easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

habebamusque

florentine

slaska

yawed

undyeable

bachelordom

outbreeds

zhongolovich

uersavistique

curio

cohabitations

conicamus

tomales

jezil

fossores

volscisque

heterosporium

theorematic


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: cunctantique
cipher variations:
dvoduboujrvf ewpevcpvkswg fxqfwdqwltxh gyrgxerxmuyi hzshyfsynvzj
iatizgtzowak jbujahuapxbl kcvkbivbqycm ldwlcjwcrzdn mexmdkxdsaeo
nfynelyetbfp ogzofmzfucgq phapgnagvdhr qibqhobhweis rjcripcixfjt
skdsjqdjygku tletkrekzhlv umfulsflaimw vngvmtgmbjnx wohwnuhnckoy
xpixoviodlpz yqjypwjpemqa zrkzqxkqfnrb aslarylrgosc btmbszmshptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: cunctantique
Cipher: xfmxgzmgrjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: cunctantique
Cipher: AAABA BAABB ABBAA AAABA BAABA AAAAA ABBAA BAABA ABAAA ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: cunctantique
cipher variations:
dvoduboujrvfhjohgbogzxjnlxolsbospdxvplopeboefjldtzotqboqvpzlxnoxcboclvntfpofaboarhpjjdojmbomhndr
nronyboyxtrzrforkboknzfhvtovwbowdftpzhoziboitlhxewpevcpvkswgikpihcphaykomypmtcptqeywqmpqfcpfgkme
uapurcprwqamyopydcpdmwougqpgbcpbsiqkkepkncpnioesospozcpzyusasgpslcploagiwupwxcpxeguqaipajcpjumiy
fxqfwdqwltxhjlqjidqibzlpnzqnudqurfzxrnqrgdqghlnfvbqvsdqsxrbnzpqzedqenxpvhrqhcdqctjrllfqlodqojpft
ptqpadqazvtbthqtmdqmpbhjxvqxydqyfhvrbjqbkdqkvnjzgyrgxerxmuyikmrkjerjcamqoarovervsgaysorsherhimog
wcrwtertyscoaqraferfoyqwisriderduksmmgrmperpkqguqurqberbawucuirunernqcikywryzerzgiwsckrclerlwoka
hzshyfsynvzjlnslkfskdbnrpbspwfswthbztpstifsijnphxdsxufsuztdpbrsbgfsgpzrxjtsjefsevltnnhsnqfsqlrhv
rvsrcfscbxvdvjsvofsordjlzxszafsahjxtdlsdmfsmxplbiatizgtzowakmotmlgtlecosqctqxgtxuicauqtujgtjkoqi
yetyvgtvaueqcstchgthqasykutkfgtfwmuooitorgtrmsiwswtsdgtdcywewktwpgtpsekmaytabgtbikyuemtengtnyqmc
jbujahuapxblnpunmhumfdptrduryhuyvjdbvruvkhuklprjzfuzwhuwbvfrdtudihuirbtzlvulghugxnvppjupshusntjx
txutehuedzxfxluxqhuqtflnbzubchucjlzvfnufohuozrndkcvkbivbqycmoqvonivngequsevszivzwkecwsvwlivlmqsk
agvaxivxcwgseuvejivjscuamwvmhivhyowqqkvqtivtoukyuyvufivfeaygymvyrivrugmocavcdivdkmawgovgpivpasoe
ldwlcjwcrzdnprwpojwohfrvtfwtajwaxlfdxtwxmjwmnrtlbhwbyjwydxhtfvwfkjwktdvbnxwnijwizpxrrlwrujwupvlz
vzwvgjwgfbzhznwzsjwsvhnpdbwdejwelnbxhpwhqjwqbtpfmexmdkxdsaeoqsxqpkxpigswugxubkxbymgeyuxynkxnosum
cixczkxzeyiugwxglkxluewcoyxojkxjaqyssmxsvkxvqwmawaxwhkxhgcaiaoxatkxtwioqecxefkxfmocyiqxirkxrcuqg
nfynelyetbfprtyrqlyqjhtxvhyvclycznhfzvyzolyoptvndjydalyafzjvhxyhmlymvfxdpzypklykbrzttnytwlywrxnb
xbyxilyihdbjbpybulyuxjprfdyfglygnpdzjryjslysdvrhogzofmzfucgqsuzsrmzrkiuywizwdmzdaoigawzapmzpquwo
ekzebmzbgakwiyzinmznwgyeqazqlmzlcsauuozuxmzxsyocyczyjmzjieckcqzcvmzvykqsgezghmzhoqeakszktmztewsi
phapgnagvdhrtvatsnasljvzxjaxenaebpjhbxabqnaqrvxpflafcnachblxjzajonaoxhzfrbarmnamdtbvvpavynaytzpd
zdazknakjfdldradwnawzlrthfahinaiprfbltalunaufxtjqibqhobhweisuwbutobtmkwaykbyfobfcqkicybcrobrswyq
gmbgdobdicmykabkpobpyiagscbsnobneucwwqbwzobzuaqeaebaloblkgemesbexobxamsuigbijobjqsgcmubmvobvgyuk
rjcripcixfjtvxcvupcunlxbzlczgpcgdrljdzcdspcstxzrhnchepcejdnzlbclqpcqzjbhtdctopcofvdxxrcxapcavbrf
bfcbmpcmlhfnftcfypcybntvjhcjkpckrthdnvcnwpcwhzvlskdsjqdjygkuwydwvqdvomycamdahqdhesmkeadetqdtuyas
iodifqdfkeoamcdmrqdrakciuedupqdpgweyysdybqdbwcsgcgdcnqdnmigogudgzqdzcouwkidklqdlsuieowdoxqdxiawm
tletkrekzhlvxzexwrewpnzdbnebireiftnlfbefureuvzbtjpejgreglfpbndensresbldjvfevqreqhxfzztezcrecxdth
dhedoreonjhphvehareadpvxljelmremtvjfpxepyreyjbxnumfulsflaimwyafyxsfxqoaecofcjsfjguomgcfgvsfvwacu
kqfkhsfhmgqcoefotsftcmekwgfwrsfriygaaufadsfdyeuieifepsfpokiqiwfibsfbeqwymkfmnsfnuwkgqyfqzsfzkcyo
vngvmtgmbjnxzbgzytgyrpbfdpgdktgkhvpnhdghwtgwxbdvlrglitginhrdpfgputgudnflxhgxstgsjzhbbvgbetgezfvj
fjgfqtgqpljrjxgjctgcfrxznlgnotgovxlhrzgratgaldzpwohwnuhnckoyachazuhzsqcgeqheluhliwqoiehixuhxycew
mshmjuhjoiseqghqvuhveogmyihytuhtkaiccwhcfuhfagwkgkhgruhrqmkskyhkduhdgsyaomhopuhpwymisahsbuhbmeaq
xpixoviodlpzbdibaviatrdhfrifmvimjxrpjfijyviyzdfxntinkvikpjtfrhirwviwfphnzjizuviulbjddxidgvigbhxl
hlihsvisrnltlzileviehtzbpnipqviqxznjtbitcvicnfbryqjypwjpemqacejcbwjbuseigsjgnwjnkysqkgjkzwjzaegy
oujolwjlqkugsijsxwjxgqioakjavwjvmckeeyjehwjhciymimjitwjtsomumajmfwjfiuacqojqrwjryaokucjudwjdogcs
zrkzqxkqfnrbdfkdcxkcvtfjhtkhoxkolztrlhklaxkabfhzpvkpmxkmrlvhtjktyxkyhrjpblkbwxkwndlffzkfixkidjzn
jnkjuxkutpnvnbkngxkgjvbdrpkrsxkszbplvdkvexkephdtaslarylrgoscegledyldwugkiulipylpmausmilmbylbcgia
qwlqnylnsmwiukluzylziskqcmlcxylxoemggalgjyljekaokolkvylvuqowoclohylhkwcesqlstyltacqmwelwfylfqieu
btmbszmshptdfhmfezmexvhljvmjqzmqnbvtnjmnczmcdhjbrxmrozmotnxjvlmvazmajtlrdnmdyzmypfnhhbmhkzmkflbp
lpmlwzmwvrpxpdmpizmilxdftrmtuzmubdrnxfmxgzmgrjfvcunctantiquegingfanfywimkwnkranrocwuoknodandeikc
synspanpuoykwmnwbanbkumseonezanzqgoiicnilanlgmcqmqnmxanxwsqyqenqjanjmyegusnuvanvcesoygnyhanhskgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: cunctantique
Cipher: phapgnagvdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: cunctantique
Cipher: 315433314411334442145451

Extended Methods:
Method #1

Plaintext: cunctantique
method variations:
hzshyfsyovzknexndlxdtaepskcsiqciyfkuxphxovhodlpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
c u n c t a n t i q u e 
3 5 3 3 4 1 3 4 4 1 5 5 
1 4 3 1 4 1 3 4 2 4 4 1 
They are then read out in rows:
353341344155143141342441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: cunctantique
Cipher: xndsdzqcdsrd

Read more ...
Method #3

Plaintext: cunctantique
method variations:
vonqdlstbyyl onqdlstbyylv nqdlstbyylvo
qdlstbyylvon dlstbyylvonq lstbyylvonqd
stbyylvonqdl tbyylvonqdls byylvonqdlst
yylvonqdlstb ylvonqdlstby lvonqdlstbyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: cunctantique

