easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

brattishing

tympans

belgaeque

carmelita

ediya

sedations

pholland

metachemic

superefficient

crampton

tophaike

exquirisque

vindicator

tradetque

kimberling

intraimperial

diplomatique

tresslike


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: counterretaliations
cipher variations:
dpvoufssfubmjbujpot eqwpvgttgvcnkcvkqpu frxqwhuuhwdoldwlrqv gsyrxivvixepmexmsrw htzsyjwwjyfqnfyntsx
iuatzkxxkzgrogzouty jvbualyylahsphapvuz kwcvbmzzmbitqibqwva lxdwcnaancjurjcrxwb myexdobbodkvskdsyxc
nzfyepccpelwtletzyd oagzfqddqfmxumfuaze pbhagreergnyvngvbaf qcibhsffshozwohwcbg rdjcitggtipaxpixdch
sekdjuhhujqbyqjyedi tflekviivkrczrkzfej ugmflwjjwlsdaslagfk vhngmxkkxmtebtmbhgl wiohnyllynufcuncihm
xjpiozmmzovgdvodjin ykqjpannapwhewpekjo zlrkqboobqxifxqflkp amslrcppcryjgyrgmlq bntmsdqqdszkhzshnmr

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: counterretaliations
Cipher: xlfmgviivgzorzgrlmh

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: counterretaliations
Cipher: AAABA ABBAB BAABB ABBAA BAABA AABAA BAAAA BAAAA AABAA BAABA AAAAA ABABA ABAAA AAAAA BAABA ABAAA ABBAB ABBAA BAAAB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: counterretaliations
cipher variations:
dpvoufssfubmjbujpothrjognaangbizbgzrodltxosviivsbepbsptonpvloedqqdebafbefvoxtxzoqlyylqbwvbqvxohxznoctggtcbslbclzorfdpoajwwjabkrbardoljfdomreermbghbmhfov
nhroyzmmzybcxbyxhofrjfokhuuhkbynbknjopvltowpccpwbudbwdlozznhoixkkxibqtbitnojeqwpvgttgvcnkcvkqpuiskphobbohcjachaspemuyptwjjwtcfqctqupoqwmpferrefcbgcfgwpy
uyaprmzzmrcxwcrwypiyaopduhhudctmcdmapsgeqpbkxxkbclscbsepmkgepnsffsnchicnigpwoispzannazcdyczyipgskgplivvilczoclokpqwmupxqddqxcvecxempaaoipjyllyjcrucjuopk
frxqwhuuhwdoldwlrqvjtlqipccpidkbdibtqfnvzquxkkxudgrdurvqprxnqgfssfgdchdghxqzvzbqsnaansdyxdsxzqjzbpqeviivedundenbqthfrqclyylcdmtdctfqnlhfqotggtodijdojhqx
pjtqaboobadezdazjqhtlhqmjwwjmdapdmplqrxnvqyreerydwfdyfnqbbpjqkzmmzkdsvdkvpqlgsyrxivvixepmexmsrwkumrjqddqjelcejcurgowarvyllyvehsevswrqsyorhgttghediehiyra
wacrtobbotezyetyarkacqrfwjjwfevoefocruigsrdmzzmdenuedugromigrpuhhupejkepkiryqkurbcppcbefaebakriumirnkxxknebqenqmrsyowrzsffszexgezgorccqkrlannaletwelwqrm
htzsyjwwjyfqnfyntsxlvnskreerkfmdfkdvshpxbswzmmzwfitfwtxsrtzpsihuuhifejfijzsbxbdsupccpufazfuzbslbdrsgxkkxgfwpfgpdsvjhtsenaanefovfevhspnjhsqviivqfklfqljsz
rlvscdqqdcfgbfcblsjvnjsolyylofcrfornstzpxsatggtafyhfahpsddrlsmboobmfuxfmxrsniuatzkxxkzgrogzoutymwotlsffslgneglewtiqyctxannaxgjugxuytsuaqtjivvijgfkgjkatc
ycetvqddqvgbagvactmcesthyllyhgxqghqetwkiutfobbofgpwgfwitqokitrwjjwrglmgrmktasmwtderredghcgdcmtkwoktpmzzmpgdsgpsotuaqytbuhhubgzigbiqteesmtncppcngvygnysto
jvbualyylahsphapvuznxpumtggtmhofhmfxujrzduyboobyhkvhyvzutvbrukjwwjkhglhklbudzdfuwreerwhcbhwbdundftuizmmzihyrhirfuxljvugpccpghqxhgxjurpljusxkkxshmnhsnlub
tnxuefssfehidhednulxpluqnaanqhethqtpuvbrzucviivchajhcjrufftnuodqqdohwzhoztupkwcvbmzzmbitqibqwvaoyqvnuhhunipgingyvksaevzcppczilwizwavuwcsvlkxxklihmilmcve
aegvxsffsxidcixcevoeguvjannajizsijsgvymkwvhqddqhiryihykvsqmkvtyllytinoitomvcuoyvfgttgfijeifeovmyqmvrobborifuiruqvwcsavdwjjwdibkidksvgguovperrepixaipauvq
lxdwcnaancjurjcrxwbpzrwoviivojqhjohzwltbfwadqqdajmxjaxbwvxdtwmlyylmjinjmndwfbfhwytggtyjedjydfwpfhvwkboobkjatjkthwznlxwireerijszjizlwtrnlwuzmmzujopjupnwd
vpzwghuuhgjkfjgfpwnzrnwspccpsjgvjsvrwxdtbwexkkxejcljeltwhhvpwqfssfqjybjqbvwrmyexdobbodkvskdsyxcqasxpwjjwpkrikpiaxmucgxberrebknykbycxwyeuxnmzzmnkjoknoexg
cgixzuhhuzkfekzegxqgiwxlcppclkbukluixaomyxjsffsjktakjamxusomxvannavkpqkvqoxewqaxhivvihklgkhgqxoasoxtqddqtkhwktwsxyeucxfyllyfkdmkfmuxiiwqxrgttgrkzckrcwxs
nzfyepccpelwtletzydrbtyqxkkxqlsjlqjbynvdhycfssfclozlczdyxzfvyonaanolkplopfyhdhjyaviivalgflafhyrhjxymdqqdmlcvlmvjybpnzyktggtklublkbnyvtpnywboobwlqrlwrpyf
xrbyijwwjilmhlihrypbtpyureerulixluxtyzfvdygzmmzglenlgnvyjjxryshuuhsladlsdxytoagzfqddqfmxumfuazescuzryllyrmtkmrkczoweizdgttgdmpamdaezyagwzpobbopmlqmpqgzi
eikzbwjjwbmhgmbgizsikyznerrenmdwmnwkzcqoazluhhulmvcmlcozwuqozxcppcxmrsmxsqzgysczjkxxkjmnimjiszqcuqzvsffsvmjymvyuzagwezhannahmfomhowzkkysztivvitmbemteyzu
pbhagreergnyvngvbaftdvaszmmzsnulnsldapxfjaehuuhenqbnebfazbhxaqpccpqnmrnqrhajfjlacxkkxcnihnchjatjlzaofssfonexnoxladrpbamviivmnwdnmdpaxvrpaydqqdynstnytrah
ztdaklyylknojnkjtardvrawtggtwnkznwzvabhxfaiboobingpnipxallztaujwwjuncfnufzavqcibhsffshozwohwcbguewbtannatovmotmebqygkbfivviforcofcgbaciybrqddqronsorsibk
gkmbdyllydojiodikbukmabpgttgpofyopymbesqcbnwjjwnoxeoneqbywsqbzerrezotuozusbiaueblmzzmlopkolkubsewsbxuhhuxolaoxawbciygbjcppcjohqojqybmmaubvkxxkvodgovgabw
rdjcitggtipaxpixdchvfxcuboobupwnpunfcrzhlcgjwwjgpsdpgdhcbdjzcsreerspotpstjclhlncezmmzepkjpejlcvlnbcqhuuhqpgzpqzncftrdcoxkkxopyfpofrczxtrcafssfapuvpavtcj
bvfcmnaanmpqlpmlvctfxtcyviivypmbpybxcdjzhckdqqdkpirpkrzcnnbvcwlyylwpehpwhbcxsekdjuhhujqbyqjyediwgydvcppcvqxoqvogdsaimdhkxxkhqteqheidcekadtsffstqpuqtukdm
imodfannafqlkqfkmdwmocdrivvirqhaqraodgusedpyllypqzgqpgsdayusdbgttgbqvwqbwudkcwgdnobbonqrmqnmwdugyudzwjjwzqncqzcydekaidlerrelqjsqlsadoocwdxmzzmxqfiqxicdy
tflekviivkrczrkzfejxhzewdqqdwryprwphetbjneilyylirufrifjedflbeutggturqvruvlenjnpegboobgrmlrglnexnpdesjwwjsribrsbpehvtfeqzmmzqrahrqhtebzvtechuuhcrwxrcxvel
dxheopccporsnronxevhzveaxkkxarodradzeflbjemfssfmrktrmtbeppdxeynaanyrgjryjdezugmflwjjwlsdaslagfkyiafxerrexszqsxqifuckofjmzzmjsvgsjgkfegmcfvuhhuvsrwsvwmfo
koqfhcppchsnmshmofyoqeftkxxktsjcstcqfiwugfrannarsbisriufcawufdivvidsxysdywfmeyifpqddqpstospoyfwiawfbyllybspesbeafgmckfngttgnslusnucfqqeyfzobbozshkszkefa
vhngmxkkxmtebtmbhglzjbgyfssfytartyrjgvdlpgknaanktwhtkhlgfhndgwviivwtsxtwxngplprgidqqditontinpgzprfgulyylutkdtudrgjxvhgsboobstcjtsjvgdbxvgejwwjetyztezxgn
fzjgqreerqtuptqpzgxjbxgczmmzctqftcfbghndlgohuuhotmvtovdgrrfzgapccpatiltalfgbwiohnyllynufcuncihmakchzgttgzubsuzskhwemqhlobboluxiulimhgioehxwjjwxutyuxyohq
mqshjerrejupoujoqhaqsghvmzzmvuleuveshkywihtcppctudkutkwhecywhfkxxkfuzaufayhogakhrsffsruvqurqahykcyhdannadurgudgchioemhpivvipunwupwehssgahbqddqbujmubmghc
xjpiozmmzovgdvodjinbldiahuuhavctvatlixfnrimpccpmvyjvmjnihjpfiyxkkxyvuzvyzpirnrtikfssfkvqpvkpribrthiwnaanwvmfvwftilzxjiudqqduvelvulxifdzxiglyylgvabvgbzip
hblistggtsvwrvsrbizldzieboobevshvehdijpfniqjwwjqvoxvqxfitthbicreercvknvcnhidykqjpannapwhewpekjocmejbivvibwduwbumjygosjnqddqnwzkwnkojikqgjzyllyzwvawzaqjs
osujlgttglwrqwlqsjcsuijxobboxwngwxgujmaykjverrevwfmwvmyjgeayjhmzzmhwbcwhcajqicmjtuhhutwxswtscjameajfcppcfwtiwfiejkqgojrkxxkrwpywrygjuuicjdsffsdwlowdoije
zlrkqboobqxifxqflkpdnfkcjwwjcxevxcvnkzhptkoreeroxalxolpkjlrhkazmmzaxwbxabrktptvkmhuuhmxsrxmrtkdtvjkypccpyxohxyhvknbzlkwfssfwxgnxwnzkhfbzkinaanixcdxidbkr
jdnkuviivuxytxutdkbnfbkgdqqdgxujxgjfklrhpkslyylsxqzxszhkvvjdketggtexmpxepjkfamslrcppcryjgyrgmlqeogldkxxkdyfwydwolaiqulpsffspybmypmqlkmsilbannabyxcybcslu
quwlnivvinytsynsuleuwklzqddqzypiyziwlocamlxgttgxyhoyxoaligcaljobbojydeyjeclskeolvwjjwvyzuyvuelcogclherrehyvkyhkglmsiqltmzzmtyraytailwwkelfuhhufynqyfqklg
bntmsdqqdszkhzshnmrfphmelyylezgxzexpmbjrvmqtggtqzcnzqnrmlntjmcboobczydzcdtmvrvxmojwwjozutzotvmfvxlmareerazqjzajxmpdbnmyhuuhyzipzypbmjhdbmkpccpkzefzkfdmt
lfpmwxkkxwzavzwvfmdphdmifssfizwlzilhmntjrmunaanuzsbzubjmxxlfmgviivgzorzgrlmhcounterretaliationsgqinfmzzmfahyafyqnckswnruhhuradoarosnmoukndcppcdazeadeunw
swynpkxxkpavuapuwngwymnbsffsbarkabkynqeconzivvizajqazqcnkiecnlqddqlafgalgenumgqnxyllyxabwaxwgneqienjgttgjaxmajminouksnvobbovatcavcknyymgnhwjjwhapsahsmni

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: counterretaliations
Cipher: pbhagreergnyvngvbaf

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: counterretaliations
Cipher: 31435433445124245144111342114442433334

Extended Methods:
Method #1

Plaintext: counterretaliations
method variations:
htzsykwwkyfqofyotsxnyexdpbbpdlvtldtyxcsdkciugguiqayqiydchxiphozmmzovfdvodihn

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
c o u n t e r r e t a l i a t i o n s 
3 4 5 3 4 5 2 2 5 4 1 1 4 1 4 4 4 3 3 
1 3 4 3 4 1 4 4 1 4 1 3 2 1 4 2 3 3 4 
They are then read out in rows:
34534522541141444331343414414132142334
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: counterretaliations
Cipher: spyguadtocssqddhqms

Read more ...
Method #3

Plaintext: counterretaliations
method variations:
qxosyfiyqdasbqtrnno xosyfiyqdasbqtrnnoq osyfiyqdasbqtrnnoqx
syfiyqdasbqtrnnoqxo yfiyqdasbqtrnnoqxos fiyqdasbqtrnnoqxosy
iyqdasbqtrnnoqxosyf yqdasbqtrnnoqxosyfi qdasbqtrnnoqxosyfiy
dasbqtrnnoqxosyfiyq asbqtrnnoqxosyfiyqd sbqtrnnoqxosyfiyqda
bqtrnnoqxosyfiyqdas qtrnnoqxosyfiyqdasb trnnoqxosyfiyqdasbq
rnnoqxosyfiyqdasbqt nnoqxosyfiyqdasbqtr noqxosyfiyqdasbqtrn
oqxosyfiyqdasbqtrnn

