dgtgaet dgtgate dgtgtae dgtgtea
dgtegat dgtegta dgteagt dgteatg dgtetag dgtetga dgtaegt dgtaetg dgtaget dgtagte dgtatge
dgtateg dgtteag dgttega dgttaeg dgttage dgttgae dgttgea dgtgeta dgtgeat dgtgtea dgtgtae
dgtgate dgtgaet dgtegta dgtegat dgtetga dgtetag dgteatg dgteagt dgttega dgtteag dgttgea
dgttgae dgttage dgttaeg dgtaetg dgtaegt dgtateg dgtatge dgtagte dgtaget dggaett dggaett
dggatet dggatte dggatte dggatet dggeatt dggeatt dggetat dggetta dggetta dggetat dggteat
dggteta dggtaet dggtate dggttae dggttea dggteta dggteat dggttea dggttae dggtate dggtaet
dgagett dgagett dgagtet dgagtte dgagtte dgagtet dgaegtt dgaegtt dgaetgt dgaettg dgaettg
dgaetgt dgategt dgatetg dgatget dgatgte dgattge dgatteg dgatetg dgategt dgatteg dgattge
dgatgte dgatget dgeagtt dgeagtt dgeatgt dgeattg dgeattg dgeatgt dgegatt dgegatt dgegtat
dgegtta dgegtta dgegtat dgetgat dgetgta dgetagt dgetatg dgettag dgettga dgetgta dgetgat
dgettga dgettag dgetatg dgetagt dgtaegt dgtaetg dgtaget dgtagte dgtatge dgtateg dgteagt
dgteatg dgtegat dgtegta dgtetga dgtetag dgtgeat dgtgeta dgtgaet dgtgate dgtgtae dgtgtea
dgttega dgtteag dgttgea dgttgae dgttage dgttaeg dgtaetg dgtaegt dgtateg dgtatge dgtagte
dgtaget dgteatg dgteagt dgtetag dgtetga dgtegta dgtegat dgtteag dgttega dgttaeg dgttage
dgttgae dgttgea dgtgeta dgtgeat dgtgtea dgtgtae dgtgate dgtgaet deggatt deggatt deggtat
deggtta deggtta deggtat degagtt degagtt degatgt degattg degattg degatgt degtagt degtatg
degtgat degtgta degttga degttag degtatg degtagt degttag degttga degtgta degtgat deggatt
deggatt deggtat deggtta deggtta deggtat degagtt degagtt degatgt degattg degattg degatgt
degtagt degtatg degtgat degtgta degttga degttag degtatg degtagt degttag degttga degtgta
degtgat deaggtt deaggtt deagtgt deagttg deagttg deagtgt deaggtt deaggtt deagtgt deagttg
deagttg deagtgt deatggt deatgtg deatggt deatgtg deattgg deattgg deatgtg deatggt deattgg
deattgg deatgtg deatggt detgagt detgatg detggat detggta detgtga detgtag detaggt detagtg
detaggt detagtg detatgg detatgg detgagt detgatg detggat detggta detgtga detgtag dettagg
dettagg dettgag dettgga dettgga dettgag detgatg detgagt detgtag detgtga detggta detggat
detagtg detaggt detatgg detatgg detagtg detaggt dettagg dettagg dettgag dettgga dettgga
dettgag detgatg detgagt detgtag detgtga detggta detggat dtggeat dtggeta dtggaet dtggate
dtggtae dtggtea dtgegat dtgegta dtgeagt dtgeatg dtgetag dtgetga dtgaegt dtgaetg dtgaget
dtgagte dtgatge dtgateg dtgteag dtgtega dtgtaeg dtgtage dtgtgae dtgtgea dtggeat dtggeta
dtggaet dtggate dtggtae dtggtea dtgegat dtgegta dtgeagt dtgeatg dtgetag dtgetga dtgaegt
dtgaetg dtgaget dtgagte dtgatge dtgateg dtgteag dtgtega dtgtaeg dtgtage dtgtgae dtgtgea
dteggat dteggta dtegagt dtegatg dtegtag dtegtga dteggat dteggta dtegagt dtegatg dtegtag
dtegtga dteaggt dteagtg dteaggt dteagtg dteatgg dteatgg dtetgag dtetgga dtetagg dtetagg
dtetgag dtetgga dtagegt dtagetg dtagget dtaggte dtagtge dtagteg dtaeggt dtaegtg dtaeggt
dtaegtg dtaetgg dtaetgg dtagegt dtagetg dtagget dtaggte dtagtge dtagteg dtategg dtategg
dtatgeg dtatgge dtatgge dtatgeg dttgeag dttgega dttgaeg dttgage dttggae dttggea dttegag
dttegga dtteagg dtteagg dttegag dttegga dttaegg dttaegg dttageg dttagge dttagge dttageg
dttgeag dttgega dttgaeg dttgage dttggae dttggea dtggeta dtggeat dtggtea dtggtae dtggate
dtggaet dtgegta dtgegat dtgetga dtgetag dtgeatg dtgeagt dtgtega dtgteag dtgtgea dtgtgae
dtgtage dtgtaeg dtgaetg dtgaegt dtgateg dtgatge dtgagte dtgaget dtggeta dtggeat dtggtea
dtggtae dtggate dtggaet dtgegta dtgegat dtgetga dtgetag dtgeatg dtgeagt dtgtega dtgteag
dtgtgea dtgtgae dtgtage dtgtaeg dtgaetg dtgaegt dtgateg dtgatge dtgagte dtgaget dteggta
dteggat dtegtga dtegtag dtegatg dtegagt dteggta dteggat dtegtga dtegtag dtegatg dtegagt
dtetgga dtetgag dtetgga dtetgag dtetagg dtetagg dteagtg dteaggt dteatgg dteatgg dteagtg
dteaggt dttgega dttgeag dttggea dttggae dttgage dttgaeg dttegga dttegag dttegga dttegag
dtteagg dtteagg dttgega dttgeag dttggea dttggae dttgage dttgaeg dttaegg dttaegg dttageg
dttagge dttagge dttageg dtagetg dtagegt dtagteg dtagtge dtaggte dtagget dtaegtg dtaeggt
dtaetgg dtaetgg dtaegtg dtaeggt dtategg dtategg dtatgeg dtatgge dtatgge dtatgeg dtagetg
dtagegt dtagteg dtagtge dtaggte dtagget adggett adggett adggtet adggtte adggtte adggtet
adgegtt adgegtt adgetgt adgettg adgettg adgetgt adgtegt adgtetg adgtget adgtgte adgttge
adgtteg adgtetg adgtegt adgtteg adgttge adgtgte adgtget adggett adggett adggtet adggtte
adggtte adggtet adgegtt adgegtt adgetgt adgettg adgettg adgetgt adgtegt adgtetg adgtget
adgtgte adgttge adgtteg adgtetg adgtegt adgtteg adgttge adgtgte adgtget adeggtt adeggtt
adegtgt adegttg adegttg adegtgt adeggtt adeggtt adegtgt adegttg adegttg adegtgt adetggt
adetgtg adetggt adetgtg adettgg adettgg adetgtg adetggt adettgg adettgg adetgtg adetggt
adtgegt adtgetg adtgget adtggte adtgtge adtgteg adteggt adtegtg adteggt adtegtg adtetgg