first 5040 cipher variations(475687488 total)
cunctantique cunctantiqeu cunctantiuqe cunctantiueq cunctantieuq cunctantiequ cunctantqiue cunctantqieu cunctantquie
cunctantquei cunctantqeui cunctantqeiu cunctantuqie cunctantuqei cunctantuiqe cunctantuieq cunctantueiq cunctantueqi
cunctantequi cunctanteqiu cunctanteuqi cunctanteuiq cunctanteiuq cunctanteiqu cunctanitque cunctanitqeu cunctanituqe
cunctanitueq cunctaniteuq cunctanitequ cunctaniqtue cunctaniqteu cunctaniqute cunctaniquet cunctaniqeut cunctaniqetu
cunctaniuqte cunctaniuqet cunctaniutqe cunctaniuteq cunctaniuetq cunctaniueqt cunctaniequt cunctanieqtu cunctanieuqt
cunctanieutq cunctanietuq cunctanietqu cunctanqitue cunctanqiteu cunctanqiute cunctanqiuet cunctanqieut cunctanqietu
cunctanqtiue cunctanqtieu cunctanqtuie cunctanqtuei cunctanqteui cunctanqteiu cunctanqutie cunctanqutei cunctanquite
cunctanquiet cunctanqueit cunctanqueti cunctanqetui cunctanqetiu cunctanqeuti cunctanqeuit cunctanqeiut cunctanqeitu
cunctanuiqte cunctanuiqet cunctanuitqe cunctanuiteq cunctanuietq cunctanuieqt cunctanuqite cunctanuqiet cunctanuqtie
cunctanuqtei cunctanuqeti cunctanuqeit cunctanutqie cunctanutqei cunctanutiqe cunctanutieq cunctanuteiq cunctanuteqi
cunctanueqti cunctanueqit cunctanuetqi cunctanuetiq cunctanueitq cunctanueiqt cunctaneiqut cunctaneiqtu cunctaneiuqt
cunctaneiutq cunctaneituq cunctaneitqu cunctaneqiut cunctaneqitu cunctanequit cunctanequti cunctaneqtui cunctaneqtiu
cunctaneuqit cunctaneuqti cunctaneuiqt cunctaneuitq cunctaneutiq cunctaneutqi cunctanetqui cunctanetqiu cunctanetuqi
cunctanetuiq cunctanetiuq cunctanetiqu cunctatnique cunctatniqeu cunctatniuqe cunctatniueq cunctatnieuq cunctatniequ
cunctatnqiue cunctatnqieu cunctatnquie cunctatnquei cunctatnqeui cunctatnqeiu cunctatnuqie cunctatnuqei cunctatnuiqe
cunctatnuieq cunctatnueiq cunctatnueqi cunctatnequi cunctatneqiu cunctatneuqi cunctatneuiq cunctatneiuq cunctatneiqu
cunctatinque cunctatinqeu cunctatinuqe cunctatinueq cunctatineuq cunctatinequ cunctatiqnue cunctatiqneu cunctatiqune
cunctatiquen cunctatiqeun cunctatiqenu cunctatiuqne cunctatiuqen cunctatiunqe cunctatiuneq cunctatiuenq cunctatiueqn
cunctatiequn cunctatieqnu cunctatieuqn cunctatieunq cunctatienuq cunctatienqu cunctatqinue cunctatqineu cunctatqiune
cunctatqiuen cunctatqieun cunctatqienu cunctatqniue cunctatqnieu cunctatqnuie cunctatqnuei cunctatqneui cunctatqneiu
cunctatqunie cunctatqunei cunctatquine cunctatquien cunctatquein cunctatqueni cunctatqenui cunctatqeniu cunctatqeuni
cunctatqeuin cunctatqeiun cunctatqeinu cunctatuiqne cunctatuiqen cunctatuinqe cunctatuineq cunctatuienq cunctatuieqn
cunctatuqine cunctatuqien cunctatuqnie cunctatuqnei cunctatuqeni cunctatuqein cunctatunqie cunctatunqei cunctatuniqe
cunctatunieq cunctatuneiq cunctatuneqi cunctatueqni cunctatueqin cunctatuenqi cunctatueniq cunctatueinq cunctatueiqn
cunctateiqun cunctateiqnu cunctateiuqn cunctateiunq cunctateinuq cunctateinqu cunctateqiun cunctateqinu cunctatequin
cunctatequni cunctateqnui cunctateqniu cunctateuqin cunctateuqni cunctateuiqn cunctateuinq cunctateuniq cunctateunqi
cunctatenqui cunctatenqiu cunctatenuqi cunctatenuiq cunctateniuq cunctateniqu cunctaitnque cunctaitnqeu cunctaitnuqe
cunctaitnueq cunctaitneuq cunctaitnequ cunctaitqnue cunctaitqneu cunctaitqune cunctaitquen cunctaitqeun cunctaitqenu
cunctaituqne cunctaituqen cunctaitunqe cunctaituneq cunctaituenq cunctaitueqn cunctaitequn cunctaiteqnu cunctaiteuqn
cunctaiteunq cunctaitenuq cunctaitenqu cunctaintque cunctaintqeu cunctaintuqe cunctaintueq cunctainteuq cunctaintequ
cunctainqtue cunctainqteu cunctainqute cunctainquet cunctainqeut cunctainqetu cunctainuqte cunctainuqet cunctainutqe
cunctainuteq cunctainuetq cunctainueqt cunctainequt cunctaineqtu cunctaineuqt cunctaineutq cunctainetuq cunctainetqu
cunctaiqntue cunctaiqnteu cunctaiqnute cunctaiqnuet cunctaiqneut cunctaiqnetu cunctaiqtnue cunctaiqtneu cunctaiqtune
cunctaiqtuen cunctaiqteun cunctaiqtenu cunctaiqutne cunctaiquten cunctaiqunte cunctaiqunet cunctaiquent cunctaiquetn
cunctaiqetun cunctaiqetnu cunctaiqeutn cunctaiqeunt cunctaiqenut cunctaiqentu cunctaiunqte cunctaiunqet cunctaiuntqe
cunctaiunteq cunctaiunetq cunctaiuneqt cunctaiuqnte cunctaiuqnet cunctaiuqtne cunctaiuqten cunctaiuqetn cunctaiuqent
cunctaiutqne cunctaiutqen cunctaiutnqe cunctaiutneq cunctaiutenq cunctaiuteqn cunctaiueqtn cunctaiueqnt cunctaiuetqn
cunctaiuetnq cunctaiuentq cunctaiuenqt cunctaienqut cunctaienqtu cunctaienuqt cunctaienutq cunctaientuq cunctaientqu
cunctaieqnut cunctaieqntu cunctaiequnt cunctaiequtn cunctaieqtun cunctaieqtnu cunctaieuqnt cunctaieuqtn cunctaieunqt
cunctaieuntq cunctaieutnq cunctaieutqn cunctaietqun cunctaietqnu cunctaietuqn cunctaietunq cunctaietnuq cunctaietnqu
cunctaqtinue cunctaqtineu cunctaqtiune cunctaqtiuen cunctaqtieun cunctaqtienu cunctaqtniue cunctaqtnieu cunctaqtnuie
cunctaqtnuei cunctaqtneui cunctaqtneiu cunctaqtunie cunctaqtunei cunctaqtuine cunctaqtuien cunctaqtuein cunctaqtueni
cunctaqtenui cunctaqteniu cunctaqteuni cunctaqteuin cunctaqteiun cunctaqteinu cunctaqitnue cunctaqitneu cunctaqitune
cunctaqituen cunctaqiteun cunctaqitenu cunctaqintue cunctaqinteu cunctaqinute cunctaqinuet cunctaqineut cunctaqinetu
cunctaqiunte cunctaqiunet cunctaqiutne cunctaqiuten cunctaqiuetn cunctaqiuent cunctaqienut cunctaqientu cunctaqieunt
cunctaqieutn cunctaqietun cunctaqietnu cunctaqnitue cunctaqniteu cunctaqniute cunctaqniuet cunctaqnieut cunctaqnietu
cunctaqntiue cunctaqntieu cunctaqntuie cunctaqntuei cunctaqnteui cunctaqnteiu cunctaqnutie cunctaqnutei cunctaqnuite
cunctaqnuiet cunctaqnueit cunctaqnueti cunctaqnetui cunctaqnetiu cunctaqneuti cunctaqneuit cunctaqneiut cunctaqneitu
cunctaquinte cunctaquinet cunctaquitne cunctaquiten cunctaquietn cunctaquient cunctaqunite cunctaquniet cunctaquntie
cunctaquntei cunctaquneti cunctaquneit cunctaqutnie cunctaqutnei cunctaqutine cunctaqutien cunctaqutein cunctaquteni
cunctaquenti cunctaquenit cunctaquetni cunctaquetin cunctaqueitn cunctaqueint cunctaqeinut cunctaqeintu cunctaqeiunt
cunctaqeiutn cunctaqeitun cunctaqeitnu cunctaqeniut cunctaqenitu cunctaqenuit cunctaqenuti cunctaqentui cunctaqentiu
cunctaqeunit cunctaqeunti cunctaqeuint cunctaqeuitn cunctaqeutin cunctaqeutni cunctaqetnui cunctaqetniu cunctaqetuni
cunctaqetuin cunctaqetiun cunctaqetinu cunctautiqne cunctautiqen cunctautinqe cunctautineq cunctautienq cunctautieqn
cunctautqine cunctautqien cunctautqnie cunctautqnei cunctautqeni cunctautqein cunctautnqie cunctautnqei cunctautniqe
cunctautnieq cunctautneiq cunctautneqi cunctauteqni cunctauteqin cunctautenqi cunctauteniq cunctauteinq cunctauteiqn
cunctauitqne cunctauitqen cunctauitnqe cunctauitneq cunctauitenq cunctauiteqn cunctauiqtne cunctauiqten cunctauiqnte
cunctauiqnet cunctauiqent cunctauiqetn cunctauinqte cunctauinqet cunctauintqe cunctauinteq cunctauinetq cunctauineqt
cunctauieqnt cunctauieqtn cunctauienqt cunctauientq cunctauietnq cunctauietqn cunctauqitne cunctauqiten cunctauqinte
cunctauqinet cunctauqient cunctauqietn cunctauqtine cunctauqtien cunctauqtnie cunctauqtnei cunctauqteni cunctauqtein
cunctauqntie cunctauqntei cunctauqnite cunctauqniet cunctauqneit cunctauqneti cunctauqetni cunctauqetin cunctauqenti
cunctauqenit cunctauqeint cunctauqeitn cunctauniqte cunctauniqet cunctaunitqe cunctauniteq cunctaunietq cunctaunieqt
cunctaunqite cunctaunqiet cunctaunqtie cunctaunqtei cunctaunqeti cunctaunqeit cunctauntqie cunctauntqei cunctauntiqe
cunctauntieq cunctaunteiq cunctaunteqi cunctauneqti cunctauneqit cunctaunetqi cunctaunetiq cunctauneitq cunctauneiqt
cunctaueiqnt cunctaueiqtn cunctaueinqt cunctaueintq cunctaueitnq cunctaueitqn cunctaueqint cunctaueqitn cunctaueqnit
cunctaueqnti cunctaueqtni cunctaueqtin cunctauenqit cunctauenqti cunctaueniqt cunctauenitq cunctauentiq cunctauentqi
cunctauetqni cunctauetqin cunctauetnqi cunctauetniq cunctauetinq cunctauetiqn cunctaetiqun cunctaetiqnu cunctaetiuqn
cunctaetiunq cunctaetinuq cunctaetinqu cunctaetqiun cunctaetqinu cunctaetquin cunctaetquni cunctaetqnui cunctaetqniu
cunctaetuqin cunctaetuqni cunctaetuiqn cunctaetuinq cunctaetuniq cunctaetunqi cunctaetnqui cunctaetnqiu cunctaetnuqi
cunctaetnuiq cunctaetniuq cunctaetniqu cunctaeitqun cunctaeitqnu cunctaeituqn cunctaeitunq cunctaeitnuq cunctaeitnqu
cunctaeiqtun cunctaeiqtnu cunctaeiqutn cunctaeiqunt cunctaeiqnut cunctaeiqntu cunctaeiuqtn cunctaeiuqnt cunctaeiutqn
cunctaeiutnq cunctaeiuntq cunctaeiunqt cunctaeinqut cunctaeinqtu cunctaeinuqt cunctaeinutq cunctaeintuq cunctaeintqu
cunctaeqitun cunctaeqitnu cunctaeqiutn cunctaeqiunt cunctaeqinut cunctaeqintu cunctaeqtiun cunctaeqtinu cunctaeqtuin
cunctaeqtuni cunctaeqtnui cunctaeqtniu cunctaequtin cunctaequtni cunctaequitn cunctaequint cunctaequnit cunctaequnti
cunctaeqntui cunctaeqntiu cunctaeqnuti cunctaeqnuit cunctaeqniut cunctaeqnitu cunctaeuiqtn cunctaeuiqnt cunctaeuitqn
cunctaeuitnq cunctaeuintq cunctaeuinqt cunctaeuqitn cunctaeuqint cunctaeuqtin cunctaeuqtni cunctaeuqnti cunctaeuqnit
cunctaeutqin cunctaeutqni cunctaeutiqn cunctaeutinq cunctaeutniq cunctaeutnqi cunctaeunqti cunctaeunqit cunctaeuntqi
cunctaeuntiq cunctaeunitq cunctaeuniqt cunctaeniqut cunctaeniqtu cunctaeniuqt cunctaeniutq cunctaenituq cunctaenitqu
cunctaenqiut cunctaenqitu cunctaenquit cunctaenquti cunctaenqtui cunctaenqtiu cunctaenuqit cunctaenuqti cunctaenuiqt
cunctaenuitq cunctaenutiq cunctaenutqi cunctaentqui cunctaentqiu cunctaentuqi cunctaentuiq cunctaentiuq cunctaentiqu