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: counterretaliations

first 5040 cipher variations(1.211127869809E+17 total)
counterretaliations counterretaliatiosn counterretaliatinos counterretaliatinso counterretaliatisno counterretaliatison
counterretaliatoins counterretaliatoisn counterretaliatonis counterretaliatonsi counterretaliatosni counterretaliatosin
counterretaliatnois counterretaliatnosi counterretaliatnios counterretaliatniso counterretaliatnsio counterretaliatnsoi
counterretaliatsoni counterretaliatsoin counterretaliatsnoi counterretaliatsnio counterretaliatsino counterretaliatsion
counterretaliaitons counterretaliaitosn counterretaliaitnos counterretaliaitnso counterretaliaitsno counterretaliaitson
counterretaliaiotns counterretaliaiotsn counterretaliaionts counterretaliaionst counterretaliaiosnt counterretaliaiostn
counterretaliainots counterretaliainost counterretaliaintos counterretaliaintso counterretaliainsto counterretaliainsot
counterretaliaisont counterretaliaisotn counterretaliaisnot counterretaliaisnto counterretaliaistno counterretaliaiston
counterretaliaoitns counterretaliaoitsn counterretaliaoints counterretaliaoinst counterretaliaoisnt counterretaliaoistn
counterretaliaotins counterretaliaotisn counterretaliaotnis counterretaliaotnsi counterretaliaotsni counterretaliaotsin
counterretaliaontis counterretaliaontsi counterretaliaonits counterretaliaonist counterretaliaonsit counterretaliaonsti
counterretaliaostni counterretaliaostin counterretaliaosnti counterretaliaosnit counterretaliaosint counterretaliaositn
counterretalianiots counterretalianiost counterretalianitos counterretalianitso counterretalianisto counterretalianisot
counterretalianoits counterretalianoist counterretalianotis counterretalianotsi counterretalianosti counterretalianosit
counterretaliantois counterretaliantosi counterretaliantios counterretaliantiso counterretaliantsio counterretaliantsoi
counterretaliansoti counterretaliansoit counterretalianstoi counterretalianstio counterretaliansito counterretaliansiot
counterretaliasiont counterretaliasiotn counterretaliasinot counterretaliasinto counterretaliasitno counterretaliasiton
counterretaliasoint counterretaliasoitn counterretaliasonit counterretaliasonti counterretaliasotni counterretaliasotin
counterretaliasnoit counterretaliasnoti counterretaliasniot counterretaliasnito counterretaliasntio counterretaliasntoi
counterretaliastoni counterretaliastoin counterretaliastnoi counterretaliastnio counterretaliastino counterretaliastion
counterretalitaions counterretalitaiosn counterretalitainos counterretalitainso counterretalitaisno counterretalitaison
counterretalitaoins counterretalitaoisn counterretalitaonis counterretalitaonsi counterretalitaosni counterretalitaosin
counterretalitanois counterretalitanosi counterretalitanios counterretalitaniso counterretalitansio counterretalitansoi
counterretalitasoni counterretalitasoin counterretalitasnoi counterretalitasnio counterretalitasino counterretalitasion
counterretalitiaons counterretalitiaosn counterretalitianos counterretalitianso counterretalitiasno counterretalitiason
counterretalitioans counterretalitioasn counterretalitionas counterretalitionsa counterretalitiosna counterretalitiosan
counterretalitinoas counterretalitinosa counterretalitinaos counterretalitinaso counterretalitinsao counterretalitinsoa
counterretalitisona counterretalitisoan counterretalitisnoa counterretalitisnao counterretalitisano counterretalitisaon
counterretalitoians counterretalitoiasn counterretalitoinas counterretalitoinsa counterretalitoisna counterretalitoisan
counterretalitoains counterretalitoaisn counterretalitoanis counterretalitoansi counterretalitoasni counterretalitoasin
counterretalitonais counterretalitonasi counterretalitonias counterretalitonisa counterretalitonsia counterretalitonsai
counterretalitosani counterretalitosain counterretalitosnai counterretalitosnia counterretalitosina counterretalitosian
counterretalitnioas counterretalitniosa counterretalitniaos counterretalitniaso counterretalitnisao counterretalitnisoa
counterretalitnoias counterretalitnoisa counterretalitnoais counterretalitnoasi counterretalitnosai counterretalitnosia
counterretalitnaois counterretalitnaosi counterretalitnaios counterretalitnaiso counterretalitnasio counterretalitnasoi
counterretalitnsoai counterretalitnsoia counterretalitnsaoi counterretalitnsaio counterretalitnsiao counterretalitnsioa
counterretalitsiona counterretalitsioan counterretalitsinoa counterretalitsinao counterretalitsiano counterretalitsiaon
counterretalitsoina counterretalitsoian counterretalitsonia counterretalitsonai counterretalitsoani counterretalitsoain
counterretalitsnoia counterretalitsnoai counterretalitsnioa counterretalitsniao counterretalitsnaio counterretalitsnaoi
counterretalitsaoni counterretalitsaoin counterretalitsanoi counterretalitsanio counterretalitsaino counterretalitsaion
counterretaliitaons counterretaliitaosn counterretaliitanos counterretaliitanso counterretaliitasno counterretaliitason
counterretaliitoans counterretaliitoasn counterretaliitonas counterretaliitonsa counterretaliitosna counterretaliitosan
counterretaliitnoas counterretaliitnosa counterretaliitnaos counterretaliitnaso counterretaliitnsao counterretaliitnsoa
counterretaliitsona counterretaliitsoan counterretaliitsnoa counterretaliitsnao counterretaliitsano counterretaliitsaon
counterretaliiatons counterretaliiatosn counterretaliiatnos counterretaliiatnso counterretaliiatsno counterretaliiatson
counterretaliiaotns counterretaliiaotsn counterretaliiaonts counterretaliiaonst counterretaliiaosnt counterretaliiaostn
counterretaliianots counterretaliianost counterretaliiantos counterretaliiantso counterretaliiansto counterretaliiansot
counterretaliiasont counterretaliiasotn counterretaliiasnot counterretaliiasnto counterretaliiastno counterretaliiaston
counterretaliioatns counterretaliioatsn counterretaliioants counterretaliioanst counterretaliioasnt counterretaliioastn
counterretaliiotans counterretaliiotasn counterretaliiotnas counterretaliiotnsa counterretaliiotsna counterretaliiotsan
counterretaliiontas counterretaliiontsa counterretaliionats counterretaliionast counterretaliionsat counterretaliionsta
counterretaliiostna counterretaliiostan counterretaliiosnta counterretaliiosnat counterretaliiosant counterretaliiosatn
counterretaliinaots counterretaliinaost counterretaliinatos counterretaliinatso counterretaliinasto counterretaliinasot
counterretaliinoats counterretaliinoast counterretaliinotas counterretaliinotsa counterretaliinosta counterretaliinosat
counterretaliintoas counterretaliintosa counterretaliintaos counterretaliintaso counterretaliintsao counterretaliintsoa
counterretaliinsota counterretaliinsoat counterretaliinstoa counterretaliinstao counterretaliinsato counterretaliinsaot
counterretaliisaont counterretaliisaotn counterretaliisanot counterretaliisanto counterretaliisatno counterretaliisaton
counterretaliisoant counterretaliisoatn counterretaliisonat counterretaliisonta counterretaliisotna counterretaliisotan
counterretaliisnoat counterretaliisnota counterretaliisnaot counterretaliisnato counterretaliisntao counterretaliisntoa
counterretaliistona counterretaliistoan counterretaliistnoa counterretaliistnao counterretaliistano counterretaliistaon
counterretaliotians counterretaliotiasn counterretaliotinas counterretaliotinsa counterretaliotisna counterretaliotisan
counterretaliotains counterretaliotaisn counterretaliotanis counterretaliotansi counterretaliotasni counterretaliotasin
counterretaliotnais counterretaliotnasi counterretaliotnias counterretaliotnisa counterretaliotnsia counterretaliotnsai
counterretaliotsani counterretaliotsain counterretaliotsnai counterretaliotsnia counterretaliotsina counterretaliotsian
counterretalioitans counterretalioitasn counterretalioitnas counterretalioitnsa counterretalioitsna counterretalioitsan
counterretalioiatns counterretalioiatsn counterretalioiants counterretalioianst counterretalioiasnt counterretalioiastn
counterretalioinats counterretalioinast counterretaliointas counterretaliointsa counterretalioinsta counterretalioinsat
counterretalioisant counterretalioisatn counterretalioisnat counterretalioisnta counterretalioistna counterretalioistan
counterretalioaitns counterretalioaitsn counterretalioaints counterretalioainst counterretalioaisnt counterretalioaistn
counterretalioatins counterretalioatisn counterretalioatnis counterretalioatnsi counterretalioatsni counterretalioatsin
counterretalioantis counterretalioantsi counterretalioanits counterretalioanist counterretalioansit counterretalioansti
counterretalioastni counterretalioastin counterretalioasnti counterretalioasnit counterretalioasint counterretalioasitn
counterretalioniats counterretalioniast counterretalionitas counterretalionitsa counterretalionista counterretalionisat
counterretalionaits counterretalionaist counterretalionatis counterretalionatsi counterretalionasti counterretalionasit
counterretaliontais counterretaliontasi counterretaliontias counterretaliontisa counterretaliontsia counterretaliontsai
counterretalionsati counterretalionsait counterretalionstai counterretalionstia counterretalionsita counterretalionsiat
counterretaliosiant counterretaliosiatn counterretaliosinat counterretaliosinta counterretaliositna counterretaliositan
counterretaliosaint counterretaliosaitn counterretaliosanit counterretaliosanti counterretaliosatni counterretaliosatin
counterretaliosnait counterretaliosnati counterretaliosniat counterretaliosnita counterretaliosntia counterretaliosntai
counterretaliostani counterretaliostain counterretaliostnai counterretaliostnia counterretaliostina counterretaliostian
counterretalintioas counterretalintiosa counterretalintiaos counterretalintiaso counterretalintisao counterretalintisoa
counterretalintoias counterretalintoisa counterretalintoais counterretalintoasi counterretalintosai counterretalintosia
counterretalintaois counterretalintaosi counterretalintaios counterretalintaiso counterretalintasio counterretalintasoi
counterretalintsoai counterretalintsoia counterretalintsaoi counterretalintsaio counterretalintsiao counterretalintsioa
counterretalinitoas counterretalinitosa counterretalinitaos counterretalinitaso counterretalinitsao counterretalinitsoa
counterretaliniotas counterretaliniotsa counterretalinioats counterretalinioast counterretaliniosat counterretaliniosta
counterretaliniaots counterretaliniaost counterretaliniatos counterretaliniatso counterretaliniasto counterretaliniasot
counterretalinisoat counterretalinisota counterretalinisaot counterretalinisato counterretalinistao counterretalinistoa
counterretalinoitas counterretalinoitsa counterretalinoiats counterretalinoiast counterretalinoisat counterretalinoista
counterretalinotias counterretalinotisa counterretalinotais counterretalinotasi counterretalinotsai counterretalinotsia
counterretalinoatis counterretalinoatsi counterretalinoaits counterretalinoaist counterretalinoasit counterretalinoasti
counterretalinostai counterretalinostia counterretalinosati counterretalinosait counterretalinosiat counterretalinosita
counterretalinaiots counterretalinaiost counterretalinaitos counterretalinaitso counterretalinaisto counterretalinaisot
counterretalinaoits counterretalinaoist counterretalinaotis counterretalinaotsi counterretalinaosti counterretalinaosit
counterretalinatois counterretalinatosi counterretalinatios counterretalinatiso counterretalinatsio counterretalinatsoi
counterretalinasoti counterretalinasoit counterretalinastoi counterretalinastio counterretalinasito counterretalinasiot
counterretalinsioat counterretalinsiota counterretalinsiaot counterretalinsiato counterretalinsitao counterretalinsitoa
counterretalinsoiat counterretalinsoita counterretalinsoait counterretalinsoati counterretalinsotai counterretalinsotia
counterretalinsaoit counterretalinsaoti counterretalinsaiot counterretalinsaito counterretalinsatio counterretalinsatoi
counterretalinstoai counterretalinstoia counterretalinstaoi counterretalinstaio counterretalinstiao counterretalinstioa
counterretalistiona counterretalistioan counterretalistinoa counterretalistinao counterretalistiano counterretalistiaon
counterretalistoina counterretalistoian counterretalistonia counterretalistonai counterretalistoani counterretalistoain
counterretalistnoia counterretalistnoai counterretalistnioa counterretalistniao counterretalistnaio counterretalistnaoi
counterretalistaoni counterretalistaoin counterretalistanoi counterretalistanio counterretalistaino counterretalistaion
counterretalisitona counterretalisitoan counterretalisitnoa counterretalisitnao counterretalisitano counterretalisitaon
counterretalisiotna counterretalisiotan counterretalisionta counterretalisionat counterretalisioant counterretalisioatn
counterretalisinota counterretalisinoat counterretalisintoa counterretalisintao counterretalisinato counterretalisinaot
counterretalisiaont counterretalisiaotn counterretalisianot counterretalisianto counterretalisiatno counterretalisiaton
counterretalisoitna counterretalisoitan counterretalisointa counterretalisoinat counterretalisoiant counterretalisoiatn
counterretalisotina counterretalisotian counterretalisotnia counterretalisotnai counterretalisotani counterretalisotain
counterretalisontia counterretalisontai counterretalisonita counterretalisoniat counterretalisonait counterretalisonati
counterretalisoatni counterretalisoatin counterretalisoanti counterretalisoanit counterretalisoaint counterretalisoaitn
counterretalisniota counterretalisnioat counterretalisnitoa counterretalisnitao counterretalisniato counterretalisniaot