adtetgg adtgegt adtgetg adtgget adtggte adtgtge adtgteg adttegg adttegg adttgeg adttgge
adttgge adttgeg adtgetg adtgegt adtgteg adtgtge adtggte adtgget adtegtg adteggt adtetgg
adtetgg adtegtg adteggt adttegg adttegg adttgeg adttgge adttgge adttgeg adtgetg adtgegt
adtgteg adtgtge adtggte adtgget agdgett agdgett agdgtet agdgtte agdgtte agdgtet agdegtt
agdegtt agdetgt agdettg agdettg agdetgt agdtegt agdtetg agdtget agdtgte agdttge agdtteg
agdtetg agdtegt agdtteg agdttge agdtgte agdtget aggdett aggdett aggdtet aggdtte aggdtte
aggdtet aggedtt aggedtt aggetdt aggettd aggettd aggetdt aggtedt aggtetd aggtdet aggtdte
aggttde aggtted aggtetd aggtedt aggtted aggttde aggtdte aggtdet agegdtt agegdtt agegtdt
agegttd agegttd agegtdt agedgtt agedgtt agedtgt agedttg agedttg agedtgt agetdgt agetdtg
agetgdt agetgtd agettgd agettdg agetdtg agetdgt agettdg agettgd agetgtd agetgdt agtgedt
agtgetd agtgdet agtgdte agtgtde agtgted agtegdt agtegtd agtedgt agtedtg agtetdg agtetgd
agtdegt agtdetg agtdget agtdgte agtdtge agtdteg agttedg agttegd agttdeg agttdge agttgde
agttged agtgetd agtgedt agtgted agtgtde agtgdte agtgdet agtegtd agtegdt agtetgd agtetdg
agtedtg agtedgt agttegd agttedg agttged agttgde agttdge agttdeg agtdetg agtdegt agtdteg
agtdtge agtdgte agtdget aggdett aggdett aggdtet aggdtte aggdtte aggdtet aggedtt aggedtt
aggetdt aggettd aggettd aggetdt aggtedt aggtetd aggtdet aggtdte aggttde aggtted aggtetd
aggtedt aggtted aggttde aggtdte aggtdet agdgett agdgett agdgtet agdgtte agdgtte agdgtet
agdegtt agdegtt agdetgt agdettg agdettg agdetgt agdtegt agdtetg agdtget agdtgte agdttge
agdtteg agdtetg agdtegt agdtteg agdttge agdtgte agdtget agedgtt agedgtt agedtgt agedttg
agedttg agedtgt agegdtt agegdtt agegtdt agegttd agegttd agegtdt agetgdt agetgtd agetdgt
agetdtg agettdg agettgd agetgtd agetgdt agettgd agettdg agetdtg agetdgt agtdegt agtdetg
agtdget agtdgte agtdtge agtdteg agtedgt agtedtg agtegdt agtegtd agtetgd agtetdg agtgedt
agtgetd agtgdet agtgdte agtgtde agtgted agttegd agttedg agttged agttgde agttdge agttdeg
agtdetg agtdegt agtdteg agtdtge agtdgte agtdget agtedtg agtedgt agtetdg agtetgd agtegtd
agtegdt agttedg agttegd agttdeg agttdge agttgde agttged agtgetd agtgedt agtgted agtgtde
agtgdte agtgdet aeggdtt aeggdtt aeggtdt aeggttd aeggttd aeggtdt aegdgtt aegdgtt aegdtgt
aegdttg aegdttg aegdtgt aegtdgt aegtdtg aegtgdt aegtgtd aegttgd aegttdg aegtdtg aegtdgt
aegttdg aegttgd aegtgtd aegtgdt aeggdtt aeggdtt aeggtdt aeggttd aeggttd aeggtdt aegdgtt
aegdgtt aegdtgt aegdttg aegdttg aegdtgt aegtdgt aegtdtg aegtgdt aegtgtd aegttgd aegttdg
aegtdtg aegtdgt aegttdg aegttgd aegtgtd aegtgdt aedggtt aedggtt aedgtgt aedgttg aedgttg
aedgtgt aedggtt aedggtt aedgtgt aedgttg aedgttg aedgtgt aedtggt aedtgtg aedtggt aedtgtg
aedttgg aedttgg aedtgtg aedtggt aedttgg aedttgg aedtgtg aedtggt aetgdgt aetgdtg aetggdt
aetggtd aetgtgd aetgtdg aetdggt aetdgtg aetdggt aetdgtg aetdtgg aetdtgg aetgdgt aetgdtg
aetggdt aetggtd aetgtgd aetgtdg aettdgg aettdgg aettgdg aettggd aettggd aettgdg aetgdtg
aetgdgt aetgtdg aetgtgd aetggtd aetggdt aetdgtg aetdggt aetdtgg aetdtgg aetdgtg aetdggt
aettdgg aettdgg aettgdg aettggd aettggd aettgdg aetgdtg aetgdgt aetgtdg aetgtgd aetggtd
aetggdt atggedt atggetd atggdet atggdte atggtde atggted atgegdt atgegtd atgedgt atgedtg
atgetdg atgetgd atgdegt atgdetg atgdget atgdgte atgdtge atgdteg atgtedg atgtegd atgtdeg
atgtdge atgtgde atgtged atggedt atggetd atggdet atggdte atggtde atggted atgegdt atgegtd
atgedgt atgedtg atgetdg atgetgd atgdegt atgdetg atgdget atgdgte atgdtge atgdteg atgtedg
atgtegd atgtdeg atgtdge atgtgde atgtged ateggdt ateggtd ategdgt ategdtg ategtdg ategtgd
ateggdt ateggtd ategdgt ategdtg ategtdg ategtgd atedggt atedgtg atedggt atedgtg atedtgg
atedtgg atetgdg atetggd atetdgg atetdgg atetgdg atetggd atdgegt atdgetg atdgget atdggte
atdgtge atdgteg atdeggt atdegtg atdeggt atdegtg atdetgg atdetgg atdgegt atdgetg atdgget
atdggte atdgtge atdgteg atdtegg atdtegg atdtgeg atdtgge atdtgge atdtgeg attgedg attgegd
attgdeg attgdge attggde attgged attegdg atteggd attedgg attedgg attegdg atteggd attdegg
attdegg attdgeg attdgge attdgge attdgeg attgedg attgegd attgdeg attgdge attggde attgged
atggetd atggedt atggted atggtde atggdte atggdet atgegtd atgegdt atgetgd atgetdg atgedtg
atgedgt atgtegd atgtedg atgtged atgtgde atgtdge atgtdeg atgdetg atgdegt atgdteg atgdtge
atgdgte atgdget atggetd atggedt atggted atggtde atggdte atggdet atgegtd atgegdt atgetgd
atgetdg atgedtg atgedgt atgtegd atgtedg atgtged atgtgde atgtdge atgtdeg atgdetg atgdegt
atgdteg atgdtge atgdgte atgdget ateggtd ateggdt ategtgd ategtdg ategdtg ategdgt ateggtd
ateggdt ategtgd ategtdg ategdtg ategdgt atetggd atetgdg atetggd atetgdg atetdgg atetdgg
atedgtg atedggt atedtgg atedtgg atedgtg atedggt attgegd attgedg attgged attggde attgdge
attgdeg atteggd attegdg atteggd attegdg attedgg attedgg attgegd attgedg attgged attggde