cunctnatique cunctnatiqeu cunctnatiuqe cunctnatiueq cunctnatieuq cunctnatiequ cunctnatqiue cunctnatqieu cunctnatquie
cunctnatquei cunctnatqeui cunctnatqeiu cunctnatuqie cunctnatuqei cunctnatuiqe cunctnatuieq cunctnatueiq cunctnatueqi
cunctnatequi cunctnateqiu cunctnateuqi cunctnateuiq cunctnateiuq cunctnateiqu cunctnaitque cunctnaitqeu cunctnaituqe
cunctnaitueq cunctnaiteuq cunctnaitequ cunctnaiqtue cunctnaiqteu cunctnaiqute cunctnaiquet cunctnaiqeut cunctnaiqetu
cunctnaiuqte cunctnaiuqet cunctnaiutqe cunctnaiuteq cunctnaiuetq cunctnaiueqt cunctnaiequt cunctnaieqtu cunctnaieuqt
cunctnaieutq cunctnaietuq cunctnaietqu cunctnaqitue cunctnaqiteu cunctnaqiute cunctnaqiuet cunctnaqieut cunctnaqietu
cunctnaqtiue cunctnaqtieu cunctnaqtuie cunctnaqtuei cunctnaqteui cunctnaqteiu cunctnaqutie cunctnaqutei cunctnaquite
cunctnaquiet cunctnaqueit cunctnaqueti cunctnaqetui cunctnaqetiu cunctnaqeuti cunctnaqeuit cunctnaqeiut cunctnaqeitu
cunctnauiqte cunctnauiqet cunctnauitqe cunctnauiteq cunctnauietq cunctnauieqt cunctnauqite cunctnauqiet cunctnauqtie
cunctnauqtei cunctnauqeti cunctnauqeit cunctnautqie cunctnautqei cunctnautiqe cunctnautieq cunctnauteiq cunctnauteqi
cunctnaueqti cunctnaueqit cunctnauetqi cunctnauetiq cunctnaueitq cunctnaueiqt cunctnaeiqut cunctnaeiqtu cunctnaeiuqt
cunctnaeiutq cunctnaeituq cunctnaeitqu cunctnaeqiut cunctnaeqitu cunctnaequit cunctnaequti cunctnaeqtui cunctnaeqtiu
cunctnaeuqit cunctnaeuqti cunctnaeuiqt cunctnaeuitq cunctnaeutiq cunctnaeutqi cunctnaetqui cunctnaetqiu cunctnaetuqi
cunctnaetuiq cunctnaetiuq cunctnaetiqu cunctntaique cunctntaiqeu cunctntaiuqe cunctntaiueq cunctntaieuq cunctntaiequ
cunctntaqiue cunctntaqieu cunctntaquie cunctntaquei cunctntaqeui cunctntaqeiu cunctntauqie cunctntauqei cunctntauiqe
cunctntauieq cunctntaueiq cunctntaueqi cunctntaequi cunctntaeqiu cunctntaeuqi cunctntaeuiq cunctntaeiuq cunctntaeiqu
cunctntiaque cunctntiaqeu cunctntiauqe cunctntiaueq cunctntiaeuq cunctntiaequ cunctntiqaue cunctntiqaeu cunctntiquae
cunctntiquea cunctntiqeua cunctntiqeau cunctntiuqae cunctntiuqea cunctntiuaqe cunctntiuaeq cunctntiueaq cunctntiueqa
cunctntiequa cunctntieqau cunctntieuqa cunctntieuaq cunctntieauq cunctntieaqu cunctntqiaue cunctntqiaeu cunctntqiuae
cunctntqiuea cunctntqieua cunctntqieau cunctntqaiue cunctntqaieu cunctntqauie cunctntqauei cunctntqaeui cunctntqaeiu
cunctntquaie cunctntquaei cunctntquiae cunctntquiea cunctntqueia cunctntqueai cunctntqeaui cunctntqeaiu cunctntqeuai
cunctntqeuia cunctntqeiua cunctntqeiau cunctntuiqae cunctntuiqea cunctntuiaqe cunctntuiaeq cunctntuieaq cunctntuieqa
cunctntuqiae cunctntuqiea cunctntuqaie cunctntuqaei cunctntuqeai cunctntuqeia cunctntuaqie cunctntuaqei cunctntuaiqe
cunctntuaieq cunctntuaeiq cunctntuaeqi cunctntueqai cunctntueqia cunctntueaqi cunctntueaiq cunctntueiaq cunctntueiqa
cunctnteiqua cunctnteiqau cunctnteiuqa cunctnteiuaq cunctnteiauq cunctnteiaqu cunctnteqiua cunctnteqiau cunctntequia
cunctntequai cunctnteqaui cunctnteqaiu cunctnteuqia cunctnteuqai cunctnteuiqa cunctnteuiaq cunctnteuaiq cunctnteuaqi
cunctnteaqui cunctnteaqiu cunctnteauqi cunctnteauiq cunctnteaiuq cunctnteaiqu cunctnitaque cunctnitaqeu cunctnitauqe
cunctnitaueq cunctnitaeuq cunctnitaequ cunctnitqaue cunctnitqaeu cunctnitquae cunctnitquea cunctnitqeua cunctnitqeau
cunctnituqae cunctnituqea cunctnituaqe cunctnituaeq cunctnitueaq cunctnitueqa cunctnitequa cunctniteqau cunctniteuqa
cunctniteuaq cunctniteauq cunctniteaqu cunctniatque cunctniatqeu cunctniatuqe cunctniatueq cunctniateuq cunctniatequ
cunctniaqtue cunctniaqteu cunctniaqute cunctniaquet cunctniaqeut cunctniaqetu cunctniauqte cunctniauqet cunctniautqe
cunctniauteq cunctniauetq cunctniaueqt cunctniaequt cunctniaeqtu cunctniaeuqt cunctniaeutq cunctniaetuq cunctniaetqu
cunctniqatue cunctniqateu cunctniqaute cunctniqauet cunctniqaeut cunctniqaetu cunctniqtaue cunctniqtaeu cunctniqtuae
cunctniqtuea cunctniqteua cunctniqteau cunctniqutae cunctniqutea cunctniquate cunctniquaet cunctniqueat cunctniqueta
cunctniqetua cunctniqetau cunctniqeuta cunctniqeuat cunctniqeaut cunctniqeatu cunctniuaqte cunctniuaqet cunctniuatqe
cunctniuateq cunctniuaetq cunctniuaeqt cunctniuqate cunctniuqaet cunctniuqtae cunctniuqtea cunctniuqeta cunctniuqeat
cunctniutqae cunctniutqea cunctniutaqe cunctniutaeq cunctniuteaq cunctniuteqa cunctniueqta cunctniueqat cunctniuetqa
cunctniuetaq cunctniueatq cunctniueaqt cunctnieaqut cunctnieaqtu cunctnieauqt cunctnieautq cunctnieatuq cunctnieatqu
cunctnieqaut cunctnieqatu cunctniequat cunctniequta cunctnieqtua cunctnieqtau cunctnieuqat cunctnieuqta cunctnieuaqt
cunctnieuatq cunctnieutaq cunctnieutqa cunctnietqua cunctnietqau cunctnietuqa cunctnietuaq cunctnietauq cunctnietaqu
cunctnqtiaue cunctnqtiaeu cunctnqtiuae cunctnqtiuea cunctnqtieua cunctnqtieau cunctnqtaiue cunctnqtaieu cunctnqtauie
cunctnqtauei cunctnqtaeui cunctnqtaeiu cunctnqtuaie cunctnqtuaei cunctnqtuiae cunctnqtuiea cunctnqtueia cunctnqtueai
cunctnqteaui cunctnqteaiu cunctnqteuai cunctnqteuia cunctnqteiua cunctnqteiau cunctnqitaue cunctnqitaeu cunctnqituae
cunctnqituea cunctnqiteua cunctnqiteau cunctnqiatue cunctnqiateu cunctnqiaute cunctnqiauet cunctnqiaeut cunctnqiaetu
cunctnqiuate cunctnqiuaet cunctnqiutae cunctnqiutea cunctnqiueta cunctnqiueat cunctnqieaut cunctnqieatu cunctnqieuat
cunctnqieuta cunctnqietua cunctnqietau cunctnqaitue cunctnqaiteu cunctnqaiute cunctnqaiuet cunctnqaieut cunctnqaietu
cunctnqatiue cunctnqatieu cunctnqatuie cunctnqatuei cunctnqateui cunctnqateiu cunctnqautie cunctnqautei cunctnqauite
cunctnqauiet cunctnqaueit cunctnqaueti cunctnqaetui cunctnqaetiu cunctnqaeuti cunctnqaeuit cunctnqaeiut cunctnqaeitu
cunctnquiate cunctnquiaet cunctnquitae cunctnquitea cunctnquieta cunctnquieat cunctnquaite cunctnquaiet cunctnquatie
cunctnquatei cunctnquaeti cunctnquaeit cunctnqutaie cunctnqutaei cunctnqutiae cunctnqutiea cunctnquteia cunctnquteai
cunctnqueati cunctnqueait cunctnquetai cunctnquetia cunctnqueita cunctnqueiat cunctnqeiaut cunctnqeiatu cunctnqeiuat
cunctnqeiuta cunctnqeitua cunctnqeitau cunctnqeaiut cunctnqeaitu cunctnqeauit cunctnqeauti cunctnqeatui cunctnqeatiu
cunctnqeuait cunctnqeuati cunctnqeuiat cunctnqeuita cunctnqeutia cunctnqeutai cunctnqetaui cunctnqetaiu cunctnqetuai
cunctnqetuia cunctnqetiua cunctnqetiau cunctnutiqae cunctnutiqea cunctnutiaqe cunctnutiaeq cunctnutieaq cunctnutieqa
cunctnutqiae cunctnutqiea cunctnutqaie cunctnutqaei cunctnutqeai cunctnutqeia cunctnutaqie cunctnutaqei cunctnutaiqe
cunctnutaieq cunctnutaeiq cunctnutaeqi cunctnuteqai cunctnuteqia cunctnuteaqi cunctnuteaiq cunctnuteiaq cunctnuteiqa
cunctnuitqae cunctnuitqea cunctnuitaqe cunctnuitaeq cunctnuiteaq cunctnuiteqa cunctnuiqtae cunctnuiqtea cunctnuiqate
cunctnuiqaet cunctnuiqeat cunctnuiqeta cunctnuiaqte cunctnuiaqet cunctnuiatqe cunctnuiateq cunctnuiaetq cunctnuiaeqt
cunctnuieqat cunctnuieqta cunctnuieaqt cunctnuieatq cunctnuietaq cunctnuietqa cunctnuqitae cunctnuqitea cunctnuqiate
cunctnuqiaet cunctnuqieat cunctnuqieta cunctnuqtiae cunctnuqtiea cunctnuqtaie cunctnuqtaei cunctnuqteai cunctnuqteia
cunctnuqatie cunctnuqatei cunctnuqaite cunctnuqaiet cunctnuqaeit cunctnuqaeti cunctnuqetai cunctnuqetia cunctnuqeati
cunctnuqeait cunctnuqeiat cunctnuqeita cunctnuaiqte cunctnuaiqet cunctnuaitqe cunctnuaiteq cunctnuaietq cunctnuaieqt
cunctnuaqite cunctnuaqiet cunctnuaqtie cunctnuaqtei cunctnuaqeti cunctnuaqeit cunctnuatqie cunctnuatqei cunctnuatiqe
cunctnuatieq cunctnuateiq cunctnuateqi cunctnuaeqti cunctnuaeqit cunctnuaetqi cunctnuaetiq cunctnuaeitq cunctnuaeiqt
cunctnueiqat cunctnueiqta cunctnueiaqt cunctnueiatq cunctnueitaq cunctnueitqa cunctnueqiat cunctnueqita cunctnueqait
cunctnueqati cunctnueqtai cunctnueqtia cunctnueaqit cunctnueaqti cunctnueaiqt cunctnueaitq cunctnueatiq cunctnueatqi
cunctnuetqai cunctnuetqia cunctnuetaqi cunctnuetaiq cunctnuetiaq cunctnuetiqa cunctnetiqua cunctnetiqau cunctnetiuqa
cunctnetiuaq cunctnetiauq cunctnetiaqu cunctnetqiua cunctnetqiau cunctnetquia cunctnetquai cunctnetqaui cunctnetqaiu
cunctnetuqia cunctnetuqai cunctnetuiqa cunctnetuiaq cunctnetuaiq cunctnetuaqi cunctnetaqui cunctnetaqiu cunctnetauqi
cunctnetauiq cunctnetaiuq cunctnetaiqu cunctneitqua cunctneitqau cunctneituqa cunctneituaq cunctneitauq cunctneitaqu
cunctneiqtua cunctneiqtau cunctneiquta cunctneiquat cunctneiqaut cunctneiqatu cunctneiuqta cunctneiuqat cunctneiutqa
cunctneiutaq cunctneiuatq cunctneiuaqt cunctneiaqut cunctneiaqtu cunctneiauqt cunctneiautq cunctneiatuq cunctneiatqu
cunctneqitua cunctneqitau cunctneqiuta cunctneqiuat cunctneqiaut cunctneqiatu cunctneqtiua cunctneqtiau cunctneqtuia
cunctneqtuai cunctneqtaui cunctneqtaiu cunctnequtia cunctnequtai cunctnequita cunctnequiat cunctnequait cunctnequati
cunctneqatui cunctneqatiu cunctneqauti cunctneqauit cunctneqaiut cunctneqaitu cunctneuiqta cunctneuiqat cunctneuitqa
cunctneuitaq cunctneuiatq cunctneuiaqt cunctneuqita cunctneuqiat cunctneuqtia cunctneuqtai cunctneuqati cunctneuqait
cunctneutqia cunctneutqai cunctneutiqa cunctneutiaq cunctneutaiq cunctneutaqi cunctneuaqti cunctneuaqit cunctneuatqi
cunctneuatiq cunctneuaitq cunctneuaiqt cunctneaiqut cunctneaiqtu cunctneaiuqt cunctneaiutq cunctneaituq cunctneaitqu
cunctneaqiut cunctneaqitu cunctneaquit cunctneaquti cunctneaqtui cunctneaqtiu cunctneauqit cunctneauqti cunctneauiqt
cunctneauitq cunctneautiq cunctneautqi cunctneatqui cunctneatqiu cunctneatuqi cunctneatuiq cunctneatiuq cunctneatiqu