counterretalisnoita counterretalisnoiat counterretalisnotia counterretalisnotai counterretalisnoati counterretalisnoait
counterretalisntoia counterretalisntoai counterretalisntioa counterretalisntiao counterretalisntaio counterretalisntaoi
counterretalisnaoti counterretalisnaoit counterretalisnatoi counterretalisnatio counterretalisnaito counterretalisnaiot
counterretalisaiont counterretalisaiotn counterretalisainot counterretalisainto counterretalisaitno counterretalisaiton
counterretalisaoint counterretalisaoitn counterretalisaonit counterretalisaonti counterretalisaotni counterretalisaotin
counterretalisanoit counterretalisanoti counterretalisaniot counterretalisanito counterretalisantio counterretalisantoi
counterretalisatoni counterretalisatoin counterretalisatnoi counterretalisatnio counterretalisatino counterretalisation
counterretalaitions counterretalaitiosn counterretalaitinos counterretalaitinso counterretalaitisno counterretalaitison
counterretalaitoins counterretalaitoisn counterretalaitonis counterretalaitonsi counterretalaitosni counterretalaitosin
counterretalaitnois counterretalaitnosi counterretalaitnios counterretalaitniso counterretalaitnsio counterretalaitnsoi
counterretalaitsoni counterretalaitsoin counterretalaitsnoi counterretalaitsnio counterretalaitsino counterretalaitsion
counterretalaiitons counterretalaiitosn counterretalaiitnos counterretalaiitnso counterretalaiitsno counterretalaiitson
counterretalaiiotns counterretalaiiotsn counterretalaiionts counterretalaiionst counterretalaiiosnt counterretalaiiostn
counterretalaiinots counterretalaiinost counterretalaiintos counterretalaiintso counterretalaiinsto counterretalaiinsot
counterretalaiisont counterretalaiisotn counterretalaiisnot counterretalaiisnto counterretalaiistno counterretalaiiston
counterretalaioitns counterretalaioitsn counterretalaioints counterretalaioinst counterretalaioisnt counterretalaioistn
counterretalaiotins counterretalaiotisn counterretalaiotnis counterretalaiotnsi counterretalaiotsni counterretalaiotsin
counterretalaiontis counterretalaiontsi counterretalaionits counterretalaionist counterretalaionsit counterretalaionsti
counterretalaiostni counterretalaiostin counterretalaiosnti counterretalaiosnit counterretalaiosint counterretalaiositn
counterretalainiots counterretalainiost counterretalainitos counterretalainitso counterretalainisto counterretalainisot
counterretalainoits counterretalainoist counterretalainotis counterretalainotsi counterretalainosti counterretalainosit
counterretalaintois counterretalaintosi counterretalaintios counterretalaintiso counterretalaintsio counterretalaintsoi
counterretalainsoti counterretalainsoit counterretalainstoi counterretalainstio counterretalainsito counterretalainsiot
counterretalaisiont counterretalaisiotn counterretalaisinot counterretalaisinto counterretalaisitno counterretalaisiton
counterretalaisoint counterretalaisoitn counterretalaisonit counterretalaisonti counterretalaisotni counterretalaisotin
counterretalaisnoit counterretalaisnoti counterretalaisniot counterretalaisnito counterretalaisntio counterretalaisntoi
counterretalaistoni counterretalaistoin counterretalaistnoi counterretalaistnio counterretalaistino counterretalaistion
counterretalatiions counterretalatiiosn counterretalatiinos counterretalatiinso counterretalatiisno counterretalatiison
counterretalatioins counterretalatioisn counterretalationis counterretalationsi counterretalatiosni counterretalatiosin
counterretalatinois counterretalatinosi counterretalatinios counterretalatiniso counterretalatinsio counterretalatinsoi
counterretalatisoni counterretalatisoin counterretalatisnoi counterretalatisnio counterretalatisino counterretalatision
counterretalatiions counterretalatiiosn counterretalatiinos counterretalatiinso counterretalatiisno counterretalatiison
counterretalatioins counterretalatioisn counterretalationis counterretalationsi counterretalatiosni counterretalatiosin
counterretalatinois counterretalatinosi counterretalatinios counterretalatiniso counterretalatinsio counterretalatinsoi
counterretalatisoni counterretalatisoin counterretalatisnoi counterretalatisnio counterretalatisino counterretalatision
counterretalatoiins counterretalatoiisn counterretalatoinis counterretalatoinsi counterretalatoisni counterretalatoisin
counterretalatoiins counterretalatoiisn counterretalatoinis counterretalatoinsi counterretalatoisni counterretalatoisin
counterretalatoniis counterretalatonisi counterretalatoniis counterretalatonisi counterretalatonsii counterretalatonsii
counterretalatosini counterretalatosiin counterretalatosnii counterretalatosnii counterretalatosini counterretalatosiin
counterretalatniois counterretalatniosi counterretalatniios counterretalatniiso counterretalatnisio counterretalatnisoi
counterretalatnoiis counterretalatnoisi counterretalatnoiis counterretalatnoisi counterretalatnosii counterretalatnosii
counterretalatniois counterretalatniosi counterretalatniios counterretalatniiso counterretalatnisio counterretalatnisoi
counterretalatnsoii counterretalatnsoii counterretalatnsioi counterretalatnsiio counterretalatnsiio counterretalatnsioi
counterretalatsioni counterretalatsioin counterretalatsinoi counterretalatsinio counterretalatsiino counterretalatsiion
counterretalatsoini counterretalatsoiin counterretalatsonii counterretalatsonii counterretalatsoini counterretalatsoiin
counterretalatsnoii counterretalatsnoii counterretalatsnioi counterretalatsniio counterretalatsniio counterretalatsnioi
counterretalatsioni counterretalatsioin counterretalatsinoi counterretalatsinio counterretalatsiino counterretalatsiion
counterretalaitions counterretalaitiosn counterretalaitinos counterretalaitinso counterretalaitisno counterretalaitison
counterretalaitoins counterretalaitoisn counterretalaitonis counterretalaitonsi counterretalaitosni counterretalaitosin
counterretalaitnois counterretalaitnosi counterretalaitnios counterretalaitniso counterretalaitnsio counterretalaitnsoi
counterretalaitsoni counterretalaitsoin counterretalaitsnoi counterretalaitsnio counterretalaitsino counterretalaitsion
counterretalaiitons counterretalaiitosn counterretalaiitnos counterretalaiitnso counterretalaiitsno counterretalaiitson
counterretalaiiotns counterretalaiiotsn counterretalaiionts counterretalaiionst counterretalaiiosnt counterretalaiiostn
counterretalaiinots counterretalaiinost counterretalaiintos counterretalaiintso counterretalaiinsto counterretalaiinsot
counterretalaiisont counterretalaiisotn counterretalaiisnot counterretalaiisnto counterretalaiistno counterretalaiiston
counterretalaioitns counterretalaioitsn counterretalaioints counterretalaioinst counterretalaioisnt counterretalaioistn
counterretalaiotins counterretalaiotisn counterretalaiotnis counterretalaiotnsi counterretalaiotsni counterretalaiotsin
counterretalaiontis counterretalaiontsi counterretalaionits counterretalaionist counterretalaionsit counterretalaionsti
counterretalaiostni counterretalaiostin counterretalaiosnti counterretalaiosnit counterretalaiosint counterretalaiositn
counterretalainiots counterretalainiost counterretalainitos counterretalainitso counterretalainisto counterretalainisot
counterretalainoits counterretalainoist counterretalainotis counterretalainotsi counterretalainosti counterretalainosit
counterretalaintois counterretalaintosi counterretalaintios counterretalaintiso counterretalaintsio counterretalaintsoi
counterretalainsoti counterretalainsoit counterretalainstoi counterretalainstio counterretalainsito counterretalainsiot
counterretalaisiont counterretalaisiotn counterretalaisinot counterretalaisinto counterretalaisitno counterretalaisiton
counterretalaisoint counterretalaisoitn counterretalaisonit counterretalaisonti counterretalaisotni counterretalaisotin
counterretalaisnoit counterretalaisnoti counterretalaisniot counterretalaisnito counterretalaisntio counterretalaisntoi
counterretalaistoni counterretalaistoin counterretalaistnoi counterretalaistnio counterretalaistino counterretalaistion
counterretalaotiins counterretalaotiisn counterretalaotinis counterretalaotinsi counterretalaotisni counterretalaotisin
counterretalaotiins counterretalaotiisn counterretalaotinis counterretalaotinsi counterretalaotisni counterretalaotisin
counterretalaotniis counterretalaotnisi counterretalaotniis counterretalaotnisi counterretalaotnsii counterretalaotnsii
counterretalaotsini counterretalaotsiin counterretalaotsnii counterretalaotsnii counterretalaotsini counterretalaotsiin
counterretalaoitins counterretalaoitisn counterretalaoitnis counterretalaoitnsi counterretalaoitsni counterretalaoitsin
counterretalaoiitns counterretalaoiitsn counterretalaoiints counterretalaoiinst counterretalaoiisnt counterretalaoiistn
counterretalaoinits counterretalaoinist counterretalaointis counterretalaointsi counterretalaoinsti counterretalaoinsit
counterretalaoisint counterretalaoisitn counterretalaoisnit counterretalaoisnti counterretalaoistni counterretalaoistin
counterretalaoiitns counterretalaoiitsn counterretalaoiints counterretalaoiinst counterretalaoiisnt counterretalaoiistn
counterretalaoitins counterretalaoitisn counterretalaoitnis counterretalaoitnsi counterretalaoitsni counterretalaoitsin
counterretalaointis counterretalaointsi counterretalaoinits counterretalaoinist counterretalaoinsit counterretalaoinsti
counterretalaoistni counterretalaoistin counterretalaoisnti counterretalaoisnit counterretalaoisint counterretalaoisitn
counterretalaoniits counterretalaoniist counterretalaonitis counterretalaonitsi counterretalaonisti counterretalaonisit
counterretalaoniits counterretalaoniist counterretalaonitis counterretalaonitsi counterretalaonisti counterretalaonisit
counterretalaontiis counterretalaontisi counterretalaontiis counterretalaontisi counterretalaontsii counterretalaontsii
counterretalaonsiti counterretalaonsiit counterretalaonstii counterretalaonstii counterretalaonsiti counterretalaonsiit
counterretalaosiint counterretalaosiitn counterretalaosinit counterretalaosinti counterretalaositni counterretalaositin
counterretalaosiint counterretalaosiitn counterretalaosinit counterretalaosinti counterretalaositni counterretalaositin
counterretalaosniit counterretalaosniti counterretalaosniit counterretalaosniti counterretalaosntii counterretalaosntii
counterretalaostini counterretalaostiin counterretalaostnii counterretalaostnii counterretalaostini counterretalaostiin
counterretalantiois counterretalantiosi counterretalantiios counterretalantiiso counterretalantisio counterretalantisoi
counterretalantoiis counterretalantoisi counterretalantoiis counterretalantoisi counterretalantosii counterretalantosii
counterretalantiois counterretalantiosi counterretalantiios counterretalantiiso counterretalantisio counterretalantisoi
counterretalantsoii counterretalantsoii counterretalantsioi counterretalantsiio counterretalantsiio counterretalantsioi
counterretalanitois counterretalanitosi counterretalanitios counterretalanitiso counterretalanitsio counterretalanitsoi
counterretalaniotis counterretalaniotsi counterretalanioits counterretalanioist counterretalaniosit counterretalaniosti
counterretalaniiots counterretalaniiost counterretalaniitos counterretalaniitso counterretalaniisto counterretalaniisot
counterretalanisoit counterretalanisoti counterretalanisiot counterretalanisito counterretalanistio counterretalanistoi
counterretalanoitis counterretalanoitsi counterretalanoiits counterretalanoiist counterretalanoisit counterretalanoisti
counterretalanotiis counterretalanotisi counterretalanotiis counterretalanotisi counterretalanotsii counterretalanotsii
counterretalanoitis counterretalanoitsi counterretalanoiits counterretalanoiist counterretalanoisit counterretalanoisti
counterretalanostii counterretalanostii counterretalanositi counterretalanosiit counterretalanosiit counterretalanositi
counterretalaniiots counterretalaniiost counterretalaniitos counterretalaniitso counterretalaniisto counterretalaniisot
counterretalanioits counterretalanioist counterretalaniotis counterretalaniotsi counterretalaniosti counterretalaniosit
counterretalanitois counterretalanitosi counterretalanitios counterretalanitiso counterretalanitsio counterretalanitsoi
counterretalanisoti counterretalanisoit counterretalanistoi counterretalanistio counterretalanisito counterretalanisiot
counterretalansioit counterretalansioti counterretalansiiot counterretalansiito counterretalansitio counterretalansitoi
counterretalansoiit counterretalansoiti counterretalansoiit counterretalansoiti counterretalansotii counterretalansotii
counterretalansioit counterretalansioti counterretalansiiot counterretalansiito counterretalansitio counterretalansitoi
counterretalanstoii counterretalanstoii counterretalanstioi counterretalanstiio counterretalanstiio counterretalanstioi
counterretalastioni counterretalastioin counterretalastinoi counterretalastinio counterretalastiino counterretalastiion
counterretalastoini counterretalastoiin counterretalastonii counterretalastonii counterretalastoini counterretalastoiin
counterretalastnoii counterretalastnoii counterretalastnioi counterretalastniio counterretalastniio counterretalastnioi
counterretalastioni counterretalastioin counterretalastinoi counterretalastinio counterretalastiino counterretalastiion
counterretalasitoni counterretalasitoin counterretalasitnoi counterretalasitnio counterretalasitino counterretalasition
counterretalasiotni counterretalasiotin counterretalasionti counterretalasionit counterretalasioint counterretalasioitn