attgdge attgdeg attdegg attdegg attdgeg attdgge attdgge attdgeg atdgetg atdgegt atdgteg
atdgtge atdggte atdgget atdegtg atdeggt atdetgg atdetgg atdegtg atdeggt atdtegg atdtegg
atdtgeg atdtgge atdtgge atdtgeg atdgetg atdgegt atdgteg atdgtge atdggte atdgget gadgett
gadgett gadgtet gadgtte gadgtte gadgtet gadegtt gadegtt gadetgt gadettg gadettg gadetgt
gadtegt gadtetg gadtget gadtgte gadttge gadtteg gadtetg gadtegt gadtteg gadttge gadtgte
gadtget gagdett gagdett gagdtet gagdtte gagdtte gagdtet gagedtt gagedtt gagetdt gagettd
gagettd gagetdt gagtedt gagtetd gagtdet gagtdte gagttde gagtted gagtetd gagtedt gagtted
gagttde gagtdte gagtdet gaegdtt gaegdtt gaegtdt gaegttd gaegttd gaegtdt gaedgtt gaedgtt
gaedtgt gaedttg gaedttg gaedtgt gaetdgt gaetdtg gaetgdt gaetgtd gaettgd gaettdg gaetdtg
gaetdgt gaettdg gaettgd gaetgtd gaetgdt gatgedt gatgetd gatgdet gatgdte gatgtde gatgted
gategdt gategtd gatedgt gatedtg gatetdg gatetgd gatdegt gatdetg gatdget gatdgte gatdtge
gatdteg gattedg gattegd gattdeg gattdge gattgde gattged gatgetd gatgedt gatgted gatgtde
gatgdte gatgdet gategtd gategdt gatetgd gatetdg gatedtg gatedgt gattegd gattedg gattged
gattgde gattdge gattdeg gatdetg gatdegt gatdteg gatdtge gatdgte gatdget gdagett gdagett
gdagtet gdagtte gdagtte gdagtet gdaegtt gdaegtt gdaetgt gdaettg gdaettg gdaetgt gdategt
gdatetg gdatget gdatgte gdattge gdatteg gdatetg gdategt gdatteg gdattge gdatgte gdatget
gdgaett gdgaett gdgatet gdgatte gdgatte gdgatet gdgeatt gdgeatt gdgetat gdgetta gdgetta
gdgetat gdgteat gdgteta gdgtaet gdgtate gdgttae gdgttea gdgteta gdgteat gdgttea gdgttae
gdgtate gdgtaet gdegatt gdegatt gdegtat gdegtta gdegtta gdegtat gdeagtt gdeagtt gdeatgt
gdeattg gdeattg gdeatgt gdetagt gdetatg gdetgat gdetgta gdettga gdettag gdetatg gdetagt
gdettag gdettga gdetgta gdetgat gdtgeat gdtgeta gdtgaet gdtgate gdtgtae gdtgtea gdtegat
gdtegta gdteagt gdteatg gdtetag gdtetga gdtaegt gdtaetg gdtaget gdtagte gdtatge gdtateg
gdtteag gdttega gdttaeg gdttage gdttgae gdttgea gdtgeta gdtgeat gdtgtea gdtgtae gdtgate
gdtgaet gdtegta gdtegat gdtetga gdtetag gdteatg gdteagt gdttega gdtteag gdttgea gdttgae
gdttage gdttaeg gdtaetg gdtaegt gdtateg gdtatge gdtagte gdtaget ggdaett ggdaett ggdatet
ggdatte ggdatte ggdatet ggdeatt ggdeatt ggdetat ggdetta ggdetta ggdetat ggdteat ggdteta
ggdtaet ggdtate ggdttae ggdttea ggdteta ggdteat ggdttea ggdttae ggdtate ggdtaet ggadett
ggadett ggadtet ggadtte ggadtte ggadtet ggaedtt ggaedtt ggaetdt ggaettd ggaettd ggaetdt
ggatedt ggatetd ggatdet ggatdte ggattde ggatted ggatetd ggatedt ggatted ggattde ggatdte
ggatdet ggeadtt ggeadtt ggeatdt ggeattd ggeattd ggeatdt ggedatt ggedatt ggedtat ggedtta
ggedtta ggedtat ggetdat ggetdta ggetadt ggetatd ggettad ggettda ggetdta ggetdat ggettda
ggettad ggetatd ggetadt ggtaedt ggtaetd ggtadet ggtadte ggtatde ggtated ggteadt ggteatd
ggtedat ggtedta ggtetda ggtetad ggtdeat ggtdeta ggtdaet ggtdate ggtdtae ggtdtea ggtteda
ggttead ggttdea ggttdae ggttade ggttaed ggtaetd ggtaedt ggtated ggtatde ggtadte ggtadet
ggteatd ggteadt ggtetad ggtetda ggtedta ggtedat ggttead ggtteda ggttaed ggttade ggttdae
ggttdea ggtdeta ggtdeat ggtdtea ggtdtae ggtdate ggtdaet gedgatt gedgatt gedgtat gedgtta
gedgtta gedgtat gedagtt gedagtt gedatgt gedattg gedattg gedatgt gedtagt gedtatg gedtgat
gedtgta gedttga gedttag gedtatg gedtagt gedttag gedttga gedtgta gedtgat gegdatt gegdatt
gegdtat gegdtta gegdtta gegdtat gegadtt gegadtt gegatdt gegattd gegattd gegatdt gegtadt
gegtatd gegtdat gegtdta gegttda gegttad gegtatd gegtadt gegttad gegttda gegtdta gegtdat
geagdtt geagdtt geagtdt geagttd geagttd geagtdt geadgtt geadgtt geadtgt geadttg geadttg
geadtgt geatdgt geatdtg geatgdt geatgtd geattgd geattdg geatdtg geatdgt geattdg geattgd
geatgtd geatgdt getgadt getgatd getgdat getgdta getgtda getgtad getagdt getagtd getadgt
getadtg getatdg getatgd getdagt getdatg getdgat getdgta getdtga getdtag gettadg gettagd
gettdag gettdga gettgda gettgad getgatd getgadt getgtad getgtda getgdta getgdat getagtd
getagdt getatgd getatdg getadtg getadgt gettagd gettadg gettgad gettgda gettdga gettdag
getdatg getdagt getdtag getdtga getdgta getdgat gtdgeat gtdgeta gtdgaet gtdgate gtdgtae
gtdgtea gtdegat gtdegta gtdeagt gtdeatg gtdetag gtdetga gtdaegt gtdaetg gtdaget gtdagte
gtdatge gtdateg gtdteag gtdtega gtdtaeg gtdtage gtdtgae gtdtgea gtgdeat gtgdeta gtgdaet
gtgdate gtgdtae gtgdtea gtgedat gtgedta gtgeadt gtgeatd gtgetad gtgetda gtgaedt gtgaetd
gtgadet gtgadte gtgatde gtgated gtgtead gtgteda gtgtaed gtgtade gtgtdae gtgtdea gtegdat
gtegdta gtegadt gtegatd gtegtad gtegtda gtedgat gtedgta gtedagt gtedatg gtedtag gtedtga
gteadgt gteadtg gteagdt gteagtd gteatgd gteatdg gtetdag gtetdga gtetadg gtetagd gtetgad
gtetgda gtagedt gtagetd gtagdet gtagdte gtagtde gtagted gtaegdt gtaegtd gtaedgt gtaedtg
gtaetdg gtaetgd gtadegt gtadetg gtadget gtadgte gtadtge gtadteg gtatedg gtategd gtatdeg