cuncttnaique cuncttnaiqeu cuncttnaiuqe cuncttnaiueq cuncttnaieuq cuncttnaiequ cuncttnaqiue cuncttnaqieu cuncttnaquie
cuncttnaquei cuncttnaqeui cuncttnaqeiu cuncttnauqie cuncttnauqei cuncttnauiqe cuncttnauieq cuncttnaueiq cuncttnaueqi
cuncttnaequi cuncttnaeqiu cuncttnaeuqi cuncttnaeuiq cuncttnaeiuq cuncttnaeiqu cuncttniaque cuncttniaqeu cuncttniauqe
cuncttniaueq cuncttniaeuq cuncttniaequ cuncttniqaue cuncttniqaeu cuncttniquae cuncttniquea cuncttniqeua cuncttniqeau
cuncttniuqae cuncttniuqea cuncttniuaqe cuncttniuaeq cuncttniueaq cuncttniueqa cuncttniequa cuncttnieqau cuncttnieuqa
cuncttnieuaq cuncttnieauq cuncttnieaqu cuncttnqiaue cuncttnqiaeu cuncttnqiuae cuncttnqiuea cuncttnqieua cuncttnqieau
cuncttnqaiue cuncttnqaieu cuncttnqauie cuncttnqauei cuncttnqaeui cuncttnqaeiu cuncttnquaie cuncttnquaei cuncttnquiae
cuncttnquiea cuncttnqueia cuncttnqueai cuncttnqeaui cuncttnqeaiu cuncttnqeuai cuncttnqeuia cuncttnqeiua cuncttnqeiau
cuncttnuiqae cuncttnuiqea cuncttnuiaqe cuncttnuiaeq cuncttnuieaq cuncttnuieqa cuncttnuqiae cuncttnuqiea cuncttnuqaie
cuncttnuqaei cuncttnuqeai cuncttnuqeia cuncttnuaqie cuncttnuaqei cuncttnuaiqe cuncttnuaieq cuncttnuaeiq cuncttnuaeqi
cuncttnueqai cuncttnueqia cuncttnueaqi cuncttnueaiq cuncttnueiaq cuncttnueiqa cuncttneiqua cuncttneiqau cuncttneiuqa
cuncttneiuaq cuncttneiauq cuncttneiaqu cuncttneqiua cuncttneqiau cuncttnequia cuncttnequai cuncttneqaui cuncttneqaiu
cuncttneuqia cuncttneuqai cuncttneuiqa cuncttneuiaq cuncttneuaiq cuncttneuaqi cuncttneaqui cuncttneaqiu cuncttneauqi
cuncttneauiq cuncttneaiuq cuncttneaiqu cuncttanique cuncttaniqeu cuncttaniuqe cuncttaniueq cuncttanieuq cuncttaniequ
cuncttanqiue cuncttanqieu cuncttanquie cuncttanquei cuncttanqeui cuncttanqeiu cuncttanuqie cuncttanuqei cuncttanuiqe
cuncttanuieq cuncttanueiq cuncttanueqi cuncttanequi cuncttaneqiu cuncttaneuqi cuncttaneuiq cuncttaneiuq cuncttaneiqu
cuncttainque cuncttainqeu cuncttainuqe cuncttainueq cuncttaineuq cuncttainequ cuncttaiqnue cuncttaiqneu cuncttaiqune
cuncttaiquen cuncttaiqeun cuncttaiqenu cuncttaiuqne cuncttaiuqen cuncttaiunqe cuncttaiuneq cuncttaiuenq cuncttaiueqn
cuncttaiequn cuncttaieqnu cuncttaieuqn cuncttaieunq cuncttaienuq cuncttaienqu cuncttaqinue cuncttaqineu cuncttaqiune
cuncttaqiuen cuncttaqieun cuncttaqienu cuncttaqniue cuncttaqnieu cuncttaqnuie cuncttaqnuei cuncttaqneui cuncttaqneiu
cuncttaqunie cuncttaqunei cuncttaquine cuncttaquien cuncttaquein cuncttaqueni cuncttaqenui cuncttaqeniu cuncttaqeuni
cuncttaqeuin cuncttaqeiun cuncttaqeinu cuncttauiqne cuncttauiqen cuncttauinqe cuncttauineq cuncttauienq cuncttauieqn
cuncttauqine cuncttauqien cuncttauqnie cuncttauqnei cuncttauqeni cuncttauqein cuncttaunqie cuncttaunqei cuncttauniqe
cuncttaunieq cuncttauneiq cuncttauneqi cuncttaueqni cuncttaueqin cuncttauenqi cuncttaueniq cuncttaueinq cuncttaueiqn
cuncttaeiqun cuncttaeiqnu cuncttaeiuqn cuncttaeiunq cuncttaeinuq cuncttaeinqu cuncttaeqiun cuncttaeqinu cuncttaequin
cuncttaequni cuncttaeqnui cuncttaeqniu cuncttaeuqin cuncttaeuqni cuncttaeuiqn cuncttaeuinq cuncttaeuniq cuncttaeunqi
cuncttaenqui cuncttaenqiu cuncttaenuqi cuncttaenuiq cuncttaeniuq cuncttaeniqu cuncttianque cuncttianqeu cuncttianuqe
cuncttianueq cuncttianeuq cuncttianequ cuncttiaqnue cuncttiaqneu cuncttiaqune cuncttiaquen cuncttiaqeun cuncttiaqenu
cuncttiauqne cuncttiauqen cuncttiaunqe cuncttiauneq cuncttiauenq cuncttiaueqn cuncttiaequn cuncttiaeqnu cuncttiaeuqn
cuncttiaeunq cuncttiaenuq cuncttiaenqu cuncttinaque cuncttinaqeu cuncttinauqe cuncttinaueq cuncttinaeuq cuncttinaequ
cuncttinqaue cuncttinqaeu cuncttinquae cuncttinquea cuncttinqeua cuncttinqeau cuncttinuqae cuncttinuqea cuncttinuaqe
cuncttinuaeq cuncttinueaq cuncttinueqa cuncttinequa cuncttineqau cuncttineuqa cuncttineuaq cuncttineauq cuncttineaqu
cuncttiqnaue cuncttiqnaeu cuncttiqnuae cuncttiqnuea cuncttiqneua cuncttiqneau cuncttiqanue cuncttiqaneu cuncttiqaune
cuncttiqauen cuncttiqaeun cuncttiqaenu cuncttiquane cuncttiquaen cuncttiqunae cuncttiqunea cuncttiquena cuncttiquean
cuncttiqeaun cuncttiqeanu cuncttiqeuan cuncttiqeuna cuncttiqenua cuncttiqenau cuncttiunqae cuncttiunqea cuncttiunaqe
cuncttiunaeq cuncttiuneaq cuncttiuneqa cuncttiuqnae cuncttiuqnea cuncttiuqane cuncttiuqaen cuncttiuqean cuncttiuqena
cuncttiuaqne cuncttiuaqen cuncttiuanqe cuncttiuaneq cuncttiuaenq cuncttiuaeqn cuncttiueqan cuncttiueqna cuncttiueaqn
cuncttiueanq cuncttiuenaq cuncttiuenqa cuncttienqua cuncttienqau cuncttienuqa cuncttienuaq cuncttienauq cuncttienaqu
cuncttieqnua cuncttieqnau cuncttiequna cuncttiequan cuncttieqaun cuncttieqanu cuncttieuqna cuncttieuqan cuncttieunqa
cuncttieunaq cuncttieuanq cuncttieuaqn cuncttieaqun cuncttieaqnu cuncttieauqn cuncttieaunq cuncttieanuq cuncttieanqu
cuncttqainue cuncttqaineu cuncttqaiune cuncttqaiuen cuncttqaieun cuncttqaienu cuncttqaniue cuncttqanieu cuncttqanuie
cuncttqanuei cuncttqaneui cuncttqaneiu cuncttqaunie cuncttqaunei cuncttqauine cuncttqauien cuncttqauein cuncttqaueni
cuncttqaenui cuncttqaeniu cuncttqaeuni cuncttqaeuin cuncttqaeiun cuncttqaeinu cuncttqianue cuncttqianeu cuncttqiaune
cuncttqiauen cuncttqiaeun cuncttqiaenu cuncttqinaue cuncttqinaeu cuncttqinuae cuncttqinuea cuncttqineua cuncttqineau
cuncttqiunae cuncttqiunea cuncttqiuane cuncttqiuaen cuncttqiuean cuncttqiuena cuncttqienua cuncttqienau cuncttqieuna
cuncttqieuan cuncttqieaun cuncttqieanu cuncttqniaue cuncttqniaeu cuncttqniuae cuncttqniuea cuncttqnieua cuncttqnieau
cuncttqnaiue cuncttqnaieu cuncttqnauie cuncttqnauei cuncttqnaeui cuncttqnaeiu cuncttqnuaie cuncttqnuaei cuncttqnuiae
cuncttqnuiea cuncttqnueia cuncttqnueai cuncttqneaui cuncttqneaiu cuncttqneuai cuncttqneuia cuncttqneiua cuncttqneiau
cuncttquinae cuncttquinea cuncttquiane cuncttquiaen cuncttquiean cuncttquiena cuncttquniae cuncttquniea cuncttqunaie
cuncttqunaei cuncttquneai cuncttquneia cuncttquanie cuncttquanei cuncttquaine cuncttquaien cuncttquaein cuncttquaeni
cuncttquenai cuncttquenia cuncttqueani cuncttqueain cuncttqueian cuncttqueina cuncttqeinua cuncttqeinau cuncttqeiuna
cuncttqeiuan cuncttqeiaun cuncttqeianu cuncttqeniua cuncttqeniau cuncttqenuia cuncttqenuai cuncttqenaui cuncttqenaiu
cuncttqeunia cuncttqeunai cuncttqeuina cuncttqeuian cuncttqeuain cuncttqeuani cuncttqeanui cuncttqeaniu cuncttqeauni
cuncttqeauin cuncttqeaiun cuncttqeainu cuncttuaiqne cuncttuaiqen cuncttuainqe cuncttuaineq cuncttuaienq cuncttuaieqn
cuncttuaqine cuncttuaqien cuncttuaqnie cuncttuaqnei cuncttuaqeni cuncttuaqein cuncttuanqie cuncttuanqei cuncttuaniqe
cuncttuanieq cuncttuaneiq cuncttuaneqi cuncttuaeqni cuncttuaeqin cuncttuaenqi cuncttuaeniq cuncttuaeinq cuncttuaeiqn
cuncttuiaqne cuncttuiaqen cuncttuianqe cuncttuianeq cuncttuiaenq cuncttuiaeqn cuncttuiqane cuncttuiqaen cuncttuiqnae
cuncttuiqnea cuncttuiqena cuncttuiqean cuncttuinqae cuncttuinqea cuncttuinaqe cuncttuinaeq cuncttuineaq cuncttuineqa
cuncttuieqna cuncttuieqan cuncttuienqa cuncttuienaq cuncttuieanq cuncttuieaqn cuncttuqiane cuncttuqiaen cuncttuqinae
cuncttuqinea cuncttuqiena cuncttuqiean cuncttuqaine cuncttuqaien cuncttuqanie cuncttuqanei cuncttuqaeni cuncttuqaein
cuncttuqnaie cuncttuqnaei cuncttuqniae cuncttuqniea cuncttuqneia cuncttuqneai cuncttuqeani cuncttuqeain cuncttuqenai
cuncttuqenia cuncttuqeina cuncttuqeian cuncttuniqae cuncttuniqea cuncttuniaqe cuncttuniaeq cuncttunieaq cuncttunieqa
cuncttunqiae cuncttunqiea cuncttunqaie cuncttunqaei cuncttunqeai cuncttunqeia cuncttunaqie cuncttunaqei cuncttunaiqe
cuncttunaieq cuncttunaeiq cuncttunaeqi cuncttuneqai cuncttuneqia cuncttuneaqi cuncttuneaiq cuncttuneiaq cuncttuneiqa
cuncttueiqna cuncttueiqan cuncttueinqa cuncttueinaq cuncttueianq cuncttueiaqn cuncttueqina cuncttueqian cuncttueqnia
cuncttueqnai cuncttueqani cuncttueqain cuncttuenqia cuncttuenqai cuncttueniqa cuncttueniaq cuncttuenaiq cuncttuenaqi
cuncttueaqni cuncttueaqin cuncttueanqi cuncttueaniq cuncttueainq cuncttueaiqn cunctteaiqun cunctteaiqnu cunctteaiuqn
cunctteaiunq cunctteainuq cunctteainqu cunctteaqiun cunctteaqinu cunctteaquin cunctteaquni cunctteaqnui cunctteaqniu
cunctteauqin cunctteauqni cunctteauiqn cunctteauinq cunctteauniq cunctteaunqi cunctteanqui cunctteanqiu cunctteanuqi
cunctteanuiq cunctteaniuq cunctteaniqu cunctteiaqun cunctteiaqnu cunctteiauqn cunctteiaunq cunctteianuq cunctteianqu
cunctteiqaun cunctteiqanu cunctteiquan cunctteiquna cunctteiqnua cunctteiqnau cunctteiuqan cunctteiuqna cunctteiuaqn
cunctteiuanq cunctteiunaq cunctteiunqa cunctteinqua cunctteinqau cunctteinuqa cunctteinuaq cunctteinauq cunctteinaqu
cunctteqiaun cunctteqianu cunctteqiuan cunctteqiuna cunctteqinua cunctteqinau cunctteqaiun cunctteqainu cunctteqauin
cunctteqauni cunctteqanui cunctteqaniu cuncttequain cuncttequani cuncttequian cuncttequina cuncttequnia cuncttequnai
cunctteqnaui cunctteqnaiu cunctteqnuai cunctteqnuia cunctteqniua cunctteqniau cunctteuiqan cunctteuiqna cunctteuiaqn
cunctteuianq cunctteuinaq cunctteuinqa cunctteuqian cunctteuqina cunctteuqain cunctteuqani cunctteuqnai cunctteuqnia
cunctteuaqin cunctteuaqni cunctteuaiqn cunctteuainq cunctteuaniq cunctteuanqi cunctteunqai cunctteunqia cunctteunaqi
cunctteunaiq cunctteuniaq cunctteuniqa cunctteniqua cunctteniqau cunctteniuqa cunctteniuaq cunctteniauq cunctteniaqu
cuncttenqiua cuncttenqiau cuncttenquia cuncttenquai cuncttenqaui cuncttenqaiu cuncttenuqia cuncttenuqai cuncttenuiqa
cuncttenuiaq cuncttenuaiq cuncttenuaqi cuncttenaqui cuncttenaqiu cuncttenauqi cuncttenauiq cuncttenaiuq cuncttenaiqu