counterretalasinoti counterretalasinoit counterretalasintoi counterretalasintio counterretalasinito counterretalasiniot
counterretalasiiont counterretalasiiotn counterretalasiinot counterretalasiinto counterretalasiitno counterretalasiiton
counterretalasoitni counterretalasoitin counterretalasointi counterretalasoinit counterretalasoiint counterretalasoiitn
counterretalasotini counterretalasotiin counterretalasotnii counterretalasotnii counterretalasotini counterretalasotiin
counterretalasontii counterretalasontii counterretalasoniti counterretalasoniit counterretalasoniit counterretalasoniti
counterretalasoitni counterretalasoitin counterretalasointi counterretalasoinit counterretalasoiint counterretalasoiitn
counterretalasnioti counterretalasnioit counterretalasnitoi counterretalasnitio counterretalasniito counterretalasniiot
counterretalasnoiti counterretalasnoiit counterretalasnotii counterretalasnotii counterretalasnoiti counterretalasnoiit
counterretalasntoii counterretalasntoii counterretalasntioi counterretalasntiio counterretalasntiio counterretalasntioi
counterretalasnioti counterretalasnioit counterretalasnitoi counterretalasnitio counterretalasniito counterretalasniiot
counterretalasiiont counterretalasiiotn counterretalasiinot counterretalasiinto counterretalasiitno counterretalasiiton
counterretalasioint counterretalasioitn counterretalasionit counterretalasionti counterretalasiotni counterretalasiotin
counterretalasinoit counterretalasinoti counterretalasiniot counterretalasinito counterretalasintio counterretalasintoi
counterretalasitoni counterretalasitoin counterretalasitnoi counterretalasitnio counterretalasitino counterretalasition
counterretaltaiions counterretaltaiiosn counterretaltaiinos counterretaltaiinso counterretaltaiisno counterretaltaiison
counterretaltaioins counterretaltaioisn counterretaltaionis counterretaltaionsi counterretaltaiosni counterretaltaiosin
counterretaltainois counterretaltainosi counterretaltainios counterretaltainiso counterretaltainsio counterretaltainsoi
counterretaltaisoni counterretaltaisoin counterretaltaisnoi counterretaltaisnio counterretaltaisino counterretaltaision
counterretaltaiions counterretaltaiiosn counterretaltaiinos counterretaltaiinso counterretaltaiisno counterretaltaiison
counterretaltaioins counterretaltaioisn counterretaltaionis counterretaltaionsi counterretaltaiosni counterretaltaiosin
counterretaltainois counterretaltainosi counterretaltainios counterretaltainiso counterretaltainsio counterretaltainsoi
counterretaltaisoni counterretaltaisoin counterretaltaisnoi counterretaltaisnio counterretaltaisino counterretaltaision
counterretaltaoiins counterretaltaoiisn counterretaltaoinis counterretaltaoinsi counterretaltaoisni counterretaltaoisin
counterretaltaoiins counterretaltaoiisn counterretaltaoinis counterretaltaoinsi counterretaltaoisni counterretaltaoisin
counterretaltaoniis counterretaltaonisi counterretaltaoniis counterretaltaonisi counterretaltaonsii counterretaltaonsii
counterretaltaosini counterretaltaosiin counterretaltaosnii counterretaltaosnii counterretaltaosini counterretaltaosiin
counterretaltaniois counterretaltaniosi counterretaltaniios counterretaltaniiso counterretaltanisio counterretaltanisoi
counterretaltanoiis counterretaltanoisi counterretaltanoiis counterretaltanoisi counterretaltanosii counterretaltanosii
counterretaltaniois counterretaltaniosi counterretaltaniios counterretaltaniiso counterretaltanisio counterretaltanisoi
counterretaltansoii counterretaltansoii counterretaltansioi counterretaltansiio counterretaltansiio counterretaltansioi
counterretaltasioni counterretaltasioin counterretaltasinoi counterretaltasinio counterretaltasiino counterretaltasiion
counterretaltasoini counterretaltasoiin counterretaltasonii counterretaltasonii counterretaltasoini counterretaltasoiin
counterretaltasnoii counterretaltasnoii counterretaltasnioi counterretaltasniio counterretaltasniio counterretaltasnioi
counterretaltasioni counterretaltasioin counterretaltasinoi counterretaltasinio counterretaltasiino counterretaltasiion
counterretaltiaions counterretaltiaiosn counterretaltiainos counterretaltiainso counterretaltiaisno counterretaltiaison
counterretaltiaoins counterretaltiaoisn counterretaltiaonis counterretaltiaonsi counterretaltiaosni counterretaltiaosin
counterretaltianois counterretaltianosi counterretaltianios counterretaltianiso counterretaltiansio counterretaltiansoi
counterretaltiasoni counterretaltiasoin counterretaltiasnoi counterretaltiasnio counterretaltiasino counterretaltiasion
counterretaltiiaons counterretaltiiaosn counterretaltiianos counterretaltiianso counterretaltiiasno counterretaltiiason
counterretaltiioans counterretaltiioasn counterretaltiionas counterretaltiionsa counterretaltiiosna counterretaltiiosan
counterretaltiinoas counterretaltiinosa counterretaltiinaos counterretaltiinaso counterretaltiinsao counterretaltiinsoa
counterretaltiisona counterretaltiisoan counterretaltiisnoa counterretaltiisnao counterretaltiisano counterretaltiisaon
counterretaltioians counterretaltioiasn counterretaltioinas counterretaltioinsa counterretaltioisna counterretaltioisan
counterretaltioains counterretaltioaisn counterretaltioanis counterretaltioansi counterretaltioasni counterretaltioasin
counterretaltionais counterretaltionasi counterretaltionias counterretaltionisa counterretaltionsia counterretaltionsai
counterretaltiosani counterretaltiosain counterretaltiosnai counterretaltiosnia counterretaltiosina counterretaltiosian
counterretaltinioas counterretaltiniosa counterretaltiniaos counterretaltiniaso counterretaltinisao counterretaltinisoa
counterretaltinoias counterretaltinoisa counterretaltinoais counterretaltinoasi counterretaltinosai counterretaltinosia
counterretaltinaois counterretaltinaosi counterretaltinaios counterretaltinaiso counterretaltinasio counterretaltinasoi
counterretaltinsoai counterretaltinsoia counterretaltinsaoi counterretaltinsaio counterretaltinsiao counterretaltinsioa
counterretaltisiona counterretaltisioan counterretaltisinoa counterretaltisinao counterretaltisiano counterretaltisiaon
counterretaltisoina counterretaltisoian counterretaltisonia counterretaltisonai counterretaltisoani counterretaltisoain
counterretaltisnoia counterretaltisnoai counterretaltisnioa counterretaltisniao counterretaltisnaio counterretaltisnaoi
counterretaltisaoni counterretaltisaoin counterretaltisanoi counterretaltisanio counterretaltisaino counterretaltisaion
counterretaltiiaons counterretaltiiaosn counterretaltiianos counterretaltiianso counterretaltiiasno counterretaltiiason
counterretaltiioans counterretaltiioasn counterretaltiionas counterretaltiionsa counterretaltiiosna counterretaltiiosan
counterretaltiinoas counterretaltiinosa counterretaltiinaos counterretaltiinaso counterretaltiinsao counterretaltiinsoa
counterretaltiisona counterretaltiisoan counterretaltiisnoa counterretaltiisnao counterretaltiisano counterretaltiisaon
counterretaltiaions counterretaltiaiosn counterretaltiainos counterretaltiainso counterretaltiaisno counterretaltiaison
counterretaltiaoins counterretaltiaoisn counterretaltiaonis counterretaltiaonsi counterretaltiaosni counterretaltiaosin
counterretaltianois counterretaltianosi counterretaltianios counterretaltianiso counterretaltiansio counterretaltiansoi
counterretaltiasoni counterretaltiasoin counterretaltiasnoi counterretaltiasnio counterretaltiasino counterretaltiasion
counterretaltioains counterretaltioaisn counterretaltioanis counterretaltioansi counterretaltioasni counterretaltioasin
counterretaltioians counterretaltioiasn counterretaltioinas counterretaltioinsa counterretaltioisna counterretaltioisan
counterretaltionias counterretaltionisa counterretaltionais counterretaltionasi counterretaltionsai counterretaltionsia
counterretaltiosina counterretaltiosian counterretaltiosnia counterretaltiosnai counterretaltiosani counterretaltiosain
counterretaltinaois counterretaltinaosi counterretaltinaios counterretaltinaiso counterretaltinasio counterretaltinasoi
counterretaltinoais counterretaltinoasi counterretaltinoias counterretaltinoisa counterretaltinosia counterretaltinosai
counterretaltinioas counterretaltiniosa counterretaltiniaos counterretaltiniaso counterretaltinisao counterretaltinisoa
counterretaltinsoia counterretaltinsoai counterretaltinsioa counterretaltinsiao counterretaltinsaio counterretaltinsaoi
counterretaltisaoni counterretaltisaoin counterretaltisanoi counterretaltisanio counterretaltisaino counterretaltisaion
counterretaltisoani counterretaltisoain counterretaltisonai counterretaltisonia counterretaltisoina counterretaltisoian
counterretaltisnoai counterretaltisnoia counterretaltisnaoi counterretaltisnaio counterretaltisniao counterretaltisnioa
counterretaltisiona counterretaltisioan counterretaltisinoa counterretaltisinao counterretaltisiano counterretaltisiaon
counterretaltoiians counterretaltoiiasn counterretaltoiinas counterretaltoiinsa counterretaltoiisna counterretaltoiisan
counterretaltoiains counterretaltoiaisn counterretaltoianis counterretaltoiansi counterretaltoiasni counterretaltoiasin
counterretaltoinais counterretaltoinasi counterretaltoinias counterretaltoinisa counterretaltoinsia counterretaltoinsai
counterretaltoisani counterretaltoisain counterretaltoisnai counterretaltoisnia counterretaltoisina counterretaltoisian
counterretaltoiians counterretaltoiiasn counterretaltoiinas counterretaltoiinsa counterretaltoiisna counterretaltoiisan
counterretaltoiains counterretaltoiaisn counterretaltoianis counterretaltoiansi counterretaltoiasni counterretaltoiasin
counterretaltoinais counterretaltoinasi counterretaltoinias counterretaltoinisa counterretaltoinsia counterretaltoinsai
counterretaltoisani counterretaltoisain counterretaltoisnai counterretaltoisnia counterretaltoisina counterretaltoisian
counterretaltoaiins counterretaltoaiisn counterretaltoainis counterretaltoainsi counterretaltoaisni counterretaltoaisin
counterretaltoaiins counterretaltoaiisn counterretaltoainis counterretaltoainsi counterretaltoaisni counterretaltoaisin
counterretaltoaniis counterretaltoanisi counterretaltoaniis counterretaltoanisi counterretaltoansii counterretaltoansii
counterretaltoasini counterretaltoasiin counterretaltoasnii counterretaltoasnii counterretaltoasini counterretaltoasiin
counterretaltoniais counterretaltoniasi counterretaltoniias counterretaltoniisa counterretaltonisia counterretaltonisai
counterretaltonaiis counterretaltonaisi counterretaltonaiis counterretaltonaisi counterretaltonasii counterretaltonasii
counterretaltoniais counterretaltoniasi counterretaltoniias counterretaltoniisa counterretaltonisia counterretaltonisai
counterretaltonsaii counterretaltonsaii counterretaltonsiai counterretaltonsiia counterretaltonsiia counterretaltonsiai
counterretaltosiani counterretaltosiain counterretaltosinai counterretaltosinia counterretaltosiina counterretaltosiian
counterretaltosaini counterretaltosaiin counterretaltosanii counterretaltosanii counterretaltosaini counterretaltosaiin
counterretaltosnaii counterretaltosnaii counterretaltosniai counterretaltosniia counterretaltosniia counterretaltosniai
counterretaltosiani counterretaltosiain counterretaltosinai counterretaltosinia counterretaltosiina counterretaltosiian
counterretaltniioas counterretaltniiosa counterretaltniiaos counterretaltniiaso counterretaltniisao counterretaltniisoa
counterretaltnioias counterretaltnioisa counterretaltnioais counterretaltnioasi counterretaltniosai counterretaltniosia
counterretaltniaois counterretaltniaosi counterretaltniaios counterretaltniaiso counterretaltniasio counterretaltniasoi
counterretaltnisoai counterretaltnisoia counterretaltnisaoi counterretaltnisaio counterretaltnisiao counterretaltnisioa
counterretaltniioas counterretaltniiosa counterretaltniiaos counterretaltniiaso counterretaltniisao counterretaltniisoa
counterretaltnioias counterretaltnioisa counterretaltnioais counterretaltnioasi counterretaltniosai counterretaltniosia
counterretaltniaois counterretaltniaosi counterretaltniaios counterretaltniaiso counterretaltniasio counterretaltniasoi
counterretaltnisoai counterretaltnisoia counterretaltnisaoi counterretaltnisaio counterretaltnisiao counterretaltnisioa
counterretaltnoiias counterretaltnoiisa counterretaltnoiais counterretaltnoiasi counterretaltnoisai counterretaltnoisia
counterretaltnoiias counterretaltnoiisa counterretaltnoiais counterretaltnoiasi counterretaltnoisai counterretaltnoisia
counterretaltnoaiis counterretaltnoaisi counterretaltnoaiis counterretaltnoaisi counterretaltnoasii counterretaltnoasii
counterretaltnosiai counterretaltnosiia counterretaltnosaii counterretaltnosaii counterretaltnosiai counterretaltnosiia
counterretaltnaiois counterretaltnaiosi counterretaltnaiios counterretaltnaiiso counterretaltnaisio counterretaltnaisoi
counterretaltnaoiis counterretaltnaoisi counterretaltnaoiis counterretaltnaoisi counterretaltnaosii counterretaltnaosii
counterretaltnaiois counterretaltnaiosi counterretaltnaiios counterretaltnaiiso counterretaltnaisio counterretaltnaisoi
counterretaltnasoii counterretaltnasoii counterretaltnasioi counterretaltnasiio counterretaltnasiio counterretaltnasioi
counterretaltnsioai counterretaltnsioia counterretaltnsiaoi counterretaltnsiaio counterretaltnsiiao counterretaltnsiioa
counterretaltnsoiai counterretaltnsoiia counterretaltnsoaii counterretaltnsoaii counterretaltnsoiai counterretaltnsoiia
counterretaltnsaoii counterretaltnsaoii counterretaltnsaioi counterretaltnsaiio counterretaltnsaiio counterretaltnsaioi
counterretaltnsioai counterretaltnsioia counterretaltnsiaoi counterretaltnsiaio counterretaltnsiiao counterretaltnsiioa