gtatdge gtatgde gtatged gttgead gttgeda gttgaed gttgade gttgdae gttgdea gttegad gttegda
gtteagd gtteadg gttedag gttedga gttaegd gttaedg gttaged gttagde gttadge gttadeg gttdeag
gttdega gttdaeg gttdage gttdgae gttdgea gtdgeta gtdgeat gtdgtea gtdgtae gtdgate gtdgaet
gtdegta gtdegat gtdetga gtdetag gtdeatg gtdeagt gtdtega gtdteag gtdtgea gtdtgae gtdtage
gtdtaeg gtdaetg gtdaegt gtdateg gtdatge gtdagte gtdaget gtgdeta gtgdeat gtgdtea gtgdtae
gtgdate gtgdaet gtgedta gtgedat gtgetda gtgetad gtgeatd gtgeadt gtgteda gtgtead gtgtdea
gtgtdae gtgtade gtgtaed gtgaetd gtgaedt gtgated gtgatde gtgadte gtgadet gtegdta gtegdat
gtegtda gtegtad gtegatd gtegadt gtedgta gtedgat gtedtga gtedtag gtedatg gtedagt gtetdga
gtetdag gtetgda gtetgad gtetagd gtetadg gteadtg gteadgt gteatdg gteatgd gteagtd gteagdt
gttgeda gttgead gttgdea gttgdae gttgade gttgaed gttegda gttegad gttedga gttedag gtteadg
gtteagd gttdega gttdeag gttdgea gttdgae gttdage gttdaeg gttaedg gttaegd gttadeg gttadge
gttagde gttaged gtagetd gtagedt gtagted gtagtde gtagdte gtagdet gtaegtd gtaegdt gtaetgd
gtaetdg gtaedtg gtaedgt gtategd gtatedg gtatged gtatgde gtatdge gtatdeg gtadetg gtadegt
gtadteg gtadtge gtadgte gtadget gagdett gagdett gagdtet gagdtte gagdtte gagdtet gagedtt
gagedtt gagetdt gagettd gagettd gagetdt gagtedt gagtetd gagtdet gagtdte gagttde gagtted
gagtetd gagtedt gagtted gagttde gagtdte gagtdet gadgett gadgett gadgtet gadgtte gadgtte
gadgtet gadegtt gadegtt gadetgt gadettg gadettg gadetgt gadtegt gadtetg gadtget gadtgte
gadttge gadtteg gadtetg gadtegt gadtteg gadttge gadtgte gadtget gaedgtt gaedgtt gaedtgt
gaedttg gaedttg gaedtgt gaegdtt gaegdtt gaegtdt gaegttd gaegttd gaegtdt gaetgdt gaetgtd
gaetdgt gaetdtg gaettdg gaettgd gaetgtd gaetgdt gaettgd gaettdg gaetdtg gaetdgt gatdegt
gatdetg gatdget gatdgte gatdtge gatdteg gatedgt gatedtg gategdt gategtd gatetgd gatetdg
gatgedt gatgetd gatgdet gatgdte gatgtde gatgted gattegd gattedg gattged gattgde gattdge
gattdeg gatdetg gatdegt gatdteg gatdtge gatdgte gatdget gatedtg gatedgt gatetdg gatetgd
gategtd gategdt gattedg gattegd gattdeg gattdge gattgde gattged gatgetd gatgedt gatgted
gatgtde gatgdte gatgdet ggadett ggadett ggadtet ggadtte ggadtte ggadtet ggaedtt ggaedtt
ggaetdt ggaettd ggaettd ggaetdt ggatedt ggatetd ggatdet ggatdte ggattde ggatted ggatetd
ggatedt ggatted ggattde ggatdte ggatdet ggdaett ggdaett ggdatet ggdatte ggdatte ggdatet
ggdeatt ggdeatt ggdetat ggdetta ggdetta ggdetat ggdteat ggdteta ggdtaet ggdtate ggdttae
ggdttea ggdteta ggdteat ggdttea ggdttae ggdtate ggdtaet ggedatt ggedatt ggedtat ggedtta
ggedtta ggedtat ggeadtt ggeadtt ggeatdt ggeattd ggeattd ggeatdt ggetadt ggetatd ggetdat
ggetdta ggettda ggettad ggetatd ggetadt ggettad ggettda ggetdta ggetdat ggtdeat ggtdeta
ggtdaet ggtdate ggtdtae ggtdtea ggtedat ggtedta ggteadt ggteatd ggtetad ggtetda ggtaedt
ggtaetd ggtadet ggtadte ggtatde ggtated ggttead ggtteda ggttaed ggttade ggttdae ggttdea
ggtdeta ggtdeat ggtdtea ggtdtae ggtdate ggtdaet ggtedta ggtedat ggtetda ggtetad ggteatd
ggteadt ggtteda ggttead ggttdea ggttdae ggttade ggttaed ggtaetd ggtaedt ggtated ggtatde
ggtadte ggtadet gdgaett gdgaett gdgatet gdgatte gdgatte gdgatet gdgeatt gdgeatt gdgetat
gdgetta gdgetta gdgetat gdgteat gdgteta gdgtaet gdgtate gdgttae gdgttea gdgteta gdgteat
gdgttea gdgttae gdgtate gdgtaet gdagett gdagett gdagtet gdagtte gdagtte gdagtet gdaegtt
gdaegtt gdaetgt gdaettg gdaettg gdaetgt gdategt gdatetg gdatget gdatgte gdattge gdatteg
gdatetg gdategt gdatteg gdattge gdatgte gdatget gdeagtt gdeagtt gdeatgt gdeattg gdeattg
gdeatgt gdegatt gdegatt gdegtat gdegtta gdegtta gdegtat gdetgat gdetgta gdetagt gdetatg
gdettag gdettga gdetgta gdetgat gdettga gdettag gdetatg gdetagt gdtaegt gdtaetg gdtaget
gdtagte gdtatge gdtateg gdteagt gdteatg gdtegat gdtegta gdtetga gdtetag gdtgeat gdtgeta
gdtgaet gdtgate gdtgtae gdtgtea gdttega gdtteag gdttgea gdttgae gdttage gdttaeg gdtaetg
gdtaegt gdtateg gdtatge gdtagte gdtaget gdteatg gdteagt gdtetag gdtetga gdtegta gdtegat
gdtteag gdttega gdttaeg gdttage gdttgae gdttgea gdtgeta gdtgeat gdtgtea gdtgtae gdtgate
gdtgaet gegdatt gegdatt gegdtat gegdtta gegdtta gegdtat gegadtt gegadtt gegatdt gegattd
gegattd gegatdt gegtadt gegtatd gegtdat gegtdta gegttda gegttad gegtatd gegtadt gegttad
gegttda gegtdta gegtdat gedgatt gedgatt gedgtat gedgtta gedgtta gedgtat gedagtt gedagtt
gedatgt gedattg gedattg gedatgt gedtagt gedtatg gedtgat gedtgta gedttga gedttag gedtatg
gedtagt gedttag gedttga gedtgta gedtgat geadgtt geadgtt geadtgt geadttg geadttg geadtgt
geagdtt geagdtt geagtdt geagttd geagttd geagtdt geatgdt geatgtd geatdgt geatdtg geattdg
geattgd geatgtd geatgdt geattgd geattdg geatdtg geatdgt getdagt getdatg getdgat getdgta
getdtga getdtag getadgt getadtg getagdt getagtd getatgd getatdg getgadt getgatd getgdat
getgdta getgtda getgtad gettagd gettadg gettgad gettgda gettdga gettdag getdatg getdagt