cunctintaque cunctintaqeu cunctintauqe cunctintaueq cunctintaeuq cunctintaequ cunctintqaue cunctintqaeu cunctintquae
cunctintquea cunctintqeua cunctintqeau cunctintuqae cunctintuqea cunctintuaqe cunctintuaeq cunctintueaq cunctintueqa
cunctintequa cunctinteqau cunctinteuqa cunctinteuaq cunctinteauq cunctinteaqu cunctinatque cunctinatqeu cunctinatuqe
cunctinatueq cunctinateuq cunctinatequ cunctinaqtue cunctinaqteu cunctinaqute cunctinaquet cunctinaqeut cunctinaqetu
cunctinauqte cunctinauqet cunctinautqe cunctinauteq cunctinauetq cunctinaueqt cunctinaequt cunctinaeqtu cunctinaeuqt
cunctinaeutq cunctinaetuq cunctinaetqu cunctinqatue cunctinqateu cunctinqaute cunctinqauet cunctinqaeut cunctinqaetu
cunctinqtaue cunctinqtaeu cunctinqtuae cunctinqtuea cunctinqteua cunctinqteau cunctinqutae cunctinqutea cunctinquate
cunctinquaet cunctinqueat cunctinqueta cunctinqetua cunctinqetau cunctinqeuta cunctinqeuat cunctinqeaut cunctinqeatu
cunctinuaqte cunctinuaqet cunctinuatqe cunctinuateq cunctinuaetq cunctinuaeqt cunctinuqate cunctinuqaet cunctinuqtae
cunctinuqtea cunctinuqeta cunctinuqeat cunctinutqae cunctinutqea cunctinutaqe cunctinutaeq cunctinuteaq cunctinuteqa
cunctinueqta cunctinueqat cunctinuetqa cunctinuetaq cunctinueatq cunctinueaqt cunctineaqut cunctineaqtu cunctineauqt
cunctineautq cunctineatuq cunctineatqu cunctineqaut cunctineqatu cunctinequat cunctinequta cunctineqtua cunctineqtau
cunctineuqat cunctineuqta cunctineuaqt cunctineuatq cunctineutaq cunctineutqa cunctinetqua cunctinetqau cunctinetuqa
cunctinetuaq cunctinetauq cunctinetaqu cunctitnaque cunctitnaqeu cunctitnauqe cunctitnaueq cunctitnaeuq cunctitnaequ
cunctitnqaue cunctitnqaeu cunctitnquae cunctitnquea cunctitnqeua cunctitnqeau cunctitnuqae cunctitnuqea cunctitnuaqe
cunctitnuaeq cunctitnueaq cunctitnueqa cunctitnequa cunctitneqau cunctitneuqa cunctitneuaq cunctitneauq cunctitneaqu
cunctitanque cunctitanqeu cunctitanuqe cunctitanueq cunctitaneuq cunctitanequ cunctitaqnue cunctitaqneu cunctitaqune
cunctitaquen cunctitaqeun cunctitaqenu cunctitauqne cunctitauqen cunctitaunqe cunctitauneq cunctitauenq cunctitaueqn
cunctitaequn cunctitaeqnu cunctitaeuqn cunctitaeunq cunctitaenuq cunctitaenqu cunctitqanue cunctitqaneu cunctitqaune
cunctitqauen cunctitqaeun cunctitqaenu cunctitqnaue cunctitqnaeu cunctitqnuae cunctitqnuea cunctitqneua cunctitqneau
cunctitqunae cunctitqunea cunctitquane cunctitquaen cunctitquean cunctitquena cunctitqenua cunctitqenau cunctitqeuna
cunctitqeuan cunctitqeaun cunctitqeanu cunctituaqne cunctituaqen cunctituanqe cunctituaneq cunctituaenq cunctituaeqn
cunctituqane cunctituqaen cunctituqnae cunctituqnea cunctituqena cunctituqean cunctitunqae cunctitunqea cunctitunaqe
cunctitunaeq cunctituneaq cunctituneqa cunctitueqna cunctitueqan cunctituenqa cunctituenaq cunctitueanq cunctitueaqn
cunctiteaqun cunctiteaqnu cunctiteauqn cunctiteaunq cunctiteanuq cunctiteanqu cunctiteqaun cunctiteqanu cunctitequan
cunctitequna cunctiteqnua cunctiteqnau cunctiteuqan cunctiteuqna cunctiteuaqn cunctiteuanq cunctiteunaq cunctiteunqa
cunctitenqua cunctitenqau cunctitenuqa cunctitenuaq cunctitenauq cunctitenaqu cunctiatnque cunctiatnqeu cunctiatnuqe
cunctiatnueq cunctiatneuq cunctiatnequ cunctiatqnue cunctiatqneu cunctiatqune cunctiatquen cunctiatqeun cunctiatqenu
cunctiatuqne cunctiatuqen cunctiatunqe cunctiatuneq cunctiatuenq cunctiatueqn cunctiatequn cunctiateqnu cunctiateuqn
cunctiateunq cunctiatenuq cunctiatenqu cunctiantque cunctiantqeu cunctiantuqe cunctiantueq cunctianteuq cunctiantequ
cunctianqtue cunctianqteu cunctianqute cunctianquet cunctianqeut cunctianqetu cunctianuqte cunctianuqet cunctianutqe
cunctianuteq cunctianuetq cunctianueqt cunctianequt cunctianeqtu cunctianeuqt cunctianeutq cunctianetuq cunctianetqu
cunctiaqntue cunctiaqnteu cunctiaqnute cunctiaqnuet cunctiaqneut cunctiaqnetu cunctiaqtnue cunctiaqtneu cunctiaqtune
cunctiaqtuen cunctiaqteun cunctiaqtenu cunctiaqutne cunctiaquten cunctiaqunte cunctiaqunet cunctiaquent cunctiaquetn
cunctiaqetun cunctiaqetnu cunctiaqeutn cunctiaqeunt cunctiaqenut cunctiaqentu cunctiaunqte cunctiaunqet cunctiauntqe
cunctiaunteq cunctiaunetq cunctiauneqt cunctiauqnte cunctiauqnet cunctiauqtne cunctiauqten cunctiauqetn cunctiauqent
cunctiautqne cunctiautqen cunctiautnqe cunctiautneq cunctiautenq cunctiauteqn cunctiaueqtn cunctiaueqnt cunctiauetqn
cunctiauetnq cunctiauentq cunctiauenqt cunctiaenqut cunctiaenqtu cunctiaenuqt cunctiaenutq cunctiaentuq cunctiaentqu
cunctiaeqnut cunctiaeqntu cunctiaequnt cunctiaequtn cunctiaeqtun cunctiaeqtnu cunctiaeuqnt cunctiaeuqtn cunctiaeunqt
cunctiaeuntq cunctiaeutnq cunctiaeutqn cunctiaetqun cunctiaetqnu cunctiaetuqn cunctiaetunq cunctiaetnuq cunctiaetnqu
cunctiqtanue cunctiqtaneu cunctiqtaune cunctiqtauen cunctiqtaeun cunctiqtaenu cunctiqtnaue cunctiqtnaeu cunctiqtnuae
cunctiqtnuea cunctiqtneua cunctiqtneau cunctiqtunae cunctiqtunea cunctiqtuane cunctiqtuaen cunctiqtuean cunctiqtuena
cunctiqtenua cunctiqtenau cunctiqteuna cunctiqteuan cunctiqteaun cunctiqteanu cunctiqatnue cunctiqatneu cunctiqatune
cunctiqatuen cunctiqateun cunctiqatenu cunctiqantue cunctiqanteu cunctiqanute cunctiqanuet cunctiqaneut cunctiqanetu
cunctiqaunte cunctiqaunet cunctiqautne cunctiqauten cunctiqauetn cunctiqauent cunctiqaenut cunctiqaentu cunctiqaeunt
cunctiqaeutn cunctiqaetun cunctiqaetnu cunctiqnatue cunctiqnateu cunctiqnaute cunctiqnauet cunctiqnaeut cunctiqnaetu
cunctiqntaue cunctiqntaeu cunctiqntuae cunctiqntuea cunctiqnteua cunctiqnteau cunctiqnutae cunctiqnutea cunctiqnuate
cunctiqnuaet cunctiqnueat cunctiqnueta cunctiqnetua cunctiqnetau cunctiqneuta cunctiqneuat cunctiqneaut cunctiqneatu
cunctiquante cunctiquanet cunctiquatne cunctiquaten cunctiquaetn cunctiquaent cunctiqunate cunctiqunaet cunctiquntae
cunctiquntea cunctiquneta cunctiquneat cunctiqutnae cunctiqutnea cunctiqutane cunctiqutaen cunctiqutean cunctiqutena
cunctiquenta cunctiquenat cunctiquetna cunctiquetan cunctiqueatn cunctiqueant cunctiqeanut cunctiqeantu cunctiqeaunt
cunctiqeautn cunctiqeatun cunctiqeatnu cunctiqenaut cunctiqenatu cunctiqenuat cunctiqenuta cunctiqentua cunctiqentau
cunctiqeunat cunctiqeunta cunctiqeuant cunctiqeuatn cunctiqeutan cunctiqeutna cunctiqetnua cunctiqetnau cunctiqetuna
cunctiqetuan cunctiqetaun cunctiqetanu cunctiutaqne cunctiutaqen cunctiutanqe cunctiutaneq cunctiutaenq cunctiutaeqn
cunctiutqane cunctiutqaen cunctiutqnae cunctiutqnea cunctiutqena cunctiutqean cunctiutnqae cunctiutnqea cunctiutnaqe
cunctiutnaeq cunctiutneaq cunctiutneqa cunctiuteqna cunctiuteqan cunctiutenqa cunctiutenaq cunctiuteanq cunctiuteaqn
cunctiuatqne cunctiuatqen cunctiuatnqe cunctiuatneq cunctiuatenq cunctiuateqn cunctiuaqtne cunctiuaqten cunctiuaqnte
cunctiuaqnet cunctiuaqent cunctiuaqetn cunctiuanqte cunctiuanqet cunctiuantqe cunctiuanteq cunctiuanetq cunctiuaneqt
cunctiuaeqnt cunctiuaeqtn cunctiuaenqt cunctiuaentq cunctiuaetnq cunctiuaetqn cunctiuqatne cunctiuqaten cunctiuqante
cunctiuqanet cunctiuqaent cunctiuqaetn cunctiuqtane cunctiuqtaen cunctiuqtnae cunctiuqtnea cunctiuqtena cunctiuqtean
cunctiuqntae cunctiuqntea cunctiuqnate cunctiuqnaet cunctiuqneat cunctiuqneta cunctiuqetna cunctiuqetan cunctiuqenta
cunctiuqenat cunctiuqeant cunctiuqeatn cunctiunaqte cunctiunaqet cunctiunatqe cunctiunateq cunctiunaetq cunctiunaeqt
cunctiunqate cunctiunqaet cunctiunqtae cunctiunqtea cunctiunqeta cunctiunqeat cunctiuntqae cunctiuntqea cunctiuntaqe
cunctiuntaeq cunctiunteaq cunctiunteqa cunctiuneqta cunctiuneqat cunctiunetqa cunctiunetaq cunctiuneatq cunctiuneaqt
cunctiueaqnt cunctiueaqtn cunctiueanqt cunctiueantq cunctiueatnq cunctiueatqn cunctiueqant cunctiueqatn cunctiueqnat
cunctiueqnta cunctiueqtna cunctiueqtan cunctiuenqat cunctiuenqta cunctiuenaqt cunctiuenatq cunctiuentaq cunctiuentqa
cunctiuetqna cunctiuetqan cunctiuetnqa cunctiuetnaq cunctiuetanq cunctiuetaqn cunctietaqun cunctietaqnu cunctietauqn
cunctietaunq cunctietanuq cunctietanqu cunctietqaun cunctietqanu cunctietquan cunctietquna cunctietqnua cunctietqnau
cunctietuqan cunctietuqna cunctietuaqn cunctietuanq cunctietunaq cunctietunqa cunctietnqua cunctietnqau cunctietnuqa
cunctietnuaq cunctietnauq cunctietnaqu cunctieatqun cunctieatqnu cunctieatuqn cunctieatunq cunctieatnuq cunctieatnqu
cunctieaqtun cunctieaqtnu cunctieaqutn cunctieaqunt cunctieaqnut cunctieaqntu cunctieauqtn cunctieauqnt cunctieautqn
cunctieautnq cunctieauntq cunctieaunqt cunctieanqut cunctieanqtu cunctieanuqt cunctieanutq cunctieantuq cunctieantqu
cunctieqatun cunctieqatnu cunctieqautn cunctieqaunt cunctieqanut cunctieqantu cunctieqtaun cunctieqtanu cunctieqtuan
cunctieqtuna cunctieqtnua cunctieqtnau cunctiequtan cunctiequtna cunctiequatn cunctiequant cunctiequnat cunctiequnta
cunctieqntua cunctieqntau cunctieqnuta cunctieqnuat cunctieqnaut cunctieqnatu cunctieuaqtn cunctieuaqnt cunctieuatqn
cunctieuatnq cunctieuantq cunctieuanqt cunctieuqatn cunctieuqant cunctieuqtan cunctieuqtna cunctieuqnta cunctieuqnat
cunctieutqan cunctieutqna cunctieutaqn cunctieutanq cunctieutnaq cunctieutnqa cunctieunqta cunctieunqat cunctieuntqa
cunctieuntaq cunctieunatq cunctieunaqt cunctienaqut cunctienaqtu cunctienauqt cunctienautq cunctienatuq cunctienatqu
cunctienqaut cunctienqatu cunctienquat cunctienquta cunctienqtua cunctienqtau cunctienuqat cunctienuqta cunctienuaqt
cunctienuatq cunctienutaq cunctienutqa cunctientqua cunctientqau cunctientuqa cunctientuaq cunctientauq cunctientaqu