counterretaltsiiona counterretaltsiioan counterretaltsiinoa counterretaltsiinao counterretaltsiiano counterretaltsiiaon
counterretaltsioina counterretaltsioian counterretaltsionia counterretaltsionai counterretaltsioani counterretaltsioain
counterretaltsinoia counterretaltsinoai counterretaltsinioa counterretaltsiniao counterretaltsinaio counterretaltsinaoi
counterretaltsiaoni counterretaltsiaoin counterretaltsianoi counterretaltsianio counterretaltsiaino counterretaltsiaion
counterretaltsiiona counterretaltsiioan counterretaltsiinoa counterretaltsiinao counterretaltsiiano counterretaltsiiaon
counterretaltsioina counterretaltsioian counterretaltsionia counterretaltsionai counterretaltsioani counterretaltsioain
counterretaltsinoia counterretaltsinoai counterretaltsinioa counterretaltsiniao counterretaltsinaio counterretaltsinaoi
counterretaltsiaoni counterretaltsiaoin counterretaltsianoi counterretaltsianio counterretaltsiaino counterretaltsiaion
counterretaltsoiina counterretaltsoiian counterretaltsoinia counterretaltsoinai counterretaltsoiani counterretaltsoiain
counterretaltsoiina counterretaltsoiian counterretaltsoinia counterretaltsoinai counterretaltsoiani counterretaltsoiain
counterretaltsoniia counterretaltsoniai counterretaltsoniia counterretaltsoniai counterretaltsonaii counterretaltsonaii
counterretaltsoaini counterretaltsoaiin counterretaltsoanii counterretaltsoanii counterretaltsoaini counterretaltsoaiin
counterretaltsnioia counterretaltsnioai counterretaltsniioa counterretaltsniiao counterretaltsniaio counterretaltsniaoi
counterretaltsnoiia counterretaltsnoiai counterretaltsnoiia counterretaltsnoiai counterretaltsnoaii counterretaltsnoaii
counterretaltsnioia counterretaltsnioai counterretaltsniioa counterretaltsniiao counterretaltsniaio counterretaltsniaoi
counterretaltsnaoii counterretaltsnaoii counterretaltsnaioi counterretaltsnaiio counterretaltsnaiio counterretaltsnaioi
counterretaltsaioni counterretaltsaioin counterretaltsainoi counterretaltsainio counterretaltsaiino counterretaltsaiion
counterretaltsaoini counterretaltsaoiin counterretaltsaonii counterretaltsaonii counterretaltsaoini counterretaltsaoiin
counterretaltsanoii counterretaltsanoii counterretaltsanioi counterretaltsaniio counterretaltsaniio counterretaltsanioi
counterretaltsaioni counterretaltsaioin counterretaltsainoi counterretaltsainio counterretaltsaiino counterretaltsaiion
counterretaliations counterretaliatiosn counterretaliatinos counterretaliatinso counterretaliatisno counterretaliatison
counterretaliatoins counterretaliatoisn counterretaliatonis counterretaliatonsi counterretaliatosni counterretaliatosin
counterretaliatnois counterretaliatnosi counterretaliatnios counterretaliatniso counterretaliatnsio counterretaliatnsoi
counterretaliatsoni counterretaliatsoin counterretaliatsnoi counterretaliatsnio counterretaliatsino counterretaliatsion
counterretaliaitons counterretaliaitosn counterretaliaitnos counterretaliaitnso counterretaliaitsno counterretaliaitson
counterretaliaiotns counterretaliaiotsn counterretaliaionts counterretaliaionst counterretaliaiosnt counterretaliaiostn
counterretaliainots counterretaliainost counterretaliaintos counterretaliaintso counterretaliainsto counterretaliainsot
counterretaliaisont counterretaliaisotn counterretaliaisnot counterretaliaisnto counterretaliaistno counterretaliaiston
counterretaliaoitns counterretaliaoitsn counterretaliaoints counterretaliaoinst counterretaliaoisnt counterretaliaoistn
counterretaliaotins counterretaliaotisn counterretaliaotnis counterretaliaotnsi counterretaliaotsni counterretaliaotsin
counterretaliaontis counterretaliaontsi counterretaliaonits counterretaliaonist counterretaliaonsit counterretaliaonsti
counterretaliaostni counterretaliaostin counterretaliaosnti counterretaliaosnit counterretaliaosint counterretaliaositn
counterretalianiots counterretalianiost counterretalianitos counterretalianitso counterretalianisto counterretalianisot
counterretalianoits counterretalianoist counterretalianotis counterretalianotsi counterretalianosti counterretalianosit
counterretaliantois counterretaliantosi counterretaliantios counterretaliantiso counterretaliantsio counterretaliantsoi
counterretaliansoti counterretaliansoit counterretalianstoi counterretalianstio counterretaliansito counterretaliansiot
counterretaliasiont counterretaliasiotn counterretaliasinot counterretaliasinto counterretaliasitno counterretaliasiton
counterretaliasoint counterretaliasoitn counterretaliasonit counterretaliasonti counterretaliasotni counterretaliasotin
counterretaliasnoit counterretaliasnoti counterretaliasniot counterretaliasnito counterretaliasntio counterretaliasntoi
counterretaliastoni counterretaliastoin counterretaliastnoi counterretaliastnio counterretaliastino counterretaliastion
counterretalitaions counterretalitaiosn counterretalitainos counterretalitainso counterretalitaisno counterretalitaison
counterretalitaoins counterretalitaoisn counterretalitaonis counterretalitaonsi counterretalitaosni counterretalitaosin
counterretalitanois counterretalitanosi counterretalitanios counterretalitaniso counterretalitansio counterretalitansoi
counterretalitasoni counterretalitasoin counterretalitasnoi counterretalitasnio counterretalitasino counterretalitasion
counterretalitiaons counterretalitiaosn counterretalitianos counterretalitianso counterretalitiasno counterretalitiason
counterretalitioans counterretalitioasn counterretalitionas counterretalitionsa counterretalitiosna counterretalitiosan
counterretalitinoas counterretalitinosa counterretalitinaos counterretalitinaso counterretalitinsao counterretalitinsoa
counterretalitisona counterretalitisoan counterretalitisnoa counterretalitisnao counterretalitisano counterretalitisaon
counterretalitoians counterretalitoiasn counterretalitoinas counterretalitoinsa counterretalitoisna counterretalitoisan
counterretalitoains counterretalitoaisn counterretalitoanis counterretalitoansi counterretalitoasni counterretalitoasin
counterretalitonais counterretalitonasi counterretalitonias counterretalitonisa counterretalitonsia counterretalitonsai
counterretalitosani counterretalitosain counterretalitosnai counterretalitosnia counterretalitosina counterretalitosian
counterretalitnioas counterretalitniosa counterretalitniaos counterretalitniaso counterretalitnisao counterretalitnisoa
counterretalitnoias counterretalitnoisa counterretalitnoais counterretalitnoasi counterretalitnosai counterretalitnosia
counterretalitnaois counterretalitnaosi counterretalitnaios counterretalitnaiso counterretalitnasio counterretalitnasoi
counterretalitnsoai counterretalitnsoia counterretalitnsaoi counterretalitnsaio counterretalitnsiao counterretalitnsioa
counterretalitsiona counterretalitsioan counterretalitsinoa counterretalitsinao counterretalitsiano counterretalitsiaon
counterretalitsoina counterretalitsoian counterretalitsonia counterretalitsonai counterretalitsoani counterretalitsoain
counterretalitsnoia counterretalitsnoai counterretalitsnioa counterretalitsniao counterretalitsnaio counterretalitsnaoi
counterretalitsaoni counterretalitsaoin counterretalitsanoi counterretalitsanio counterretalitsaino counterretalitsaion
counterretaliitaons counterretaliitaosn counterretaliitanos counterretaliitanso counterretaliitasno counterretaliitason
counterretaliitoans counterretaliitoasn counterretaliitonas counterretaliitonsa counterretaliitosna counterretaliitosan
counterretaliitnoas counterretaliitnosa counterretaliitnaos counterretaliitnaso counterretaliitnsao counterretaliitnsoa
counterretaliitsona counterretaliitsoan counterretaliitsnoa counterretaliitsnao counterretaliitsano counterretaliitsaon
counterretaliiatons counterretaliiatosn counterretaliiatnos counterretaliiatnso counterretaliiatsno counterretaliiatson
counterretaliiaotns counterretaliiaotsn counterretaliiaonts counterretaliiaonst counterretaliiaosnt counterretaliiaostn
counterretaliianots counterretaliianost counterretaliiantos counterretaliiantso counterretaliiansto counterretaliiansot
counterretaliiasont counterretaliiasotn counterretaliiasnot counterretaliiasnto counterretaliiastno counterretaliiaston
counterretaliioatns counterretaliioatsn counterretaliioants counterretaliioanst counterretaliioasnt counterretaliioastn
counterretaliiotans counterretaliiotasn counterretaliiotnas counterretaliiotnsa counterretaliiotsna counterretaliiotsan
counterretaliiontas counterretaliiontsa counterretaliionats counterretaliionast counterretaliionsat counterretaliionsta
counterretaliiostna counterretaliiostan counterretaliiosnta counterretaliiosnat counterretaliiosant counterretaliiosatn
counterretaliinaots counterretaliinaost counterretaliinatos counterretaliinatso counterretaliinasto counterretaliinasot
counterretaliinoats counterretaliinoast counterretaliinotas counterretaliinotsa counterretaliinosta counterretaliinosat
counterretaliintoas counterretaliintosa counterretaliintaos counterretaliintaso counterretaliintsao counterretaliintsoa
counterretaliinsota counterretaliinsoat counterretaliinstoa counterretaliinstao counterretaliinsato counterretaliinsaot
counterretaliisaont counterretaliisaotn counterretaliisanot counterretaliisanto counterretaliisatno counterretaliisaton
counterretaliisoant counterretaliisoatn counterretaliisonat counterretaliisonta counterretaliisotna counterretaliisotan
counterretaliisnoat counterretaliisnota counterretaliisnaot counterretaliisnato counterretaliisntao counterretaliisntoa
counterretaliistona counterretaliistoan counterretaliistnoa counterretaliistnao counterretaliistano counterretaliistaon
counterretaliotians counterretaliotiasn counterretaliotinas counterretaliotinsa counterretaliotisna counterretaliotisan
counterretaliotains counterretaliotaisn counterretaliotanis counterretaliotansi counterretaliotasni counterretaliotasin
counterretaliotnais counterretaliotnasi counterretaliotnias counterretaliotnisa counterretaliotnsia counterretaliotnsai
counterretaliotsani counterretaliotsain counterretaliotsnai counterretaliotsnia counterretaliotsina counterretaliotsian
counterretalioitans counterretalioitasn counterretalioitnas counterretalioitnsa counterretalioitsna counterretalioitsan
counterretalioiatns counterretalioiatsn counterretalioiants counterretalioianst counterretalioiasnt counterretalioiastn
counterretalioinats counterretalioinast counterretaliointas counterretaliointsa counterretalioinsta counterretalioinsat
counterretalioisant counterretalioisatn counterretalioisnat counterretalioisnta counterretalioistna counterretalioistan
counterretalioaitns counterretalioaitsn counterretalioaints counterretalioainst counterretalioaisnt counterretalioaistn
counterretalioatins counterretalioatisn counterretalioatnis counterretalioatnsi counterretalioatsni counterretalioatsin
counterretalioantis counterretalioantsi counterretalioanits counterretalioanist counterretalioansit counterretalioansti
counterretalioastni counterretalioastin counterretalioasnti counterretalioasnit counterretalioasint counterretalioasitn
counterretalioniats counterretalioniast counterretalionitas counterretalionitsa counterretalionista counterretalionisat
counterretalionaits counterretalionaist counterretalionatis counterretalionatsi counterretalionasti counterretalionasit
counterretaliontais counterretaliontasi counterretaliontias counterretaliontisa counterretaliontsia counterretaliontsai
counterretalionsati counterretalionsait counterretalionstai counterretalionstia counterretalionsita counterretalionsiat
counterretaliosiant counterretaliosiatn counterretaliosinat counterretaliosinta counterretaliositna counterretaliositan
counterretaliosaint counterretaliosaitn counterretaliosanit counterretaliosanti counterretaliosatni counterretaliosatin
counterretaliosnait counterretaliosnati counterretaliosniat counterretaliosnita counterretaliosntia counterretaliosntai
counterretaliostani counterretaliostain counterretaliostnai counterretaliostnia counterretaliostina counterretaliostian
counterretalintioas counterretalintiosa counterretalintiaos counterretalintiaso counterretalintisao counterretalintisoa
counterretalintoias counterretalintoisa counterretalintoais counterretalintoasi counterretalintosai counterretalintosia
counterretalintaois counterretalintaosi counterretalintaios counterretalintaiso counterretalintasio counterretalintasoi
counterretalintsoai counterretalintsoia counterretalintsaoi counterretalintsaio counterretalintsiao counterretalintsioa
counterretalinitoas counterretalinitosa counterretalinitaos counterretalinitaso counterretalinitsao counterretalinitsoa
counterretaliniotas counterretaliniotsa counterretalinioats counterretalinioast counterretaliniosat counterretaliniosta
counterretaliniaots counterretaliniaost counterretaliniatos counterretaliniatso counterretaliniasto counterretaliniasot
counterretalinisoat counterretalinisota counterretalinisaot counterretalinisato counterretalinistao counterretalinistoa
counterretalinoitas counterretalinoitsa counterretalinoiats counterretalinoiast counterretalinoisat counterretalinoista
counterretalinotias counterretalinotisa counterretalinotais counterretalinotasi counterretalinotsai counterretalinotsia
counterretalinoatis counterretalinoatsi counterretalinoaits counterretalinoaist counterretalinoasit counterretalinoasti
counterretalinostai counterretalinostia counterretalinosati counterretalinosait counterretalinosiat counterretalinosita
counterretalinaiots counterretalinaiost counterretalinaitos counterretalinaitso counterretalinaisto counterretalinaisot
counterretalinaoits counterretalinaoist counterretalinaotis counterretalinaotsi counterretalinaosti counterretalinaosit