getdtag getdtga getdgta getdgat getadtg getadgt getatdg getatgd getagtd getagdt gettadg
gettagd gettdag gettdga gettgda gettgad getgatd getgadt getgtad getgtda getgdta getgdat
gtgdeat gtgdeta gtgdaet gtgdate gtgdtae gtgdtea gtgedat gtgedta gtgeadt gtgeatd gtgetad
gtgetda gtgaedt gtgaetd gtgadet gtgadte gtgatde gtgated gtgtead gtgteda gtgtaed gtgtade
gtgtdae gtgtdea gtdgeat gtdgeta gtdgaet gtdgate gtdgtae gtdgtea gtdegat gtdegta gtdeagt
gtdeatg gtdetag gtdetga gtdaegt gtdaetg gtdaget gtdagte gtdatge gtdateg gtdteag gtdtega
gtdtaeg gtdtage gtdtgae gtdtgea gtedgat gtedgta gtedagt gtedatg gtedtag gtedtga gtegdat
gtegdta gtegadt gtegatd gtegtad gtegtda gteagdt gteagtd gteadgt gteadtg gteatdg gteatgd
gtetgad gtetgda gtetagd gtetadg gtetdag gtetdga gtadegt gtadetg gtadget gtadgte gtadtge
gtadteg gtaedgt gtaedtg gtaegdt gtaegtd gtaetgd gtaetdg gtagedt gtagetd gtagdet gtagdte
gtagtde gtagted gtategd gtatedg gtatged gtatgde gtatdge gtatdeg gttdeag gttdega gttdaeg
gttdage gttdgae gttdgea gttedag gttedga gtteadg gtteagd gttegad gttegda gttaedg gttaegd
gttadeg gttadge gttagde gttaged gttgead gttgeda gttgaed gttgade gttgdae gttgdea gtgdeta
gtgdeat gtgdtea gtgdtae gtgdate gtgdaet gtgedta gtgedat gtgetda gtgetad gtgeatd gtgeadt
gtgteda gtgtead gtgtdea gtgtdae gtgtade gtgtaed gtgaetd gtgaedt gtgated gtgatde gtgadte
gtgadet gtdgeta gtdgeat gtdgtea gtdgtae gtdgate gtdgaet gtdegta gtdegat gtdetga gtdetag
gtdeatg gtdeagt gtdtega gtdteag gtdtgea gtdtgae gtdtage gtdtaeg gtdaetg gtdaegt gtdateg
gtdatge gtdagte gtdaget gtedgta gtedgat gtedtga gtedtag gtedatg gtedagt gtegdta gtegdat
gtegtda gtegtad gtegatd gtegadt gtetgda gtetgad gtetdga gtetdag gtetadg gtetagd gteagtd
gteagdt gteatgd gteatdg gteadtg gteadgt gttdega gttdeag gttdgea gttdgae gttdage gttdaeg
gttedga gttedag gttegda gttegad gtteagd gtteadg gttgeda gttgead gttgdea gttgdae gttgade
gttgaed gttaegd gttaedg gttaged gttagde gttadge gttadeg gtadetg gtadegt gtadteg gtadtge
gtadgte gtadget gtaedtg gtaedgt gtaetdg gtaetgd gtaegtd gtaegdt gtatedg gtategd gtatdeg
gtatdge gtatgde gtatged gtagetd gtagedt gtagted gtagtde gtagdte gtagdet eaggdtt eaggdtt
eaggtdt eaggttd eaggttd eaggtdt eagdgtt eagdgtt eagdtgt eagdttg eagdttg eagdtgt eagtdgt
eagtdtg eagtgdt eagtgtd eagttgd eagttdg eagtdtg eagtdgt eagttdg eagttgd eagtgtd eagtgdt
eaggdtt eaggdtt eaggtdt eaggttd eaggttd eaggtdt eagdgtt eagdgtt eagdtgt eagdttg eagdttg
eagdtgt eagtdgt eagtdtg eagtgdt eagtgtd eagttgd eagttdg eagtdtg eagtdgt eagttdg eagttgd
eagtgtd eagtgdt eadggtt eadggtt eadgtgt eadgttg eadgttg eadgtgt eadggtt eadggtt eadgtgt
eadgttg eadgttg eadgtgt eadtggt eadtgtg eadtggt eadtgtg eadttgg eadttgg eadtgtg eadtggt
eadttgg eadttgg eadtgtg eadtggt eatgdgt eatgdtg eatggdt eatggtd eatgtgd eatgtdg eatdggt
eatdgtg eatdggt eatdgtg eatdtgg eatdtgg eatgdgt eatgdtg eatggdt eatggtd eatgtgd eatgtdg
eattdgg eattdgg eattgdg eattggd eattggd eattgdg eatgdtg eatgdgt eatgtdg eatgtgd eatggtd
eatggdt eatdgtg eatdggt eatdtgg eatdtgg eatdgtg eatdggt eattdgg eattdgg eattgdg eattggd
eattggd eattgdg eatgdtg eatgdgt eatgtdg eatgtgd eatggtd eatggdt egagdtt egagdtt egagtdt
egagttd egagttd egagtdt egadgtt egadgtt egadtgt egadttg egadttg egadtgt egatdgt egatdtg
egatgdt egatgtd egattgd egattdg egatdtg egatdgt egattdg egattgd egatgtd egatgdt eggadtt
eggadtt eggatdt eggattd eggattd eggatdt eggdatt eggdatt eggdtat eggdtta eggdtta eggdtat
eggtdat eggtdta eggtadt eggtatd eggttad eggttda eggtdta eggtdat eggttda eggttad eggtatd
eggtadt egdgatt egdgatt egdgtat egdgtta egdgtta egdgtat egdagtt egdagtt egdatgt egdattg
egdattg egdatgt egdtagt egdtatg egdtgat egdtgta egdttga egdttag egdtatg egdtagt egdttag
egdttga egdtgta egdtgat egtgdat egtgdta egtgadt egtgatd egtgtad egtgtda egtdgat egtdgta
egtdagt egtdatg egtdtag egtdtga egtadgt egtadtg egtagdt egtagtd egtatgd egtatdg egttdag
egttdga egttadg egttagd egttgad egttgda egtgdta egtgdat egtgtda egtgtad egtgatd egtgadt
egtdgta egtdgat egtdtga egtdtag egtdatg egtdagt egttdga egttdag egttgda egttgad egttagd
egttadg egtadtg egtadgt egtatdg egtatgd egtagtd egtagdt eggadtt eggadtt eggatdt eggattd
eggattd eggatdt eggdatt eggdatt eggdtat eggdtta eggdtta eggdtat eggtdat eggtdta eggtadt
eggtatd eggttad eggttda eggtdta eggtdat eggttda eggttad eggtatd eggtadt egagdtt egagdtt
egagtdt egagttd egagttd egagtdt egadgtt egadgtt egadtgt egadttg egadttg egadtgt egatdgt
egatdtg egatgdt egatgtd egattgd egattdg egatdtg egatdgt egattdg egattgd egatgtd egatgdt
egdagtt egdagtt egdatgt egdattg egdattg egdatgt egdgatt egdgatt egdgtat egdgtta egdgtta
egdgtat egdtgat egdtgta egdtagt egdtatg egdttag egdttga egdtgta egdtgat egdttga egdttag
egdtatg egdtagt egtadgt egtadtg egtagdt egtagtd egtatgd egtatdg egtdagt egtdatg egtdgat
egtdgta egtdtga egtdtag egtgdat egtgdta egtgadt egtgatd egtgtad egtgtda egttdga egttdag
egttgda egttgad egttagd egttadg egtadtg egtadgt egtatdg egtatgd egtagtd egtagdt egtdatg