cunctqntiaue cunctqntiaeu cunctqntiuae cunctqntiuea cunctqntieua cunctqntieau cunctqntaiue cunctqntaieu cunctqntauie
cunctqntauei cunctqntaeui cunctqntaeiu cunctqntuaie cunctqntuaei cunctqntuiae cunctqntuiea cunctqntueia cunctqntueai
cunctqnteaui cunctqnteaiu cunctqnteuai cunctqnteuia cunctqnteiua cunctqnteiau cunctqnitaue cunctqnitaeu cunctqnituae
cunctqnituea cunctqniteua cunctqniteau cunctqniatue cunctqniateu cunctqniaute cunctqniauet cunctqniaeut cunctqniaetu
cunctqniuate cunctqniuaet cunctqniutae cunctqniutea cunctqniueta cunctqniueat cunctqnieaut cunctqnieatu cunctqnieuat
cunctqnieuta cunctqnietua cunctqnietau cunctqnaitue cunctqnaiteu cunctqnaiute cunctqnaiuet cunctqnaieut cunctqnaietu
cunctqnatiue cunctqnatieu cunctqnatuie cunctqnatuei cunctqnateui cunctqnateiu cunctqnautie cunctqnautei cunctqnauite
cunctqnauiet cunctqnaueit cunctqnaueti cunctqnaetui cunctqnaetiu cunctqnaeuti cunctqnaeuit cunctqnaeiut cunctqnaeitu
cunctqnuiate cunctqnuiaet cunctqnuitae cunctqnuitea cunctqnuieta cunctqnuieat cunctqnuaite cunctqnuaiet cunctqnuatie
cunctqnuatei cunctqnuaeti cunctqnuaeit cunctqnutaie cunctqnutaei cunctqnutiae cunctqnutiea cunctqnuteia cunctqnuteai
cunctqnueati cunctqnueait cunctqnuetai cunctqnuetia cunctqnueita cunctqnueiat cunctqneiaut cunctqneiatu cunctqneiuat
cunctqneiuta cunctqneitua cunctqneitau cunctqneaiut cunctqneaitu cunctqneauit cunctqneauti cunctqneatui cunctqneatiu
cunctqneuait cunctqneuati cunctqneuiat cunctqneuita cunctqneutia cunctqneutai cunctqnetaui cunctqnetaiu cunctqnetuai
cunctqnetuia cunctqnetiua cunctqnetiau cunctqtniaue cunctqtniaeu cunctqtniuae cunctqtniuea cunctqtnieua cunctqtnieau
cunctqtnaiue cunctqtnaieu cunctqtnauie cunctqtnauei cunctqtnaeui cunctqtnaeiu cunctqtnuaie cunctqtnuaei cunctqtnuiae
cunctqtnuiea cunctqtnueia cunctqtnueai cunctqtneaui cunctqtneaiu cunctqtneuai cunctqtneuia cunctqtneiua cunctqtneiau
cunctqtinaue cunctqtinaeu cunctqtinuae cunctqtinuea cunctqtineua cunctqtineau cunctqtianue cunctqtianeu cunctqtiaune
cunctqtiauen cunctqtiaeun cunctqtiaenu cunctqtiuane cunctqtiuaen cunctqtiunae cunctqtiunea cunctqtiuena cunctqtiuean
cunctqtieaun cunctqtieanu cunctqtieuan cunctqtieuna cunctqtienua cunctqtienau cunctqtainue cunctqtaineu cunctqtaiune
cunctqtaiuen cunctqtaieun cunctqtaienu cunctqtaniue cunctqtanieu cunctqtanuie cunctqtanuei cunctqtaneui cunctqtaneiu
cunctqtaunie cunctqtaunei cunctqtauine cunctqtauien cunctqtauein cunctqtaueni cunctqtaenui cunctqtaeniu cunctqtaeuni
cunctqtaeuin cunctqtaeiun cunctqtaeinu cunctqtuiane cunctqtuiaen cunctqtuinae cunctqtuinea cunctqtuiena cunctqtuiean
cunctqtuaine cunctqtuaien cunctqtuanie cunctqtuanei cunctqtuaeni cunctqtuaein cunctqtunaie cunctqtunaei cunctqtuniae
cunctqtuniea cunctqtuneia cunctqtuneai cunctqtueani cunctqtueain cunctqtuenai cunctqtuenia cunctqtueina cunctqtueian
cunctqteiaun cunctqteianu cunctqteiuan cunctqteiuna cunctqteinua cunctqteinau cunctqteaiun cunctqteainu cunctqteauin
cunctqteauni cunctqteanui cunctqteaniu cunctqteuain cunctqteuani cunctqteuian cunctqteuina cunctqteunia cunctqteunai
cunctqtenaui cunctqtenaiu cunctqtenuai cunctqtenuia cunctqteniua cunctqteniau cunctqitnaue cunctqitnaeu cunctqitnuae
cunctqitnuea cunctqitneua cunctqitneau cunctqitanue cunctqitaneu cunctqitaune cunctqitauen cunctqitaeun cunctqitaenu
cunctqituane cunctqituaen cunctqitunae cunctqitunea cunctqituena cunctqituean cunctqiteaun cunctqiteanu cunctqiteuan
cunctqiteuna cunctqitenua cunctqitenau cunctqintaue cunctqintaeu cunctqintuae cunctqintuea cunctqinteua cunctqinteau
cunctqinatue cunctqinateu cunctqinaute cunctqinauet cunctqinaeut cunctqinaetu cunctqinuate cunctqinuaet cunctqinutae
cunctqinutea cunctqinueta cunctqinueat cunctqineaut cunctqineatu cunctqineuat cunctqineuta cunctqinetua cunctqinetau
cunctqiantue cunctqianteu cunctqianute cunctqianuet cunctqianeut cunctqianetu cunctqiatnue cunctqiatneu cunctqiatune
cunctqiatuen cunctqiateun cunctqiatenu cunctqiautne cunctqiauten cunctqiaunte cunctqiaunet cunctqiauent cunctqiauetn
cunctqiaetun cunctqiaetnu cunctqiaeutn cunctqiaeunt cunctqiaenut cunctqiaentu cunctqiunate cunctqiunaet cunctqiuntae
cunctqiuntea cunctqiuneta cunctqiuneat cunctqiuante cunctqiuanet cunctqiuatne cunctqiuaten cunctqiuaetn cunctqiuaent
cunctqiutane cunctqiutaen cunctqiutnae cunctqiutnea cunctqiutena cunctqiutean cunctqiueatn cunctqiueant cunctqiuetan
cunctqiuetna cunctqiuenta cunctqiuenat cunctqienaut cunctqienatu cunctqienuat cunctqienuta cunctqientua cunctqientau
cunctqieanut cunctqieantu cunctqieaunt cunctqieautn cunctqieatun cunctqieatnu cunctqieuant cunctqieuatn cunctqieunat
cunctqieunta cunctqieutna cunctqieutan cunctqietaun cunctqietanu cunctqietuan cunctqietuna cunctqietnua cunctqietnau
cunctqatinue cunctqatineu cunctqatiune cunctqatiuen cunctqatieun cunctqatienu cunctqatniue cunctqatnieu cunctqatnuie
cunctqatnuei cunctqatneui cunctqatneiu cunctqatunie cunctqatunei cunctqatuine cunctqatuien cunctqatuein cunctqatueni
cunctqatenui cunctqateniu cunctqateuni cunctqateuin cunctqateiun cunctqateinu cunctqaitnue cunctqaitneu cunctqaitune
cunctqaituen cunctqaiteun cunctqaitenu cunctqaintue cunctqainteu cunctqainute cunctqainuet cunctqaineut cunctqainetu
cunctqaiunte cunctqaiunet cunctqaiutne cunctqaiuten cunctqaiuetn cunctqaiuent cunctqaienut cunctqaientu cunctqaieunt
cunctqaieutn cunctqaietun cunctqaietnu cunctqanitue cunctqaniteu cunctqaniute cunctqaniuet cunctqanieut cunctqanietu
cunctqantiue cunctqantieu cunctqantuie cunctqantuei cunctqanteui cunctqanteiu cunctqanutie cunctqanutei cunctqanuite
cunctqanuiet cunctqanueit cunctqanueti cunctqanetui cunctqanetiu cunctqaneuti cunctqaneuit cunctqaneiut cunctqaneitu
cunctqauinte cunctqauinet cunctqauitne cunctqauiten cunctqauietn cunctqauient cunctqaunite cunctqauniet cunctqauntie
cunctqauntei cunctqauneti cunctqauneit cunctqautnie cunctqautnei cunctqautine cunctqautien cunctqautein cunctqauteni
cunctqauenti cunctqauenit cunctqauetni cunctqauetin cunctqaueitn cunctqaueint cunctqaeinut cunctqaeintu cunctqaeiunt
cunctqaeiutn cunctqaeitun cunctqaeitnu cunctqaeniut cunctqaenitu cunctqaenuit cunctqaenuti cunctqaentui cunctqaentiu
cunctqaeunit cunctqaeunti cunctqaeuint cunctqaeuitn cunctqaeutin cunctqaeutni cunctqaetnui cunctqaetniu cunctqaetuni
cunctqaetuin cunctqaetiun cunctqaetinu cunctqutiane cunctqutiaen cunctqutinae cunctqutinea cunctqutiena cunctqutiean
cunctqutaine cunctqutaien cunctqutanie cunctqutanei cunctqutaeni cunctqutaein cunctqutnaie cunctqutnaei cunctqutniae
cunctqutniea cunctqutneia cunctqutneai cunctquteani cunctquteain cunctqutenai cunctqutenia cunctquteina cunctquteian
cunctquitane cunctquitaen cunctquitnae cunctquitnea cunctquitena cunctquitean cunctquiatne cunctquiaten cunctquiante
cunctquianet cunctquiaent cunctquiaetn cunctquinate cunctquinaet cunctquintae cunctquintea cunctquineta cunctquineat
cunctquieant cunctquieatn cunctquienat cunctquienta cunctquietna cunctquietan cunctquaitne cunctquaiten cunctquainte
cunctquainet cunctquaient cunctquaietn cunctquatine cunctquatien cunctquatnie cunctquatnei cunctquateni cunctquatein
cunctquantie cunctquantei cunctquanite cunctquaniet cunctquaneit cunctquaneti cunctquaetni cunctquaetin cunctquaenti
cunctquaenit cunctquaeint cunctquaeitn cunctquniate cunctquniaet cunctqunitae cunctqunitea cunctqunieta cunctqunieat
cunctqunaite cunctqunaiet cunctqunatie cunctqunatei cunctqunaeti cunctqunaeit cunctquntaie cunctquntaei cunctquntiae
cunctquntiea cunctqunteia cunctqunteai cunctquneati cunctquneait cunctqunetai cunctqunetia cunctquneita cunctquneiat
cunctqueiant cunctqueiatn cunctqueinat cunctqueinta cunctqueitna cunctqueitan cunctqueaint cunctqueaitn cunctqueanit
cunctqueanti cunctqueatni cunctqueatin cunctquenait cunctquenati cunctqueniat cunctquenita cunctquentia cunctquentai
cunctquetani cunctquetain cunctquetnai cunctquetnia cunctquetina cunctquetian cunctqetiaun cunctqetianu cunctqetiuan
cunctqetiuna cunctqetinua cunctqetinau cunctqetaiun cunctqetainu cunctqetauin cunctqetauni cunctqetanui cunctqetaniu
cunctqetuain cunctqetuani cunctqetuian cunctqetuina cunctqetunia cunctqetunai cunctqetnaui cunctqetnaiu cunctqetnuai
cunctqetnuia cunctqetniua cunctqetniau cunctqeitaun cunctqeitanu cunctqeituan cunctqeituna cunctqeitnua cunctqeitnau
cunctqeiatun cunctqeiatnu cunctqeiautn cunctqeiaunt cunctqeianut cunctqeiantu cunctqeiuatn cunctqeiuant cunctqeiutan
cunctqeiutna cunctqeiunta cunctqeiunat cunctqeinaut cunctqeinatu cunctqeinuat cunctqeinuta cunctqeintua cunctqeintau
cunctqeaitun cunctqeaitnu cunctqeaiutn cunctqeaiunt cunctqeainut cunctqeaintu cunctqeatiun cunctqeatinu cunctqeatuin
cunctqeatuni cunctqeatnui cunctqeatniu cunctqeautin cunctqeautni cunctqeauitn cunctqeauint cunctqeaunit cunctqeaunti
cunctqeantui cunctqeantiu cunctqeanuti cunctqeanuit cunctqeaniut cunctqeanitu cunctqeuiatn cunctqeuiant cunctqeuitan
cunctqeuitna cunctqeuinta cunctqeuinat cunctqeuaitn cunctqeuaint cunctqeuatin cunctqeuatni cunctqeuanti cunctqeuanit
cunctqeutain cunctqeutani cunctqeutian cunctqeutina cunctqeutnia cunctqeutnai cunctqeunati cunctqeunait cunctqeuntai
cunctqeuntia cunctqeunita cunctqeuniat cunctqeniaut cunctqeniatu cunctqeniuat cunctqeniuta cunctqenitua cunctqenitau
cunctqenaiut cunctqenaitu cunctqenauit cunctqenauti cunctqenatui cunctqenatiu cunctqenuait cunctqenuati cunctqenuiat
cunctqenuita cunctqenutia cunctqenutai cunctqentaui cunctqentaiu cunctqentuai cunctqentuia cunctqentiua cunctqentiau