counterretalinatois counterretalinatosi counterretalinatios counterretalinatiso counterretalinatsio counterretalinatsoi
counterretalinasoti counterretalinasoit counterretalinastoi counterretalinastio counterretalinasito counterretalinasiot
counterretalinsioat counterretalinsiota counterretalinsiaot counterretalinsiato counterretalinsitao counterretalinsitoa
counterretalinsoiat counterretalinsoita counterretalinsoait counterretalinsoati counterretalinsotai counterretalinsotia
counterretalinsaoit counterretalinsaoti counterretalinsaiot counterretalinsaito counterretalinsatio counterretalinsatoi
counterretalinstoai counterretalinstoia counterretalinstaoi counterretalinstaio counterretalinstiao counterretalinstioa
counterretalistiona counterretalistioan counterretalistinoa counterretalistinao counterretalistiano counterretalistiaon
counterretalistoina counterretalistoian counterretalistonia counterretalistonai counterretalistoani counterretalistoain
counterretalistnoia counterretalistnoai counterretalistnioa counterretalistniao counterretalistnaio counterretalistnaoi
counterretalistaoni counterretalistaoin counterretalistanoi counterretalistanio counterretalistaino counterretalistaion
counterretalisitona counterretalisitoan counterretalisitnoa counterretalisitnao counterretalisitano counterretalisitaon
counterretalisiotna counterretalisiotan counterretalisionta counterretalisionat counterretalisioant counterretalisioatn
counterretalisinota counterretalisinoat counterretalisintoa counterretalisintao counterretalisinato counterretalisinaot
counterretalisiaont counterretalisiaotn counterretalisianot counterretalisianto counterretalisiatno counterretalisiaton
counterretalisoitna counterretalisoitan counterretalisointa counterretalisoinat counterretalisoiant counterretalisoiatn
counterretalisotina counterretalisotian counterretalisotnia counterretalisotnai counterretalisotani counterretalisotain
counterretalisontia counterretalisontai counterretalisonita counterretalisoniat counterretalisonait counterretalisonati
counterretalisoatni counterretalisoatin counterretalisoanti counterretalisoanit counterretalisoaint counterretalisoaitn
counterretalisniota counterretalisnioat counterretalisnitoa counterretalisnitao counterretalisniato counterretalisniaot
counterretalisnoita counterretalisnoiat counterretalisnotia counterretalisnotai counterretalisnoati counterretalisnoait
counterretalisntoia counterretalisntoai counterretalisntioa counterretalisntiao counterretalisntaio counterretalisntaoi
counterretalisnaoti counterretalisnaoit counterretalisnatoi counterretalisnatio counterretalisnaito counterretalisnaiot
counterretalisaiont counterretalisaiotn counterretalisainot counterretalisainto counterretalisaitno counterretalisaiton
counterretalisaoint counterretalisaoitn counterretalisaonit counterretalisaonti counterretalisaotni counterretalisaotin
counterretalisanoit counterretalisanoti counterretalisaniot counterretalisanito counterretalisantio counterretalisantoi
counterretalisatoni counterretalisatoin counterretalisatnoi counterretalisatnio counterretalisatino counterretalisation
counterretaloatiins counterretaloatiisn counterretaloatinis counterretaloatinsi counterretaloatisni counterretaloatisin
counterretaloatiins counterretaloatiisn counterretaloatinis counterretaloatinsi counterretaloatisni counterretaloatisin
counterretaloatniis counterretaloatnisi counterretaloatniis counterretaloatnisi counterretaloatnsii counterretaloatnsii
counterretaloatsini counterretaloatsiin counterretaloatsnii counterretaloatsnii counterretaloatsini counterretaloatsiin
counterretaloaitins counterretaloaitisn counterretaloaitnis counterretaloaitnsi counterretaloaitsni counterretaloaitsin
counterretaloaiitns counterretaloaiitsn counterretaloaiints counterretaloaiinst counterretaloaiisnt counterretaloaiistn
counterretaloainits counterretaloainist counterretaloaintis counterretaloaintsi counterretaloainsti counterretaloainsit
counterretaloaisint counterretaloaisitn counterretaloaisnit counterretaloaisnti counterretaloaistni counterretaloaistin
counterretaloaiitns counterretaloaiitsn counterretaloaiints counterretaloaiinst counterretaloaiisnt counterretaloaiistn
counterretaloaitins counterretaloaitisn counterretaloaitnis counterretaloaitnsi counterretaloaitsni counterretaloaitsin
counterretaloaintis counterretaloaintsi counterretaloainits counterretaloainist counterretaloainsit counterretaloainsti
counterretaloaistni counterretaloaistin counterretaloaisnti counterretaloaisnit counterretaloaisint counterretaloaisitn
counterretaloaniits counterretaloaniist counterretaloanitis counterretaloanitsi counterretaloanisti counterretaloanisit
counterretaloaniits counterretaloaniist counterretaloanitis counterretaloanitsi counterretaloanisti counterretaloanisit
counterretaloantiis counterretaloantisi counterretaloantiis counterretaloantisi counterretaloantsii counterretaloantsii
counterretaloansiti counterretaloansiit counterretaloanstii counterretaloanstii counterretaloansiti counterretaloansiit
counterretaloasiint counterretaloasiitn counterretaloasinit counterretaloasinti counterretaloasitni counterretaloasitin
counterretaloasiint counterretaloasiitn counterretaloasinit counterretaloasinti counterretaloasitni counterretaloasitin
counterretaloasniit counterretaloasniti counterretaloasniit counterretaloasniti counterretaloasntii counterretaloasntii
counterretaloastini counterretaloastiin counterretaloastnii counterretaloastnii counterretaloastini counterretaloastiin
counterretalotaiins counterretalotaiisn counterretalotainis counterretalotainsi counterretalotaisni counterretalotaisin
counterretalotaiins counterretalotaiisn counterretalotainis counterretalotainsi counterretalotaisni counterretalotaisin
counterretalotaniis counterretalotanisi counterretalotaniis counterretalotanisi counterretalotansii counterretalotansii
counterretalotasini counterretalotasiin counterretalotasnii counterretalotasnii counterretalotasini counterretalotasiin
counterretalotiains counterretalotiaisn counterretalotianis counterretalotiansi counterretalotiasni counterretalotiasin
counterretalotiians counterretalotiiasn counterretalotiinas counterretalotiinsa counterretalotiisna counterretalotiisan
counterretalotinias counterretalotinisa counterretalotinais counterretalotinasi counterretalotinsai counterretalotinsia
counterretalotisina counterretalotisian counterretalotisnia counterretalotisnai counterretalotisani counterretalotisain
counterretalotiians counterretalotiiasn counterretalotiinas counterretalotiinsa counterretalotiisna counterretalotiisan
counterretalotiains counterretalotiaisn counterretalotianis counterretalotiansi counterretalotiasni counterretalotiasin
counterretalotinais counterretalotinasi counterretalotinias counterretalotinisa counterretalotinsia counterretalotinsai
counterretalotisani counterretalotisain counterretalotisnai counterretalotisnia counterretalotisina counterretalotisian
counterretalotniias counterretalotniisa counterretalotniais counterretalotniasi counterretalotnisai counterretalotnisia
counterretalotniias counterretalotniisa counterretalotniais counterretalotniasi counterretalotnisai counterretalotnisia
counterretalotnaiis counterretalotnaisi counterretalotnaiis counterretalotnaisi counterretalotnasii counterretalotnasii
counterretalotnsiai counterretalotnsiia counterretalotnsaii counterretalotnsaii counterretalotnsiai counterretalotnsiia
counterretalotsiina counterretalotsiian counterretalotsinia counterretalotsinai counterretalotsiani counterretalotsiain
counterretalotsiina counterretalotsiian counterretalotsinia counterretalotsinai counterretalotsiani counterretalotsiain
counterretalotsniia counterretalotsniai counterretalotsniia counterretalotsniai counterretalotsnaii counterretalotsnaii
counterretalotsaini counterretalotsaiin counterretalotsanii counterretalotsanii counterretalotsaini counterretalotsaiin
counterretaloitains counterretaloitaisn counterretaloitanis counterretaloitansi counterretaloitasni counterretaloitasin
counterretaloitians counterretaloitiasn counterretaloitinas counterretaloitinsa counterretaloitisna counterretaloitisan
counterretaloitnias counterretaloitnisa counterretaloitnais counterretaloitnasi counterretaloitnsai counterretaloitnsia
counterretaloitsina counterretaloitsian counterretaloitsnia counterretaloitsnai counterretaloitsani counterretaloitsain
counterretaloiatins counterretaloiatisn counterretaloiatnis counterretaloiatnsi counterretaloiatsni counterretaloiatsin
counterretaloiaitns counterretaloiaitsn counterretaloiaints counterretaloiainst counterretaloiaisnt counterretaloiaistn
counterretaloianits counterretaloianist counterretaloiantis counterretaloiantsi counterretaloiansti counterretaloiansit
counterretaloiasint counterretaloiasitn counterretaloiasnit counterretaloiasnti counterretaloiastni counterretaloiastin
counterretaloiiatns counterretaloiiatsn counterretaloiiants counterretaloiianst counterretaloiiasnt counterretaloiiastn
counterretaloiitans counterretaloiitasn counterretaloiitnas counterretaloiitnsa counterretaloiitsna counterretaloiitsan
counterretaloiintas counterretaloiintsa counterretaloiinats counterretaloiinast counterretaloiinsat counterretaloiinsta
counterretaloiistna counterretaloiistan counterretaloiisnta counterretaloiisnat counterretaloiisant counterretaloiisatn
counterretaloinaits counterretaloinaist counterretaloinatis counterretaloinatsi counterretaloinasti counterretaloinasit
counterretaloiniats counterretaloiniast counterretaloinitas counterretaloinitsa counterretaloinista counterretaloinisat
counterretalointias counterretalointisa counterretalointais counterretalointasi counterretalointsai counterretalointsia
counterretaloinsita counterretaloinsiat counterretaloinstia counterretaloinstai counterretaloinsati counterretaloinsait
counterretaloisaint counterretaloisaitn counterretaloisanit counterretaloisanti counterretaloisatni counterretaloisatin
counterretaloisiant counterretaloisiatn counterretaloisinat counterretaloisinta counterretaloisitna counterretaloisitan
counterretaloisniat counterretaloisnita counterretaloisnait counterretaloisnati counterretaloisntai counterretaloisntia
counterretaloistina counterretaloistian counterretaloistnia counterretaloistnai counterretaloistani counterretaloistain
counterretaloitians counterretaloitiasn counterretaloitinas counterretaloitinsa counterretaloitisna counterretaloitisan
counterretaloitains counterretaloitaisn counterretaloitanis counterretaloitansi counterretaloitasni counterretaloitasin
counterretaloitnais counterretaloitnasi counterretaloitnias counterretaloitnisa counterretaloitnsia counterretaloitnsai
counterretaloitsani counterretaloitsain counterretaloitsnai counterretaloitsnia counterretaloitsina counterretaloitsian
counterretaloiitans counterretaloiitasn counterretaloiitnas counterretaloiitnsa counterretaloiitsna counterretaloiitsan
counterretaloiiatns counterretaloiiatsn counterretaloiiants counterretaloiianst counterretaloiiasnt counterretaloiiastn
counterretaloiinats counterretaloiinast counterretaloiintas counterretaloiintsa counterretaloiinsta counterretaloiinsat
counterretaloiisant counterretaloiisatn counterretaloiisnat counterretaloiisnta counterretaloiistna counterretaloiistan
counterretaloiaitns counterretaloiaitsn counterretaloiaints counterretaloiainst counterretaloiaisnt counterretaloiaistn
counterretaloiatins counterretaloiatisn counterretaloiatnis counterretaloiatnsi counterretaloiatsni counterretaloiatsin
counterretaloiantis counterretaloiantsi counterretaloianits counterretaloianist counterretaloiansit counterretaloiansti
counterretaloiastni counterretaloiastin counterretaloiasnti counterretaloiasnit counterretaloiasint counterretaloiasitn
counterretaloiniats counterretaloiniast counterretaloinitas counterretaloinitsa counterretaloinista counterretaloinisat
counterretaloinaits counterretaloinaist counterretaloinatis counterretaloinatsi counterretaloinasti counterretaloinasit
counterretalointais counterretalointasi counterretalointias counterretalointisa counterretalointsia counterretalointsai
counterretaloinsati counterretaloinsait counterretaloinstai counterretaloinstia counterretaloinsita counterretaloinsiat
counterretaloisiant counterretaloisiatn counterretaloisinat counterretaloisinta counterretaloisitna counterretaloisitan
counterretaloisaint counterretaloisaitn counterretaloisanit counterretaloisanti counterretaloisatni counterretaloisatin
counterretaloisnait counterretaloisnati counterretaloisniat counterretaloisnita counterretaloisntia counterretaloisntai
counterretaloistani counterretaloistain counterretaloistnai counterretaloistnia counterretaloistina counterretaloistian
counterretalontiias counterretalontiisa counterretalontiais counterretalontiasi counterretalontisai counterretalontisia
counterretalontiias counterretalontiisa counterretalontiais counterretalontiasi counterretalontisai counterretalontisia
counterretalontaiis counterretalontaisi counterretalontaiis counterretalontaisi counterretalontasii counterretalontasii
counterretalontsiai counterretalontsiia counterretalontsaii counterretalontsaii counterretalontsiai counterretalontsiia
counterretalonitias counterretalonitisa counterretalonitais counterretalonitasi counterretalonitsai counterretalonitsia
counterretaloniitas counterretaloniitsa counterretaloniiats counterretaloniiast counterretaloniisat counterretaloniista
counterretaloniaits counterretaloniaist counterretaloniatis counterretaloniatsi counterretaloniasti counterretaloniasit