egtdagt egtdtag egtdtga egtdgta egtdgat egttdag egttdga egttadg egttagd egttgad egttgda
egtgdta egtgdat egtgtda egtgtad egtgatd egtgadt edggatt edggatt edggtat edggtta edggtta
edggtat edgagtt edgagtt edgatgt edgattg edgattg edgatgt edgtagt edgtatg edgtgat edgtgta
edgttga edgttag edgtatg edgtagt edgttag edgttga edgtgta edgtgat edggatt edggatt edggtat
edggtta edggtta edggtat edgagtt edgagtt edgatgt edgattg edgattg edgatgt edgtagt edgtatg
edgtgat edgtgta edgttga edgttag edgtatg edgtagt edgttag edgttga edgtgta edgtgat edaggtt
edaggtt edagtgt edagttg edagttg edagtgt edaggtt edaggtt edagtgt edagttg edagttg edagtgt
edatggt edatgtg edatggt edatgtg edattgg edattgg edatgtg edatggt edattgg edattgg edatgtg
edatggt edtgagt edtgatg edtggat edtggta edtgtga edtgtag edtaggt edtagtg edtaggt edtagtg
edtatgg edtatgg edtgagt edtgatg edtggat edtggta edtgtga edtgtag edttagg edttagg edttgag
edttgga edttgga edttgag edtgatg edtgagt edtgtag edtgtga edtggta edtggat edtagtg edtaggt
edtatgg edtatgg edtagtg edtaggt edttagg edttagg edttgag edttgga edttgga edttgag edtgatg
edtgagt edtgtag edtgtga edtggta edtggat etggdat etggdta etggadt etggatd etggtad etggtda
etgdgat etgdgta etgdagt etgdatg etgdtag etgdtga etgadgt etgadtg etgagdt etgagtd etgatgd
etgatdg etgtdag etgtdga etgtadg etgtagd etgtgad etgtgda etggdat etggdta etggadt etggatd
etggtad etggtda etgdgat etgdgta etgdagt etgdatg etgdtag etgdtga etgadgt etgadtg etgagdt
etgagtd etgatgd etgatdg etgtdag etgtdga etgtadg etgtagd etgtgad etgtgda etdggat etdggta
etdgagt etdgatg etdgtag etdgtga etdggat etdggta etdgagt etdgatg etdgtag etdgtga etdaggt
etdagtg etdaggt etdagtg etdatgg etdatgg etdtgag etdtgga etdtagg etdtagg etdtgag etdtgga
etagdgt etagdtg etaggdt etaggtd etagtgd etagtdg etadggt etadgtg etadggt etadgtg etadtgg
etadtgg etagdgt etagdtg etaggdt etaggtd etagtgd etagtdg etatdgg etatdgg etatgdg etatggd
etatggd etatgdg ettgdag ettgdga ettgadg ettgagd ettggad ettggda ettdgag ettdgga ettdagg
ettdagg ettdgag ettdgga ettadgg ettadgg ettagdg ettaggd ettaggd ettagdg ettgdag ettgdga
ettgadg ettgagd ettggad ettggda etggdta etggdat etggtda etggtad etggatd etggadt etgdgta
etgdgat etgdtga etgdtag etgdatg etgdagt etgtdga etgtdag etgtgda etgtgad etgtagd etgtadg
etgadtg etgadgt etgatdg etgatgd etgagtd etgagdt etggdta etggdat etggtda etggtad etggatd
etggadt etgdgta etgdgat etgdtga etgdtag etgdatg etgdagt etgtdga etgtdag etgtgda etgtgad
etgtagd etgtadg etgadtg etgadgt etgatdg etgatgd etgagtd etgagdt etdggta etdggat etdgtga
etdgtag etdgatg etdgagt etdggta etdggat etdgtga etdgtag etdgatg etdgagt etdtgga etdtgag
etdtgga etdtgag etdtagg etdtagg etdagtg etdaggt etdatgg etdatgg etdagtg etdaggt ettgdga
ettgdag ettggda ettggad ettgagd ettgadg ettdgga ettdgag ettdgga ettdgag ettdagg ettdagg
ettgdga ettgdag ettggda ettggad ettgagd ettgadg ettadgg ettadgg ettagdg ettaggd ettaggd
ettagdg etagdtg etagdgt etagtdg etagtgd etaggtd etaggdt etadgtg etadggt etadtgg etadtgg
etadgtg etadggt etatdgg etatdgg etatgdg etatggd etatggd etatgdg etagdtg etagdgt etagtdg
etagtgd etaggtd etaggdt taggedt taggetd taggdet taggdte taggtde taggted tagegdt tagegtd
tagedgt tagedtg tagetdg tagetgd tagdegt tagdetg tagdget tagdgte tagdtge tagdteg tagtedg
tagtegd tagtdeg tagtdge tagtgde tagtged taggedt taggetd taggdet taggdte taggtde taggted
tagegdt tagegtd tagedgt tagedtg tagetdg tagetgd tagdegt tagdetg tagdget tagdgte tagdtge
tagdteg tagtedg tagtegd tagtdeg tagtdge tagtgde tagtged taeggdt taeggtd taegdgt taegdtg
taegtdg taegtgd taeggdt taeggtd taegdgt taegdtg taegtdg taegtgd taedggt taedgtg taedggt
taedgtg taedtgg taedtgg taetgdg taetggd taetdgg taetdgg taetgdg taetggd tadgegt tadgetg
tadgget tadggte tadgtge tadgteg tadeggt tadegtg tadeggt tadegtg tadetgg tadetgg tadgegt
tadgetg tadgget tadggte tadgtge tadgteg tadtegg tadtegg tadtgeg tadtgge tadtgge tadtgeg
tatgedg tatgegd tatgdeg tatgdge tatggde tatgged tategdg tateggd tatedgg tatedgg tategdg
tateggd tatdegg tatdegg tatdgeg tatdgge tatdgge tatdgeg tatgedg tatgegd tatgdeg tatgdge
tatggde tatgged tgagedt tgagetd tgagdet tgagdte tgagtde tgagted tgaegdt tgaegtd tgaedgt
tgaedtg tgaetdg tgaetgd tgadegt tgadetg tgadget tgadgte tgadtge tgadteg tgatedg tgategd
tgatdeg tgatdge tgatgde tgatged tggaedt tggaetd tggadet tggadte tggatde tggated tggeadt
tggeatd tggedat tggedta tggetda tggetad tggdeat tggdeta tggdaet tggdate tggdtae tggdtea
tggteda tggtead tggtdea tggtdae tggtade tggtaed tgegadt tgegatd tgegdat tgegdta tgegtda
tgegtad tgeagdt tgeagtd tgeadgt tgeadtg tgeatdg tgeatgd tgedagt tgedatg tgedgat tgedgta
tgedtga tgedtag tgetadg tgetagd tgetdag tgetdga tgetgda tgetgad tgdgeat tgdgeta tgdgaet
tgdgate tgdgtae tgdgtea tgdegat tgdegta tgdeagt tgdeatg tgdetag tgdetga tgdaegt tgdaetg
tgdaget tgdagte tgdatge tgdateg tgdteag tgdtega tgdtaeg tgdtage tgdtgae tgdtgea tgtgeda
tgtgead tgtgdea tgtgdae tgtgade tgtgaed tgtegda tgtegad tgtedga tgtedag tgteadg tgteagd
tgtdega tgtdeag tgtdgea tgtdgae tgtdage tgtdaeg tgtaedg tgtaegd tgtadeg tgtadge tgtagde