cunctuntiqae cunctuntiqea cunctuntiaqe cunctuntiaeq cunctuntieaq cunctuntieqa cunctuntqiae cunctuntqiea cunctuntqaie
cunctuntqaei cunctuntqeai cunctuntqeia cunctuntaqie cunctuntaqei cunctuntaiqe cunctuntaieq cunctuntaeiq cunctuntaeqi
cunctunteqai cunctunteqia cunctunteaqi cunctunteaiq cunctunteiaq cunctunteiqa cunctunitqae cunctunitqea cunctunitaqe
cunctunitaeq cunctuniteaq cunctuniteqa cunctuniqtae cunctuniqtea cunctuniqate cunctuniqaet cunctuniqeat cunctuniqeta
cunctuniaqte cunctuniaqet cunctuniatqe cunctuniateq cunctuniaetq cunctuniaeqt cunctunieqat cunctunieqta cunctunieaqt
cunctunieatq cunctunietaq cunctunietqa cunctunqitae cunctunqitea cunctunqiate cunctunqiaet cunctunqieat cunctunqieta
cunctunqtiae cunctunqtiea cunctunqtaie cunctunqtaei cunctunqteai cunctunqteia cunctunqatie cunctunqatei cunctunqaite
cunctunqaiet cunctunqaeit cunctunqaeti cunctunqetai cunctunqetia cunctunqeati cunctunqeait cunctunqeiat cunctunqeita
cunctunaiqte cunctunaiqet cunctunaitqe cunctunaiteq cunctunaietq cunctunaieqt cunctunaqite cunctunaqiet cunctunaqtie
cunctunaqtei cunctunaqeti cunctunaqeit cunctunatqie cunctunatqei cunctunatiqe cunctunatieq cunctunateiq cunctunateqi
cunctunaeqti cunctunaeqit cunctunaetqi cunctunaetiq cunctunaeitq cunctunaeiqt cunctuneiqat cunctuneiqta cunctuneiaqt
cunctuneiatq cunctuneitaq cunctuneitqa cunctuneqiat cunctuneqita cunctuneqait cunctuneqati cunctuneqtai cunctuneqtia
cunctuneaqit cunctuneaqti cunctuneaiqt cunctuneaitq cunctuneatiq cunctuneatqi cunctunetqai cunctunetqia cunctunetaqi
cunctunetaiq cunctunetiaq cunctunetiqa cunctutniqae cunctutniqea cunctutniaqe cunctutniaeq cunctutnieaq cunctutnieqa
cunctutnqiae cunctutnqiea cunctutnqaie cunctutnqaei cunctutnqeai cunctutnqeia cunctutnaqie cunctutnaqei cunctutnaiqe
cunctutnaieq cunctutnaeiq cunctutnaeqi cunctutneqai cunctutneqia cunctutneaqi cunctutneaiq cunctutneiaq cunctutneiqa
cunctutinqae cunctutinqea cunctutinaqe cunctutinaeq cunctutineaq cunctutineqa cunctutiqnae cunctutiqnea cunctutiqane
cunctutiqaen cunctutiqean cunctutiqena cunctutiaqne cunctutiaqen cunctutianqe cunctutianeq cunctutiaenq cunctutiaeqn
cunctutieqan cunctutieqna cunctutieaqn cunctutieanq cunctutienaq cunctutienqa cunctutqinae cunctutqinea cunctutqiane
cunctutqiaen cunctutqiean cunctutqiena cunctutqniae cunctutqniea cunctutqnaie cunctutqnaei cunctutqneai cunctutqneia
cunctutqanie cunctutqanei cunctutqaine cunctutqaien cunctutqaein cunctutqaeni cunctutqenai cunctutqenia cunctutqeani
cunctutqeain cunctutqeian cunctutqeina cunctutaiqne cunctutaiqen cunctutainqe cunctutaineq cunctutaienq cunctutaieqn
cunctutaqine cunctutaqien cunctutaqnie cunctutaqnei cunctutaqeni cunctutaqein cunctutanqie cunctutanqei cunctutaniqe
cunctutanieq cunctutaneiq cunctutaneqi cunctutaeqni cunctutaeqin cunctutaenqi cunctutaeniq cunctutaeinq cunctutaeiqn
cunctuteiqan cunctuteiqna cunctuteiaqn cunctuteianq cunctuteinaq cunctuteinqa cunctuteqian cunctuteqina cunctuteqain
cunctuteqani cunctuteqnai cunctuteqnia cunctuteaqin cunctuteaqni cunctuteaiqn cunctuteainq cunctuteaniq cunctuteanqi
cunctutenqai cunctutenqia cunctutenaqi cunctutenaiq cunctuteniaq cunctuteniqa cunctuitnqae cunctuitnqea cunctuitnaqe
cunctuitnaeq cunctuitneaq cunctuitneqa cunctuitqnae cunctuitqnea cunctuitqane cunctuitqaen cunctuitqean cunctuitqena
cunctuitaqne cunctuitaqen cunctuitanqe cunctuitaneq cunctuitaenq cunctuitaeqn cunctuiteqan cunctuiteqna cunctuiteaqn
cunctuiteanq cunctuitenaq cunctuitenqa cunctuintqae cunctuintqea cunctuintaqe cunctuintaeq cunctuinteaq cunctuinteqa
cunctuinqtae cunctuinqtea cunctuinqate cunctuinqaet cunctuinqeat cunctuinqeta cunctuinaqte cunctuinaqet cunctuinatqe
cunctuinateq cunctuinaetq cunctuinaeqt cunctuineqat cunctuineqta cunctuineaqt cunctuineatq cunctuinetaq cunctuinetqa
cunctuiqntae cunctuiqntea cunctuiqnate cunctuiqnaet cunctuiqneat cunctuiqneta cunctuiqtnae cunctuiqtnea cunctuiqtane
cunctuiqtaen cunctuiqtean cunctuiqtena cunctuiqatne cunctuiqaten cunctuiqante cunctuiqanet cunctuiqaent cunctuiqaetn
cunctuiqetan cunctuiqetna cunctuiqeatn cunctuiqeant cunctuiqenat cunctuiqenta cunctuianqte cunctuianqet cunctuiantqe
cunctuianteq cunctuianetq cunctuianeqt cunctuiaqnte cunctuiaqnet cunctuiaqtne cunctuiaqten cunctuiaqetn cunctuiaqent
cunctuiatqne cunctuiatqen cunctuiatnqe cunctuiatneq cunctuiatenq cunctuiateqn cunctuiaeqtn cunctuiaeqnt cunctuiaetqn
cunctuiaetnq cunctuiaentq cunctuiaenqt cunctuienqat cunctuienqta cunctuienaqt cunctuienatq cunctuientaq cunctuientqa
cunctuieqnat cunctuieqnta cunctuieqant cunctuieqatn cunctuieqtan cunctuieqtna cunctuieaqnt cunctuieaqtn cunctuieanqt
cunctuieantq cunctuieatnq cunctuieatqn cunctuietqan cunctuietqna cunctuietaqn cunctuietanq cunctuietnaq cunctuietnqa
cunctuqtinae cunctuqtinea cunctuqtiane cunctuqtiaen cunctuqtiean cunctuqtiena cunctuqtniae cunctuqtniea cunctuqtnaie
cunctuqtnaei cunctuqtneai cunctuqtneia cunctuqtanie cunctuqtanei cunctuqtaine cunctuqtaien cunctuqtaein cunctuqtaeni
cunctuqtenai cunctuqtenia cunctuqteani cunctuqteain cunctuqteian cunctuqteina cunctuqitnae cunctuqitnea cunctuqitane
cunctuqitaen cunctuqitean cunctuqitena cunctuqintae cunctuqintea cunctuqinate cunctuqinaet cunctuqineat cunctuqineta
cunctuqiante cunctuqianet cunctuqiatne cunctuqiaten cunctuqiaetn cunctuqiaent cunctuqienat cunctuqienta cunctuqieant
cunctuqieatn cunctuqietan cunctuqietna cunctuqnitae cunctuqnitea cunctuqniate cunctuqniaet cunctuqnieat cunctuqnieta
cunctuqntiae cunctuqntiea cunctuqntaie cunctuqntaei cunctuqnteai cunctuqnteia cunctuqnatie cunctuqnatei cunctuqnaite
cunctuqnaiet cunctuqnaeit cunctuqnaeti cunctuqnetai cunctuqnetia cunctuqneati cunctuqneait cunctuqneiat cunctuqneita
cunctuqainte cunctuqainet cunctuqaitne cunctuqaiten cunctuqaietn cunctuqaient cunctuqanite cunctuqaniet cunctuqantie
cunctuqantei cunctuqaneti cunctuqaneit cunctuqatnie cunctuqatnei cunctuqatine cunctuqatien cunctuqatein cunctuqateni
cunctuqaenti cunctuqaenit cunctuqaetni cunctuqaetin cunctuqaeitn cunctuqaeint cunctuqeinat cunctuqeinta cunctuqeiant
cunctuqeiatn cunctuqeitan cunctuqeitna cunctuqeniat cunctuqenita cunctuqenait cunctuqenati cunctuqentai cunctuqentia
cunctuqeanit cunctuqeanti cunctuqeaint cunctuqeaitn cunctuqeatin cunctuqeatni cunctuqetnai cunctuqetnia cunctuqetani
cunctuqetain cunctuqetian cunctuqetina cunctuatiqne cunctuatiqen cunctuatinqe cunctuatineq cunctuatienq cunctuatieqn
cunctuatqine cunctuatqien cunctuatqnie cunctuatqnei cunctuatqeni cunctuatqein cunctuatnqie cunctuatnqei cunctuatniqe
cunctuatnieq cunctuatneiq cunctuatneqi cunctuateqni cunctuateqin cunctuatenqi cunctuateniq cunctuateinq cunctuateiqn
cunctuaitqne cunctuaitqen cunctuaitnqe cunctuaitneq cunctuaitenq cunctuaiteqn cunctuaiqtne cunctuaiqten cunctuaiqnte
cunctuaiqnet cunctuaiqent cunctuaiqetn cunctuainqte cunctuainqet cunctuaintqe cunctuainteq cunctuainetq cunctuaineqt
cunctuaieqnt cunctuaieqtn cunctuaienqt cunctuaientq cunctuaietnq cunctuaietqn cunctuaqitne cunctuaqiten cunctuaqinte
cunctuaqinet cunctuaqient cunctuaqietn cunctuaqtine cunctuaqtien cunctuaqtnie cunctuaqtnei cunctuaqteni cunctuaqtein
cunctuaqntie cunctuaqntei cunctuaqnite cunctuaqniet cunctuaqneit cunctuaqneti cunctuaqetni cunctuaqetin cunctuaqenti
cunctuaqenit cunctuaqeint cunctuaqeitn cunctuaniqte cunctuaniqet cunctuanitqe cunctuaniteq cunctuanietq cunctuanieqt
cunctuanqite cunctuanqiet cunctuanqtie cunctuanqtei cunctuanqeti cunctuanqeit cunctuantqie cunctuantqei cunctuantiqe
cunctuantieq cunctuanteiq cunctuanteqi cunctuaneqti cunctuaneqit cunctuanetqi cunctuanetiq cunctuaneitq cunctuaneiqt
cunctuaeiqnt cunctuaeiqtn cunctuaeinqt cunctuaeintq cunctuaeitnq cunctuaeitqn cunctuaeqint cunctuaeqitn cunctuaeqnit
cunctuaeqnti cunctuaeqtni cunctuaeqtin cunctuaenqit cunctuaenqti cunctuaeniqt cunctuaenitq cunctuaentiq cunctuaentqi
cunctuaetqni cunctuaetqin cunctuaetnqi cunctuaetniq cunctuaetinq cunctuaetiqn cunctuetiqan cunctuetiqna cunctuetiaqn
cunctuetianq cunctuetinaq cunctuetinqa cunctuetqian cunctuetqina cunctuetqain cunctuetqani cunctuetqnai cunctuetqnia
cunctuetaqin cunctuetaqni cunctuetaiqn cunctuetainq cunctuetaniq cunctuetanqi cunctuetnqai cunctuetnqia cunctuetnaqi
cunctuetnaiq cunctuetniaq cunctuetniqa cunctueitqan cunctueitqna cunctueitaqn cunctueitanq cunctueitnaq cunctueitnqa
cunctueiqtan cunctueiqtna cunctueiqatn cunctueiqant cunctueiqnat cunctueiqnta cunctueiaqtn cunctueiaqnt cunctueiatqn
cunctueiatnq cunctueiantq cunctueianqt cunctueinqat cunctueinqta cunctueinaqt cunctueinatq cunctueintaq cunctueintqa
cunctueqitan cunctueqitna cunctueqiatn cunctueqiant cunctueqinat cunctueqinta cunctueqtian cunctueqtina cunctueqtain
cunctueqtani cunctueqtnai cunctueqtnia cunctueqatin cunctueqatni cunctueqaitn cunctueqaint cunctueqanit cunctueqanti
cunctueqntai cunctueqntia cunctueqnati cunctueqnait cunctueqniat cunctueqnita cunctueaiqtn cunctueaiqnt cunctueaitqn
cunctueaitnq cunctueaintq cunctueainqt cunctueaqitn cunctueaqint cunctueaqtin cunctueaqtni cunctueaqnti cunctueaqnit
cunctueatqin cunctueatqni cunctueatiqn cunctueatinq cunctueatniq cunctueatnqi cunctueanqti cunctueanqit cunctueantqi
cunctueantiq cunctueanitq cunctueaniqt cunctueniqat cunctueniqta cunctueniaqt cunctueniatq cunctuenitaq cunctuenitqa
cunctuenqiat cunctuenqita cunctuenqait cunctuenqati cunctuenqtai cunctuenqtia cunctuenaqit cunctuenaqti cunctuenaiqt
cunctuenaitq cunctuenatiq cunctuenatqi cunctuentqai cunctuentqia cunctuentaqi cunctuentaiq cunctuentiaq cunctuentiqa