counterretalonisiat counterretalonisita counterretalonisait counterretalonisati counterretalonistai counterretalonistia
counterretaloniitas counterretaloniitsa counterretaloniiats counterretaloniiast counterretaloniisat counterretaloniista
counterretalonitias counterretalonitisa counterretalonitais counterretalonitasi counterretalonitsai counterretalonitsia
counterretaloniatis counterretaloniatsi counterretaloniaits counterretaloniaist counterretaloniasit counterretaloniasti
counterretalonistai counterretalonistia counterretalonisati counterretalonisait counterretalonisiat counterretalonisita
counterretalonaiits counterretalonaiist counterretalonaitis counterretalonaitsi counterretalonaisti counterretalonaisit
counterretalonaiits counterretalonaiist counterretalonaitis counterretalonaitsi counterretalonaisti counterretalonaisit
counterretalonatiis counterretalonatisi counterretalonatiis counterretalonatisi counterretalonatsii counterretalonatsii
counterretalonasiti counterretalonasiit counterretalonastii counterretalonastii counterretalonasiti counterretalonasiit
counterretalonsiiat counterretalonsiita counterretalonsiait counterretalonsiati counterretalonsitai counterretalonsitia
counterretalonsiiat counterretalonsiita counterretalonsiait counterretalonsiati counterretalonsitai counterretalonsitia
counterretalonsaiit counterretalonsaiti counterretalonsaiit counterretalonsaiti counterretalonsatii counterretalonsatii
counterretalonstiai counterretalonstiia counterretalonstaii counterretalonstaii counterretalonstiai counterretalonstiia
counterretalostiina counterretalostiian counterretalostinia counterretalostinai counterretalostiani counterretalostiain
counterretalostiina counterretalostiian counterretalostinia counterretalostinai counterretalostiani counterretalostiain
counterretalostniia counterretalostniai counterretalostniia counterretalostniai counterretalostnaii counterretalostnaii
counterretalostaini counterretalostaiin counterretalostanii counterretalostanii counterretalostaini counterretalostaiin
counterretalositina counterretalositian counterretalositnia counterretalositnai counterretalositani counterretalositain
counterretalosiitna counterretalosiitan counterretalosiinta counterretalosiinat counterretalosiiant counterretalosiiatn
counterretalosinita counterretalosiniat counterretalosintia counterretalosintai counterretalosinati counterretalosinait
counterretalosiaint counterretalosiaitn counterretalosianit counterretalosianti counterretalosiatni counterretalosiatin
counterretalosiitna counterretalosiitan counterretalosiinta counterretalosiinat counterretalosiiant counterretalosiiatn
counterretalositina counterretalositian counterretalositnia counterretalositnai counterretalositani counterretalositain
counterretalosintia counterretalosintai counterretalosinita counterretalosiniat counterretalosinait counterretalosinati
counterretalosiatni counterretalosiatin counterretalosianti counterretalosianit counterretalosiaint counterretalosiaitn
counterretalosniita counterretalosniiat counterretalosnitia counterretalosnitai counterretalosniati counterretalosniait
counterretalosniita counterretalosniiat counterretalosnitia counterretalosnitai counterretalosniati counterretalosniait
counterretalosntiia counterretalosntiai counterretalosntiia counterretalosntiai counterretalosntaii counterretalosntaii
counterretalosnaiti counterretalosnaiit counterretalosnatii counterretalosnatii counterretalosnaiti counterretalosnaiit
counterretalosaiint counterretalosaiitn counterretalosainit counterretalosainti counterretalosaitni counterretalosaitin
counterretalosaiint counterretalosaiitn counterretalosainit counterretalosainti counterretalosaitni counterretalosaitin
counterretalosaniit counterretalosaniti counterretalosaniit counterretalosaniti counterretalosantii counterretalosantii
counterretalosatini counterretalosatiin counterretalosatnii counterretalosatnii counterretalosatini counterretalosatiin
counterretalnatiois counterretalnatiosi counterretalnatiios counterretalnatiiso counterretalnatisio counterretalnatisoi
counterretalnatoiis counterretalnatoisi counterretalnatoiis counterretalnatoisi counterretalnatosii counterretalnatosii
counterretalnatiois counterretalnatiosi counterretalnatiios counterretalnatiiso counterretalnatisio counterretalnatisoi
counterretalnatsoii counterretalnatsoii counterretalnatsioi counterretalnatsiio counterretalnatsiio counterretalnatsioi
counterretalnaitois counterretalnaitosi counterretalnaitios counterretalnaitiso counterretalnaitsio counterretalnaitsoi
counterretalnaiotis counterretalnaiotsi counterretalnaioits counterretalnaioist counterretalnaiosit counterretalnaiosti
counterretalnaiiots counterretalnaiiost counterretalnaiitos counterretalnaiitso counterretalnaiisto counterretalnaiisot
counterretalnaisoit counterretalnaisoti counterretalnaisiot counterretalnaisito counterretalnaistio counterretalnaistoi
counterretalnaoitis counterretalnaoitsi counterretalnaoiits counterretalnaoiist counterretalnaoisit counterretalnaoisti
counterretalnaotiis counterretalnaotisi counterretalnaotiis counterretalnaotisi counterretalnaotsii counterretalnaotsii
counterretalnaoitis counterretalnaoitsi counterretalnaoiits counterretalnaoiist counterretalnaoisit counterretalnaoisti
counterretalnaostii counterretalnaostii counterretalnaositi counterretalnaosiit counterretalnaosiit counterretalnaositi
counterretalnaiiots counterretalnaiiost counterretalnaiitos counterretalnaiitso counterretalnaiisto counterretalnaiisot
counterretalnaioits counterretalnaioist counterretalnaiotis counterretalnaiotsi counterretalnaiosti counterretalnaiosit
counterretalnaitois counterretalnaitosi counterretalnaitios counterretalnaitiso counterretalnaitsio counterretalnaitsoi
counterretalnaisoti counterretalnaisoit counterretalnaistoi counterretalnaistio counterretalnaisito counterretalnaisiot
counterretalnasioit counterretalnasioti counterretalnasiiot counterretalnasiito counterretalnasitio counterretalnasitoi
counterretalnasoiit counterretalnasoiti counterretalnasoiit counterretalnasoiti counterretalnasotii counterretalnasotii
counterretalnasioit counterretalnasioti counterretalnasiiot counterretalnasiito counterretalnasitio counterretalnasitoi
counterretalnastoii counterretalnastoii counterretalnastioi counterretalnastiio counterretalnastiio counterretalnastioi
counterretalntaiois counterretalntaiosi counterretalntaiios counterretalntaiiso counterretalntaisio counterretalntaisoi
counterretalntaoiis counterretalntaoisi counterretalntaoiis counterretalntaoisi counterretalntaosii counterretalntaosii
counterretalntaiois counterretalntaiosi counterretalntaiios counterretalntaiiso counterretalntaisio counterretalntaisoi
counterretalntasoii counterretalntasoii counterretalntasioi counterretalntasiio counterretalntasiio counterretalntasioi
counterretalntiaois counterretalntiaosi counterretalntiaios counterretalntiaiso counterretalntiasio counterretalntiasoi
counterretalntioais counterretalntioasi counterretalntioias counterretalntioisa counterretalntiosia counterretalntiosai
counterretalntiioas counterretalntiiosa counterretalntiiaos counterretalntiiaso counterretalntiisao counterretalntiisoa
counterretalntisoia counterretalntisoai counterretalntisioa counterretalntisiao counterretalntisaio counterretalntisaoi
counterretalntoiais counterretalntoiasi counterretalntoiias counterretalntoiisa counterretalntoisia counterretalntoisai
counterretalntoaiis counterretalntoaisi counterretalntoaiis counterretalntoaisi counterretalntoasii counterretalntoasii
counterretalntoiais counterretalntoiasi counterretalntoiias counterretalntoiisa counterretalntoisia counterretalntoisai
counterretalntosaii counterretalntosaii counterretalntosiai counterretalntosiia counterretalntosiia counterretalntosiai
counterretalntiioas counterretalntiiosa counterretalntiiaos counterretalntiiaso counterretalntiisao counterretalntiisoa
counterretalntioias counterretalntioisa counterretalntioais counterretalntioasi counterretalntiosai counterretalntiosia
counterretalntiaois counterretalntiaosi counterretalntiaios counterretalntiaiso counterretalntiasio counterretalntiasoi
counterretalntisoai counterretalntisoia counterretalntisaoi counterretalntisaio counterretalntisiao counterretalntisioa
counterretalntsioia counterretalntsioai counterretalntsiioa counterretalntsiiao counterretalntsiaio counterretalntsiaoi
counterretalntsoiia counterretalntsoiai counterretalntsoiia counterretalntsoiai counterretalntsoaii counterretalntsoaii
counterretalntsioia counterretalntsioai counterretalntsiioa counterretalntsiiao counterretalntsiaio counterretalntsiaoi
counterretalntsaoii counterretalntsaoii counterretalntsaioi counterretalntsaiio counterretalntsaiio counterretalntsaioi
counterretalnitaois counterretalnitaosi counterretalnitaios counterretalnitaiso counterretalnitasio counterretalnitasoi
counterretalnitoais counterretalnitoasi counterretalnitoias counterretalnitoisa counterretalnitosia counterretalnitosai
counterretalnitioas counterretalnitiosa counterretalnitiaos counterretalnitiaso counterretalnitisao counterretalnitisoa
counterretalnitsoia counterretalnitsoai counterretalnitsioa counterretalnitsiao counterretalnitsaio counterretalnitsaoi
counterretalniatois counterretalniatosi counterretalniatios counterretalniatiso counterretalniatsio counterretalniatsoi
counterretalniaotis counterretalniaotsi counterretalniaoits counterretalniaoist counterretalniaosit counterretalniaosti
counterretalniaiots counterretalniaiost counterretalniaitos counterretalniaitso counterretalniaisto counterretalniaisot
counterretalniasoit counterretalniasoti counterretalniasiot counterretalniasito counterretalniastio counterretalniastoi
counterretalnioatis counterretalnioatsi counterretalnioaits counterretalnioaist counterretalnioasit counterretalnioasti
counterretalniotais counterretalniotasi counterretalniotias counterretalniotisa counterretalniotsia counterretalniotsai
counterretalnioitas counterretalnioitsa counterretalnioiats counterretalnioiast counterretalnioisat counterretalnioista
counterretalniostia counterretalniostai counterretalniosita counterretalniosiat counterretalniosait counterretalniosati
counterretalniiaots counterretalniiaost counterretalniiatos counterretalniiatso counterretalniiasto counterretalniiasot
counterretalniioats counterretalniioast counterretalniiotas counterretalniiotsa counterretalniiosta counterretalniiosat
counterretalniitoas counterretalniitosa counterretalniitaos counterretalniitaso counterretalniitsao counterretalniitsoa
counterretalniisota counterretalniisoat counterretalniistoa counterretalniistao counterretalniisato counterretalniisaot
counterretalnisaoit counterretalnisaoti counterretalnisaiot counterretalnisaito counterretalnisatio counterretalnisatoi
counterretalnisoait counterretalnisoati counterretalnisoiat counterretalnisoita counterretalnisotia counterretalnisotai
counterretalnisioat counterretalnisiota counterretalnisiaot counterretalnisiato counterretalnisitao counterretalnisitoa
counterretalnistoia counterretalnistoai counterretalnistioa counterretalnistiao counterretalnistaio counterretalnistaoi
counterretalnotiais counterretalnotiasi counterretalnotiias counterretalnotiisa counterretalnotisia counterretalnotisai
counterretalnotaiis counterretalnotaisi counterretalnotaiis counterretalnotaisi counterretalnotasii counterretalnotasii
counterretalnotiais counterretalnotiasi counterretalnotiias counterretalnotiisa counterretalnotisia counterretalnotisai
counterretalnotsaii counterretalnotsaii counterretalnotsiai counterretalnotsiia counterretalnotsiia counterretalnotsiai
counterretalnoitais counterretalnoitasi counterretalnoitias counterretalnoitisa counterretalnoitsia counterretalnoitsai
counterretalnoiatis counterretalnoiatsi counterretalnoiaits counterretalnoiaist counterretalnoiasit counterretalnoiasti
counterretalnoiiats counterretalnoiiast counterretalnoiitas counterretalnoiitsa counterretalnoiista counterretalnoiisat
counterretalnoisait counterretalnoisati counterretalnoisiat counterretalnoisita counterretalnoistia counterretalnoistai
counterretalnoaitis counterretalnoaitsi counterretalnoaiits counterretalnoaiist counterretalnoaisit counterretalnoaisti
counterretalnoatiis counterretalnoatisi counterretalnoatiis counterretalnoatisi counterretalnoatsii counterretalnoatsii
counterretalnoaitis counterretalnoaitsi counterretalnoaiits counterretalnoaiist counterretalnoaisit counterretalnoaisti
counterretalnoastii counterretalnoastii counterretalnoasiti counterretalnoasiit counterretalnoasiit counterretalnoasiti
counterretalnoiiats counterretalnoiiast counterretalnoiitas counterretalnoiitsa counterretalnoiista counterretalnoiisat
counterretalnoiaits counterretalnoiaist counterretalnoiatis counterretalnoiatsi counterretalnoiasti counterretalnoiasit
counterretalnoitais counterretalnoitasi counterretalnoitias counterretalnoitisa counterretalnoitsia counterretalnoitsai
counterretalnoisati counterretalnoisait counterretalnoistai counterretalnoistia counterretalnoisita counterretalnoisiat
counterretalnosiait counterretalnosiati counterretalnosiiat counterretalnosiita counterretalnositia counterretalnositai
counterretalnosaiit counterretalnosaiti counterretalnosaiit counterretalnosaiti counterretalnosatii counterretalnosatii
counterretalnosiait counterretalnosiati counterretalnosiiat counterretalnosiita counterretalnositia counterretalnositai
counterretalnostaii counterretalnostaii counterretalnostiai counterretalnostiia counterretalnostiia counterretalnostiai
counterretalnitioas counterretalnitiosa counterretalnitiaos counterretalnitiaso counterretalnitisao counterretalnitisoa