tgtaged tggaedt tggaetd tggadet tggadte tggatde tggated tggeadt tggeatd tggedat tggedta
tggetda tggetad tggdeat tggdeta tggdaet tggdate tggdtae tggdtea tggteda tggtead tggtdea
tggtdae tggtade tggtaed tgagedt tgagetd tgagdet tgagdte tgagtde tgagted tgaegdt tgaegtd
tgaedgt tgaedtg tgaetdg tgaetgd tgadegt tgadetg tgadget tgadgte tgadtge tgadteg tgatedg
tgategd tgatdeg tgatdge tgatgde tgatged tgeagdt tgeagtd tgeadgt tgeadtg tgeatdg tgeatgd
tgegadt tgegatd tgegdat tgegdta tgegtda tgegtad tgedgat tgedgta tgedagt tgedatg tgedtag
tgedtga tgetgda tgetgad tgetdga tgetdag tgetadg tgetagd tgdaegt tgdaetg tgdaget tgdagte
tgdatge tgdateg tgdeagt tgdeatg tgdegat tgdegta tgdetga tgdetag tgdgeat tgdgeta tgdgaet
tgdgate tgdgtae tgdgtea tgdtega tgdteag tgdtgea tgdtgae tgdtage tgdtaeg tgtaedg tgtaegd
tgtadeg tgtadge tgtagde tgtaged tgteadg tgteagd tgtedag tgtedga tgtegda tgtegad tgtdeag
tgtdega tgtdaeg tgtdage tgtdgae tgtdgea tgtgeda tgtgead tgtgdea tgtgdae tgtgade tgtgaed
teggadt teggatd teggdat teggdta teggtda teggtad tegagdt tegagtd tegadgt tegadtg tegatdg
tegatgd tegdagt tegdatg tegdgat tegdgta tegdtga tegdtag tegtadg tegtagd tegtdag tegtdga
tegtgda tegtgad teggadt teggatd teggdat teggdta teggtda teggtad tegagdt tegagtd tegadgt
tegadtg tegatdg tegatgd tegdagt tegdatg tegdgat tegdgta tegdtga tegdtag tegtadg tegtagd
tegtdag tegtdga tegtgda tegtgad teaggdt teaggtd teagdgt teagdtg teagtdg teagtgd teaggdt
teaggtd teagdgt teagdtg teagtdg teagtgd teadggt teadgtg teadggt teadgtg teadtgg teadtgg
teatgdg teatggd teatdgg teatdgg teatgdg teatggd tedgagt tedgatg tedggat tedggta tedgtga
tedgtag tedaggt tedagtg tedaggt tedagtg tedatgg tedatgg tedgagt tedgatg tedggat tedggta
tedgtga tedgtag tedtagg tedtagg tedtgag tedtgga tedtgga tedtgag tetgadg tetgagd tetgdag
tetgdga tetggda tetggad tetagdg tetaggd tetadgg tetadgg tetagdg tetaggd tetdagg tetdagg
tetdgag tetdgga tetdgga tetdgag tetgadg tetgagd tetgdag tetgdga tetggda tetggad tdggeat
tdggeta tdggaet tdggate tdggtae tdggtea tdgegat tdgegta tdgeagt tdgeatg tdgetag tdgetga
tdgaegt tdgaetg tdgaget tdgagte tdgatge tdgateg tdgteag tdgtega tdgtaeg tdgtage tdgtgae
tdgtgea tdggeat tdggeta tdggaet tdggate tdggtae tdggtea tdgegat tdgegta tdgeagt tdgeatg
tdgetag tdgetga tdgaegt tdgaetg tdgaget tdgagte tdgatge tdgateg tdgteag tdgtega tdgtaeg
tdgtage tdgtgae tdgtgea tdeggat tdeggta tdegagt tdegatg tdegtag tdegtga tdeggat tdeggta
tdegagt tdegatg tdegtag tdegtga tdeaggt tdeagtg tdeaggt tdeagtg tdeatgg tdeatgg tdetgag
tdetgga tdetagg tdetagg tdetgag tdetgga tdagegt tdagetg tdagget tdaggte tdagtge tdagteg
tdaeggt tdaegtg tdaeggt tdaegtg tdaetgg tdaetgg tdagegt tdagetg tdagget tdaggte tdagtge
tdagteg tdategg tdategg tdatgeg tdatgge tdatgge tdatgeg tdtgeag tdtgega tdtgaeg tdtgage
tdtggae tdtggea tdtegag tdtegga tdteagg tdteagg tdtegag tdtegga tdtaegg tdtaegg tdtageg
tdtagge tdtagge tdtageg tdtgeag tdtgega tdtgaeg tdtgage tdtggae tdtggea ttggeda ttggead
ttggdea ttggdae ttggade ttggaed ttgegda ttgegad ttgedga ttgedag ttgeadg ttgeagd ttgdega
ttgdeag ttgdgea ttgdgae ttgdage ttgdaeg ttgaedg ttgaegd ttgadeg ttgadge ttgagde ttgaged
ttggeda ttggead ttggdea ttggdae ttggade ttggaed ttgegda ttgegad ttgedga ttgedag ttgeadg
ttgeagd ttgdega ttgdeag ttgdgea ttgdgae ttgdage ttgdaeg ttgaedg ttgaegd ttgadeg ttgadge
ttgagde ttgaged tteggda tteggad ttegdga ttegdag ttegadg ttegagd tteggda tteggad ttegdga
ttegdag ttegadg ttegagd ttedgga ttedgag ttedgga ttedgag ttedagg ttedagg tteagdg tteaggd
tteadgg tteadgg tteagdg tteaggd ttdgega ttdgeag ttdggea ttdggae ttdgage ttdgaeg ttdegga
ttdegag ttdegga ttdegag ttdeagg ttdeagg ttdgega ttdgeag ttdggea ttdggae ttdgage ttdgaeg
ttdaegg ttdaegg ttdageg ttdagge ttdagge ttdageg ttagedg ttagegd ttagdeg ttagdge ttaggde
ttagged ttaegdg ttaeggd ttaedgg ttaedgg ttaegdg ttaeggd ttadegg ttadegg ttadgeg ttadgge
ttadgge ttadgeg ttagedg ttagegd ttagdeg ttagdge ttaggde ttagged taggetd taggedt taggted
taggtde taggdte taggdet tagegtd tagegdt tagetgd tagetdg tagedtg tagedgt tagtegd tagtedg
tagtged tagtgde tagtdge tagtdeg tagdetg tagdegt tagdteg tagdtge tagdgte tagdget taggetd
taggedt taggted taggtde taggdte taggdet tagegtd tagegdt tagetgd tagetdg tagedtg tagedgt
tagtegd tagtedg tagtged tagtgde tagtdge tagtdeg tagdetg tagdegt tagdteg tagdtge tagdgte
tagdget taeggtd taeggdt taegtgd taegtdg taegdtg taegdgt taeggtd taeggdt taegtgd taegtdg
taegdtg taegdgt taetggd taetgdg taetggd taetgdg taetdgg taetdgg taedgtg taedggt taedtgg
taedtgg taedgtg taedggt tatgegd tatgedg tatgged tatggde tatgdge tatgdeg tateggd tategdg
tateggd tategdg tatedgg tatedgg tatgegd tatgedg tatgged tatggde tatgdge tatgdeg tatdegg
tatdegg tatdgeg tatdgge tatdgge tatdgeg tadgetg tadgegt tadgteg tadgtge tadggte tadgget
tadegtg tadeggt tadetgg tadetgg tadegtg tadeggt tadtegg tadtegg tadtgeg tadtgge tadtgge
tadtgeg tadgetg tadgegt tadgteg tadgtge tadggte tadgget tgagetd tgagedt tgagted tgagtde