cunctentiqua cunctentiqau cunctentiuqa cunctentiuaq cunctentiauq cunctentiaqu cunctentqiua cunctentqiau cunctentquia
cunctentquai cunctentqaui cunctentqaiu cunctentuqia cunctentuqai cunctentuiqa cunctentuiaq cunctentuaiq cunctentuaqi
cunctentaqui cunctentaqiu cunctentauqi cunctentauiq cunctentaiuq cunctentaiqu cunctenitqua cunctenitqau cunctenituqa
cunctenituaq cunctenitauq cunctenitaqu cuncteniqtua cuncteniqtau cuncteniquta cuncteniquat cuncteniqaut cuncteniqatu
cuncteniuqta cuncteniuqat cuncteniutqa cuncteniutaq cuncteniuatq cuncteniuaqt cuncteniaqut cuncteniaqtu cuncteniauqt
cuncteniautq cuncteniatuq cuncteniatqu cunctenqitua cunctenqitau cunctenqiuta cunctenqiuat cunctenqiaut cunctenqiatu
cunctenqtiua cunctenqtiau cunctenqtuia cunctenqtuai cunctenqtaui cunctenqtaiu cunctenqutia cunctenqutai cunctenquita
cunctenquiat cunctenquait cunctenquati cunctenqatui cunctenqatiu cunctenqauti cunctenqauit cunctenqaiut cunctenqaitu
cunctenuiqta cunctenuiqat cunctenuitqa cunctenuitaq cunctenuiatq cunctenuiaqt cunctenuqita cunctenuqiat cunctenuqtia
cunctenuqtai cunctenuqati cunctenuqait cunctenutqia cunctenutqai cunctenutiqa cunctenutiaq cunctenutaiq cunctenutaqi
cunctenuaqti cunctenuaqit cunctenuatqi cunctenuatiq cunctenuaitq cunctenuaiqt cunctenaiqut cunctenaiqtu cunctenaiuqt
cunctenaiutq cunctenaituq cunctenaitqu cunctenaqiut cunctenaqitu cunctenaquit cunctenaquti cunctenaqtui cunctenaqtiu
cunctenauqit cunctenauqti cunctenauiqt cunctenauitq cunctenautiq cunctenautqi cunctenatqui cunctenatqiu cunctenatuqi
cunctenatuiq cunctenatiuq cunctenatiqu cunctetniqua cunctetniqau cunctetniuqa cunctetniuaq cunctetniauq cunctetniaqu
cunctetnqiua cunctetnqiau cunctetnquia cunctetnquai cunctetnqaui cunctetnqaiu cunctetnuqia cunctetnuqai cunctetnuiqa
cunctetnuiaq cunctetnuaiq cunctetnuaqi cunctetnaqui cunctetnaqiu cunctetnauqi cunctetnauiq cunctetnaiuq cunctetnaiqu
cunctetinqua cunctetinqau cunctetinuqa cunctetinuaq cunctetinauq cunctetinaqu cunctetiqnua cunctetiqnau cunctetiquna
cunctetiquan cunctetiqaun cunctetiqanu cunctetiuqna cunctetiuqan cunctetiunqa cunctetiunaq cunctetiuanq cunctetiuaqn
cunctetiaqun cunctetiaqnu cunctetiauqn cunctetiaunq cunctetianuq cunctetianqu cunctetqinua cunctetqinau cunctetqiuna
cunctetqiuan cunctetqiaun cunctetqianu cunctetqniua cunctetqniau cunctetqnuia cunctetqnuai cunctetqnaui cunctetqnaiu
cunctetqunia cunctetqunai cunctetquina cunctetquian cunctetquain cunctetquani cunctetqanui cunctetqaniu cunctetqauni
cunctetqauin cunctetqaiun cunctetqainu cunctetuiqna cunctetuiqan cunctetuinqa cunctetuinaq cunctetuianq cunctetuiaqn
cunctetuqina cunctetuqian cunctetuqnia cunctetuqnai cunctetuqani cunctetuqain cunctetunqia cunctetunqai cunctetuniqa
cunctetuniaq cunctetunaiq cunctetunaqi cunctetuaqni cunctetuaqin cunctetuanqi cunctetuaniq cunctetuainq cunctetuaiqn
cunctetaiqun cunctetaiqnu cunctetaiuqn cunctetaiunq cunctetainuq cunctetainqu cunctetaqiun cunctetaqinu cunctetaquin
cunctetaquni cunctetaqnui cunctetaqniu cunctetauqin cunctetauqni cunctetauiqn cunctetauinq cunctetauniq cunctetaunqi
cunctetanqui cunctetanqiu cunctetanuqi cunctetanuiq cunctetaniuq cunctetaniqu cuncteitnqua cuncteitnqau cuncteitnuqa
cuncteitnuaq cuncteitnauq cuncteitnaqu cuncteitqnua cuncteitqnau cuncteitquna cuncteitquan cuncteitqaun cuncteitqanu
cuncteituqna cuncteituqan cuncteitunqa cuncteitunaq cuncteituanq cuncteituaqn cuncteitaqun cuncteitaqnu cuncteitauqn
cuncteitaunq cuncteitanuq cuncteitanqu cuncteintqua cuncteintqau cuncteintuqa cuncteintuaq cuncteintauq cuncteintaqu
cuncteinqtua cuncteinqtau cuncteinquta cuncteinquat cuncteinqaut cuncteinqatu cuncteinuqta cuncteinuqat cuncteinutqa
cuncteinutaq cuncteinuatq cuncteinuaqt cuncteinaqut cuncteinaqtu cuncteinauqt cuncteinautq cuncteinatuq cuncteinatqu
cuncteiqntua cuncteiqntau cuncteiqnuta cuncteiqnuat cuncteiqnaut cuncteiqnatu cuncteiqtnua cuncteiqtnau cuncteiqtuna
cuncteiqtuan cuncteiqtaun cuncteiqtanu cuncteiqutna cuncteiqutan cuncteiqunta cuncteiqunat cuncteiquant cuncteiquatn
cuncteiqatun cuncteiqatnu cuncteiqautn cuncteiqaunt cuncteiqanut cuncteiqantu cuncteiunqta cuncteiunqat cuncteiuntqa
cuncteiuntaq cuncteiunatq cuncteiunaqt cuncteiuqnta cuncteiuqnat cuncteiuqtna cuncteiuqtan cuncteiuqatn cuncteiuqant
cuncteiutqna cuncteiutqan cuncteiutnqa cuncteiutnaq cuncteiutanq cuncteiutaqn cuncteiuaqtn cuncteiuaqnt cuncteiuatqn
cuncteiuatnq cuncteiuantq cuncteiuanqt cuncteianqut cuncteianqtu cuncteianuqt cuncteianutq cuncteiantuq cuncteiantqu
cuncteiaqnut cuncteiaqntu cuncteiaqunt cuncteiaqutn cuncteiaqtun cuncteiaqtnu cuncteiauqnt cuncteiauqtn cuncteiaunqt
cuncteiauntq cuncteiautnq cuncteiautqn cuncteiatqun cuncteiatqnu cuncteiatuqn cuncteiatunq cuncteiatnuq cuncteiatnqu
cuncteqtinua cuncteqtinau cuncteqtiuna cuncteqtiuan cuncteqtiaun cuncteqtianu cuncteqtniua cuncteqtniau cuncteqtnuia
cuncteqtnuai cuncteqtnaui cuncteqtnaiu cuncteqtunia cuncteqtunai cuncteqtuina cuncteqtuian cuncteqtuain cuncteqtuani
cuncteqtanui cuncteqtaniu cuncteqtauni cuncteqtauin cuncteqtaiun cuncteqtainu cuncteqitnua cuncteqitnau cuncteqituna
cuncteqituan cuncteqitaun cuncteqitanu cuncteqintua cuncteqintau cuncteqinuta cuncteqinuat cuncteqinaut cuncteqinatu
cuncteqiunta cuncteqiunat cuncteqiutna cuncteqiutan cuncteqiuatn cuncteqiuant cuncteqianut cuncteqiantu cuncteqiaunt
cuncteqiautn cuncteqiatun cuncteqiatnu cuncteqnitua cuncteqnitau cuncteqniuta cuncteqniuat cuncteqniaut cuncteqniatu
cuncteqntiua cuncteqntiau cuncteqntuia cuncteqntuai cuncteqntaui cuncteqntaiu cuncteqnutia cuncteqnutai cuncteqnuita
cuncteqnuiat cuncteqnuait cuncteqnuati cuncteqnatui cuncteqnatiu cuncteqnauti cuncteqnauit cuncteqnaiut cuncteqnaitu
cunctequinta cunctequinat cunctequitna cunctequitan cunctequiatn cunctequiant cunctequnita cunctequniat cunctequntia
cunctequntai cunctequnati cunctequnait cunctequtnia cunctequtnai cunctequtina cunctequtian cunctequtain cunctequtani
cunctequanti cunctequanit cunctequatni cunctequatin cunctequaitn cunctequaint cuncteqainut cuncteqaintu cuncteqaiunt
cuncteqaiutn cuncteqaitun cuncteqaitnu cuncteqaniut cuncteqanitu cuncteqanuit cuncteqanuti cuncteqantui cuncteqantiu
cuncteqaunit cuncteqaunti cuncteqauint cuncteqauitn cuncteqautin cuncteqautni cuncteqatnui cuncteqatniu cuncteqatuni
cuncteqatuin cuncteqatiun cuncteqatinu cuncteutiqna cuncteutiqan cuncteutinqa cuncteutinaq cuncteutianq cuncteutiaqn
cuncteutqina cuncteutqian cuncteutqnia cuncteutqnai cuncteutqani cuncteutqain cuncteutnqia cuncteutnqai cuncteutniqa
cuncteutniaq cuncteutnaiq cuncteutnaqi cuncteutaqni cuncteutaqin cuncteutanqi cuncteutaniq cuncteutainq cuncteutaiqn
cuncteuitqna cuncteuitqan cuncteuitnqa cuncteuitnaq cuncteuitanq cuncteuitaqn cuncteuiqtna cuncteuiqtan cuncteuiqnta
cuncteuiqnat cuncteuiqant cuncteuiqatn cuncteuinqta cuncteuinqat cuncteuintqa cuncteuintaq cuncteuinatq cuncteuinaqt
cuncteuiaqnt cuncteuiaqtn cuncteuianqt cuncteuiantq cuncteuiatnq cuncteuiatqn cuncteuqitna cuncteuqitan cuncteuqinta
cuncteuqinat cuncteuqiant cuncteuqiatn cuncteuqtina cuncteuqtian cuncteuqtnia cuncteuqtnai cuncteuqtani cuncteuqtain
cuncteuqntia cuncteuqntai cuncteuqnita cuncteuqniat cuncteuqnait cuncteuqnati cuncteuqatni cuncteuqatin cuncteuqanti
cuncteuqanit cuncteuqaint cuncteuqaitn cuncteuniqta cuncteuniqat cuncteunitqa cuncteunitaq cuncteuniatq cuncteuniaqt
cuncteunqita cuncteunqiat cuncteunqtia cuncteunqtai cuncteunqati cuncteunqait cuncteuntqia cuncteuntqai cuncteuntiqa
cuncteuntiaq cuncteuntaiq cuncteuntaqi cuncteunaqti cuncteunaqit cuncteunatqi cuncteunatiq cuncteunaitq cuncteunaiqt
cuncteuaiqnt cuncteuaiqtn cuncteuainqt cuncteuaintq cuncteuaitnq cuncteuaitqn cuncteuaqint cuncteuaqitn cuncteuaqnit
cuncteuaqnti cuncteuaqtni cuncteuaqtin cuncteuanqit cuncteuanqti cuncteuaniqt cuncteuanitq cuncteuantiq cuncteuantqi
cuncteuatqni cuncteuatqin cuncteuatnqi cuncteuatniq cuncteuatinq cuncteuatiqn cuncteatiqun cuncteatiqnu cuncteatiuqn
cuncteatiunq cuncteatinuq cuncteatinqu cuncteatqiun cuncteatqinu cuncteatquin cuncteatquni cuncteatqnui cuncteatqniu
cuncteatuqin cuncteatuqni cuncteatuiqn cuncteatuinq cuncteatuniq cuncteatunqi cuncteatnqui cuncteatnqiu cuncteatnuqi
cuncteatnuiq cuncteatniuq cuncteatniqu cuncteaitqun cuncteaitqnu cuncteaituqn cuncteaitunq cuncteaitnuq cuncteaitnqu
cuncteaiqtun cuncteaiqtnu cuncteaiqutn cuncteaiqunt cuncteaiqnut cuncteaiqntu cuncteaiuqtn cuncteaiuqnt cuncteaiutqn
cuncteaiutnq cuncteaiuntq cuncteaiunqt cuncteainqut cuncteainqtu cuncteainuqt cuncteainutq cuncteaintuq cuncteaintqu
cuncteaqitun cuncteaqitnu cuncteaqiutn cuncteaqiunt cuncteaqinut cuncteaqintu cuncteaqtiun cuncteaqtinu cuncteaqtuin
cuncteaqtuni cuncteaqtnui cuncteaqtniu cuncteaqutin cuncteaqutni cuncteaquitn cuncteaquint cuncteaqunit cuncteaqunti
cuncteaqntui cuncteaqntiu cuncteaqnuti cuncteaqnuit cuncteaqniut cuncteaqnitu cuncteauiqtn cuncteauiqnt cuncteauitqn
cuncteauitnq cuncteauintq cuncteauinqt cuncteauqitn cuncteauqint cuncteauqtin cuncteauqtni cuncteauqnti cuncteauqnit
cuncteautqin cuncteautqni cuncteautiqn cuncteautinq cuncteautniq cuncteautnqi cuncteaunqti cuncteaunqit cuncteauntqi
cuncteauntiq cuncteaunitq cuncteauniqt cuncteaniqut cuncteaniqtu cuncteaniuqt cuncteaniutq cuncteanituq cuncteanitqu
cuncteanqiut cuncteanqitu cuncteanquit cuncteanquti cuncteanqtui cuncteanqtiu cuncteanuqit cuncteanuqti cuncteanuiqt
cuncteanuitq cuncteanutiq cuncteanutqi cuncteantqui cuncteantqiu cuncteantuqi cuncteantuiq cuncteantiuq cuncteantiqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us