tgagdte tgagdet tgaegtd tgaegdt tgaetgd tgaetdg tgaedtg tgaedgt tgategd tgatedg tgatged
tgatgde tgatdge tgatdeg tgadetg tgadegt tgadteg tgadtge tgadgte tgadget tggaetd tggaedt
tggated tggatde tggadte tggadet tggeatd tggeadt tggetad tggetda tggedta tggedat tggtead
tggteda tggtaed tggtade tggtdae tggtdea tggdeta tggdeat tggdtea tggdtae tggdate tggdaet
tgegatd tgegadt tgegtad tgegtda tgegdta tgegdat tgeagtd tgeagdt tgeatgd tgeatdg tgeadtg
tgeadgt tgetagd tgetadg tgetgad tgetgda tgetdga tgetdag tgedatg tgedagt tgedtag tgedtga
tgedgta tgedgat tgtgead tgtgeda tgtgaed tgtgade tgtgdae tgtgdea tgtegad tgtegda tgteagd
tgteadg tgtedag tgtedga tgtaegd tgtaedg tgtaged tgtagde tgtadge tgtadeg tgtdeag tgtdega
tgtdaeg tgtdage tgtdgae tgtdgea tgdgeta tgdgeat tgdgtea tgdgtae tgdgate tgdgaet tgdegta
tgdegat tgdetga tgdetag tgdeatg tgdeagt tgdtega tgdteag tgdtgea tgdtgae tgdtage tgdtaeg
tgdaetg tgdaegt tgdateg tgdatge tgdagte tgdaget tggaetd tggaedt tggated tggatde tggadte
tggadet tggeatd tggeadt tggetad tggetda tggedta tggedat tggtead tggteda tggtaed tggtade
tggtdae tggtdea tggdeta tggdeat tggdtea tggdtae tggdate tggdaet tgagetd tgagedt tgagted
tgagtde tgagdte tgagdet tgaegtd tgaegdt tgaetgd tgaetdg tgaedtg tgaedgt tgategd tgatedg
tgatged tgatgde tgatdge tgatdeg tgadetg tgadegt tgadteg tgadtge tgadgte tgadget tgeagtd
tgeagdt tgeatgd tgeatdg tgeadtg tgeadgt tgegatd tgegadt tgegtad tgegtda tgegdta tgegdat
tgetgad tgetgda tgetagd tgetadg tgetdag tgetdga tgedgta tgedgat tgedtga tgedtag tgedatg
tgedagt tgtaegd tgtaedg tgtaged tgtagde tgtadge tgtadeg tgteagd tgteadg tgtegad tgtegda
tgtedga tgtedag tgtgead tgtgeda tgtgaed tgtgade tgtgdae tgtgdea tgtdega tgtdeag tgtdgea
tgtdgae tgtdage tgtdaeg tgdaetg tgdaegt tgdateg tgdatge tgdagte tgdaget tgdeatg tgdeagt
tgdetag tgdetga tgdegta tgdegat tgdteag tgdtega tgdtaeg tgdtage tgdtgae tgdtgea tgdgeta
tgdgeat tgdgtea tgdgtae tgdgate tgdgaet teggatd teggadt teggtad teggtda teggdta teggdat
tegagtd tegagdt tegatgd tegatdg tegadtg tegadgt tegtagd tegtadg tegtgad tegtgda tegtdga
tegtdag tegdatg tegdagt tegdtag tegdtga tegdgta tegdgat teggatd teggadt teggtad teggtda
teggdta teggdat tegagtd tegagdt tegatgd tegatdg tegadtg tegadgt tegtagd tegtadg tegtgad
tegtgda tegtdga tegtdag tegdatg tegdagt tegdtag tegdtga tegdgta tegdgat teaggtd teaggdt
teagtgd teagtdg teagdtg teagdgt teaggtd teaggdt teagtgd teagtdg teagdtg teagdgt teatggd
teatgdg teatggd teatgdg teatdgg teatdgg teadgtg teadggt teadtgg teadtgg teadgtg teadggt
tetgagd tetgadg tetggad tetggda tetgdga tetgdag tetaggd tetagdg tetaggd tetagdg tetadgg
tetadgg tetgagd tetgadg tetggad tetggda tetgdga tetgdag tetdagg tetdagg tetdgag tetdgga
tetdgga tetdgag tedgatg tedgagt tedgtag tedgtga tedggta tedggat tedagtg tedaggt tedatgg
tedatgg tedagtg tedaggt tedtagg tedtagg tedtgag tedtgga tedtgga tedtgag tedgatg tedgagt
tedgtag tedgtga tedggta tedggat ttggead ttggeda ttggaed ttggade ttggdae ttggdea ttgegad
ttgegda ttgeagd ttgeadg ttgedag ttgedga ttgaegd ttgaedg ttgaged ttgagde ttgadge ttgadeg
ttgdeag ttgdega ttgdaeg ttgdage ttgdgae ttgdgea ttggead ttggeda ttggaed ttggade ttggdae
ttggdea ttgegad ttgegda ttgeagd ttgeadg ttgedag ttgedga ttgaegd ttgaedg ttgaged ttgagde
ttgadge ttgadeg ttgdeag ttgdega ttgdaeg ttgdage ttgdgae ttgdgea tteggad tteggda ttegagd
ttegadg ttegdag ttegdga tteggad tteggda ttegagd ttegadg ttegdag ttegdga tteaggd tteagdg
tteaggd tteagdg tteadgg tteadgg ttedgag ttedgga ttedagg ttedagg ttedgag ttedgga ttagegd
ttagedg ttagged ttaggde ttagdge ttagdeg ttaeggd ttaegdg ttaeggd ttaegdg ttaedgg ttaedgg
ttagegd ttagedg ttagged ttaggde ttagdge ttagdeg ttadegg ttadegg ttadgeg ttadgge ttadgge
ttadgeg ttdgeag ttdgega ttdgaeg ttdgage ttdggae ttdggea ttdegag ttdegga ttdeagg ttdeagg
ttdegag ttdegga ttdaegg ttdaegg ttdageg ttdagge ttdagge ttdageg ttdgeag ttdgega ttdgaeg
ttdgage ttdggae ttdggea tdggeta tdggeat tdggtea tdggtae tdggate tdggaet tdgegta tdgegat
tdgetga tdgetag tdgeatg tdgeagt tdgtega tdgteag tdgtgea tdgtgae tdgtage tdgtaeg tdgaetg
tdgaegt tdgateg tdgatge tdgagte tdgaget tdggeta tdggeat tdggtea tdggtae tdggate tdggaet
tdgegta tdgegat tdgetga tdgetag tdgeatg tdgeagt tdgtega tdgteag tdgtgea tdgtgae tdgtage
tdgtaeg tdgaetg tdgaegt tdgateg tdgatge tdgagte tdgaget tdeggta tdeggat tdegtga tdegtag
tdegatg tdegagt tdeggta tdeggat tdegtga tdegtag tdegatg tdegagt tdetgga tdetgag tdetgga
tdetgag tdetagg tdetagg tdeagtg tdeaggt tdeatgg tdeatgg tdeagtg tdeaggt tdtgega tdtgeag
tdtggea tdtggae tdtgage tdtgaeg tdtegga tdtegag tdtegga tdtegag tdteagg tdteagg tdtgega
tdtgeag tdtggea tdtggae tdtgage tdtgaeg tdtaegg tdtaegg tdtageg tdtagge tdtagge tdtageg
tdagetg tdagegt tdagteg tdagtge tdaggte tdagget tdaegtg tdaeggt tdaetgg tdaetgg tdaegtg
tdaeggt tdategg tdategg tdatgeg tdatgge tdatgge tdatgeg tdagetg tdagegt tdagteg tdagtge
tdaggte tdagget

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us