counterretalnitoias counterretalnitoisa counterretalnitoais counterretalnitoasi counterretalnitosai counterretalnitosia
counterretalnitaois counterretalnitaosi counterretalnitaios counterretalnitaiso counterretalnitasio counterretalnitasoi
counterretalnitsoai counterretalnitsoia counterretalnitsaoi counterretalnitsaio counterretalnitsiao counterretalnitsioa
counterretalniitoas counterretalniitosa counterretalniitaos counterretalniitaso counterretalniitsao counterretalniitsoa
counterretalniiotas counterretalniiotsa counterretalniioats counterretalniioast counterretalniiosat counterretalniiosta
counterretalniiaots counterretalniiaost counterretalniiatos counterretalniiatso counterretalniiasto counterretalniiasot
counterretalniisoat counterretalniisota counterretalniisaot counterretalniisato counterretalniistao counterretalniistoa
counterretalnioitas counterretalnioitsa counterretalnioiats counterretalnioiast counterretalnioisat counterretalnioista
counterretalniotias counterretalniotisa counterretalniotais counterretalniotasi counterretalniotsai counterretalniotsia
counterretalnioatis counterretalnioatsi counterretalnioaits counterretalnioaist counterretalnioasit counterretalnioasti
counterretalniostai counterretalniostia counterretalniosati counterretalniosait counterretalniosiat counterretalniosita
counterretalniaiots counterretalniaiost counterretalniaitos counterretalniaitso counterretalniaisto counterretalniaisot
counterretalniaoits counterretalniaoist counterretalniaotis counterretalniaotsi counterretalniaosti counterretalniaosit
counterretalniatois counterretalniatosi counterretalniatios counterretalniatiso counterretalniatsio counterretalniatsoi
counterretalniasoti counterretalniasoit counterretalniastoi counterretalniastio counterretalniasito counterretalniasiot
counterretalnisioat counterretalnisiota counterretalnisiaot counterretalnisiato counterretalnisitao counterretalnisitoa
counterretalnisoiat counterretalnisoita counterretalnisoait counterretalnisoati counterretalnisotai counterretalnisotia
counterretalnisaoit counterretalnisaoti counterretalnisaiot counterretalnisaito counterretalnisatio counterretalnisatoi
counterretalnistoai counterretalnistoia counterretalnistaoi counterretalnistaio counterretalnistiao counterretalnistioa
counterretalnstioia counterretalnstioai counterretalnstiioa counterretalnstiiao counterretalnstiaio counterretalnstiaoi
counterretalnstoiia counterretalnstoiai counterretalnstoiia counterretalnstoiai counterretalnstoaii counterretalnstoaii
counterretalnstioia counterretalnstioai counterretalnstiioa counterretalnstiiao counterretalnstiaio counterretalnstiaoi
counterretalnstaoii counterretalnstaoii counterretalnstaioi counterretalnstaiio counterretalnstaiio counterretalnstaioi
counterretalnsitoia counterretalnsitoai counterretalnsitioa counterretalnsitiao counterretalnsitaio counterretalnsitaoi
counterretalnsiotia counterretalnsiotai counterretalnsioita counterretalnsioiat counterretalnsioait counterretalnsioati
counterretalnsiiota counterretalnsiioat counterretalnsiitoa counterretalnsiitao counterretalnsiiato counterretalnsiiaot
counterretalnsiaoit counterretalnsiaoti counterretalnsiaiot counterretalnsiaito counterretalnsiatio counterretalnsiatoi
counterretalnsoitia counterretalnsoitai counterretalnsoiita counterretalnsoiiat counterretalnsoiait counterretalnsoiati
counterretalnsotiia counterretalnsotiai counterretalnsotiia counterretalnsotiai counterretalnsotaii counterretalnsotaii
counterretalnsoitia counterretalnsoitai counterretalnsoiita counterretalnsoiiat counterretalnsoiait counterretalnsoiati
counterretalnsoatii counterretalnsoatii counterretalnsoaiti counterretalnsoaiit counterretalnsoaiit counterretalnsoaiti
counterretalnsiiota counterretalnsiioat counterretalnsiitoa counterretalnsiitao counterretalnsiiato counterretalnsiiaot
counterretalnsioita counterretalnsioiat counterretalnsiotia counterretalnsiotai counterretalnsioati counterretalnsioait
counterretalnsitoia counterretalnsitoai counterretalnsitioa counterretalnsitiao counterretalnsitaio counterretalnsitaoi
counterretalnsiaoti counterretalnsiaoit counterretalnsiatoi counterretalnsiatio counterretalnsiaito counterretalnsiaiot
counterretalnsaioit counterretalnsaioti counterretalnsaiiot counterretalnsaiito counterretalnsaitio counterretalnsaitoi
counterretalnsaoiit counterretalnsaoiti counterretalnsaoiit counterretalnsaoiti counterretalnsaotii counterretalnsaotii
counterretalnsaioit counterretalnsaioti counterretalnsaiiot counterretalnsaiito counterretalnsaitio counterretalnsaitoi
counterretalnsatoii counterretalnsatoii counterretalnsatioi counterretalnsatiio counterretalnsatiio counterretalnsatioi
counterretalsationi counterretalsatioin counterretalsatinoi counterretalsatinio counterretalsatiino counterretalsatiion
counterretalsatoini counterretalsatoiin counterretalsatonii counterretalsatonii counterretalsatoini counterretalsatoiin
counterretalsatnoii counterretalsatnoii counterretalsatnioi counterretalsatniio counterretalsatniio counterretalsatnioi
counterretalsationi counterretalsatioin counterretalsatinoi counterretalsatinio counterretalsatiino counterretalsatiion
counterretalsaitoni counterretalsaitoin counterretalsaitnoi counterretalsaitnio counterretalsaitino counterretalsaition
counterretalsaiotni counterretalsaiotin counterretalsaionti counterretalsaionit counterretalsaioint counterretalsaioitn
counterretalsainoti counterretalsainoit counterretalsaintoi counterretalsaintio counterretalsainito counterretalsainiot
counterretalsaiiont counterretalsaiiotn counterretalsaiinot counterretalsaiinto counterretalsaiitno counterretalsaiiton
counterretalsaoitni counterretalsaoitin counterretalsaointi counterretalsaoinit counterretalsaoiint counterretalsaoiitn
counterretalsaotini counterretalsaotiin counterretalsaotnii counterretalsaotnii counterretalsaotini counterretalsaotiin
counterretalsaontii counterretalsaontii counterretalsaoniti counterretalsaoniit counterretalsaoniit counterretalsaoniti
counterretalsaoitni counterretalsaoitin counterretalsaointi counterretalsaoinit counterretalsaoiint counterretalsaoiitn
counterretalsanioti counterretalsanioit counterretalsanitoi counterretalsanitio counterretalsaniito counterretalsaniiot
counterretalsanoiti counterretalsanoiit counterretalsanotii counterretalsanotii counterretalsanoiti counterretalsanoiit
counterretalsantoii counterretalsantoii counterretalsantioi counterretalsantiio counterretalsantiio counterretalsantioi
counterretalsanioti counterretalsanioit counterretalsanitoi counterretalsanitio counterretalsaniito counterretalsaniiot
counterretalsaiiont counterretalsaiiotn counterretalsaiinot counterretalsaiinto counterretalsaiitno counterretalsaiiton
counterretalsaioint counterretalsaioitn counterretalsaionit counterretalsaionti counterretalsaiotni counterretalsaiotin
counterretalsainoit counterretalsainoti counterretalsainiot counterretalsainito counterretalsaintio counterretalsaintoi
counterretalsaitoni counterretalsaitoin counterretalsaitnoi counterretalsaitnio counterretalsaitino counterretalsaition
counterretalstaioni counterretalstaioin counterretalstainoi counterretalstainio counterretalstaiino counterretalstaiion
counterretalstaoini counterretalstaoiin counterretalstaonii counterretalstaonii counterretalstaoini counterretalstaoiin
counterretalstanoii counterretalstanoii counterretalstanioi counterretalstaniio counterretalstaniio counterretalstanioi
counterretalstaioni counterretalstaioin counterretalstainoi counterretalstainio counterretalstaiino counterretalstaiion
counterretalstiaoni counterretalstiaoin counterretalstianoi counterretalstianio counterretalstiaino counterretalstiaion
counterretalstioani counterretalstioain counterretalstionai counterretalstionia counterretalstioina counterretalstioian
counterretalstinoai counterretalstinoia counterretalstinaoi counterretalstinaio counterretalstiniao counterretalstinioa
counterretalstiiona counterretalstiioan counterretalstiinoa counterretalstiinao counterretalstiiano counterretalstiiaon
counterretalstoiani counterretalstoiain counterretalstoinai counterretalstoinia counterretalstoiina counterretalstoiian
counterretalstoaini counterretalstoaiin counterretalstoanii counterretalstoanii counterretalstoaini counterretalstoaiin
counterretalstonaii counterretalstonaii counterretalstoniai counterretalstoniia counterretalstoniia counterretalstoniai
counterretalstoiani counterretalstoiain counterretalstoinai counterretalstoinia counterretalstoiina counterretalstoiian
counterretalstnioai counterretalstnioia counterretalstniaoi counterretalstniaio counterretalstniiao counterretalstniioa
counterretalstnoiai counterretalstnoiia counterretalstnoaii counterretalstnoaii counterretalstnoiai counterretalstnoiia
counterretalstnaoii counterretalstnaoii counterretalstnaioi counterretalstnaiio counterretalstnaiio counterretalstnaioi
counterretalstnioai counterretalstnioia counterretalstniaoi counterretalstniaio counterretalstniiao counterretalstniioa
counterretalstiiona counterretalstiioan counterretalstiinoa counterretalstiinao counterretalstiiano counterretalstiiaon
counterretalstioina counterretalstioian counterretalstionia counterretalstionai counterretalstioani counterretalstioain
counterretalstinoia counterretalstinoai counterretalstinioa counterretalstiniao counterretalstinaio counterretalstinaoi
counterretalstiaoni counterretalstiaoin counterretalstianoi counterretalstianio counterretalstiaino counterretalstiaion
counterretalsitaoni counterretalsitaoin counterretalsitanoi counterretalsitanio counterretalsitaino counterretalsitaion
counterretalsitoani counterretalsitoain counterretalsitonai counterretalsitonia counterretalsitoina counterretalsitoian
counterretalsitnoai counterretalsitnoia counterretalsitnaoi counterretalsitnaio counterretalsitniao counterretalsitnioa
counterretalsitiona counterretalsitioan counterretalsitinoa counterretalsitinao counterretalsitiano counterretalsitiaon
counterretalsiatoni counterretalsiatoin counterretalsiatnoi counterretalsiatnio counterretalsiatino counterretalsiation
counterretalsiaotni counterretalsiaotin counterretalsiaonti counterretalsiaonit counterretalsiaoint counterretalsiaoitn
counterretalsianoti counterretalsianoit counterretalsiantoi counterretalsiantio counterretalsianito counterretalsianiot
counterretalsiaiont counterretalsiaiotn counterretalsiainot counterretalsiainto counterretalsiaitno counterretalsiaiton
counterretalsioatni counterretalsioatin counterretalsioanti counterretalsioanit counterretalsioaint counterretalsioaitn
counterretalsiotani counterretalsiotain counterretalsiotnai counterretalsiotnia counterretalsiotina counterretalsiotian
counterretalsiontai counterretalsiontia counterretalsionati counterretalsionait counterretalsioniat counterretalsionita
counterretalsioitna counterretalsioitan counterretalsiointa counterretalsioinat counterretalsioiant counterretalsioiatn
counterretalsinaoti counterretalsinaoit counterretalsinatoi counterretalsinatio counterretalsinaito counterretalsinaiot
counterretalsinoati counterretalsinoait counterretalsinotai counterretalsinotia counterretalsinoita counterretalsinoiat
counterretalsintoai counterretalsintoia counterretalsintaoi counterretalsintaio counterretalsintiao counterretalsintioa
counterretalsiniota counterretalsinioat counterretalsinitoa counterretalsinitao counterretalsiniato counterretalsiniaot
counterretalsiiaont counterretalsiiaotn counterretalsiianot counterretalsiianto counterretalsiiatno counterretalsiiaton
counterretalsiioant counterretalsiioatn counterretalsiionat counterretalsiionta counterretalsiiotna counterretalsiiotan
counterretalsiinoat counterretalsiinota counterretalsiinaot counterretalsiinato counterretalsiintao counterretalsiintoa
counterretalsiitona counterretalsiitoan counterretalsiitnoa counterretalsiitnao counterretalsiitano counterretalsiitaon
counterretalsotiani counterretalsotiain counterretalsotinai counterretalsotinia counterretalsotiina counterretalsotiian
counterretalsotaini counterretalsotaiin counterretalsotanii counterretalsotanii counterretalsotaini counterretalsotaiin
counterretalsotnaii counterretalsotnaii counterretalsotniai counterretalsotniia counterretalsotniia counterretalsotniai
counterretalsotiani counterretalsotiain counterretalsotinai counterretalsotinia counterretalsotiina counterretalsotiian
counterretalsoitani counterretalsoitain counterretalsoitnai counterretalsoitnia counterretalsoitina counterretalsoitian
counterretalsoiatni counterretalsoiatin counterretalsoianti counterretalsoianit counterretalsoiaint counterretalsoiaitn
counterretalsoinati counterretalsoinait counterretalsointai counterretalsointia counterretalsoinita counterretalsoiniat
counterretalsoiiant counterretalsoiiatn counterretalsoiinat counterretalsoiinta counterretalsoiitna counterretalsoiitan
counterretalsoaitni counterretalsoaitin counterretalsoainti counterretalsoainit counterretalsoaiint counterretalsoaiitn
counterretalsoatini counterretalsoatiin counterretalsoatnii counterretalsoatnii counterretalsoatini counterretalsoatiin
counterretalsoantii counterretalsoantii counterretalsoaniti counterretalsoaniit counterretalsoaniit counterretalsoaniti
counterretalsoaitni counterretalsoaitin counterretalsoainti counterretalsoainit counterretalsoaiint counterretalsoaiitn
counterretalsoniati counterretalsoniait counterretalsonitai counterretalsonitia counterretalsoniita counterretalsoniiat
counterretalsonaiti counterretalsonaiit counterretalsonatii counterretalsonatii counterretalsonaiti counterretalsonaiit
counterretalsontaii counterretalsontaii counterretalsontiai counterretalsontiia counterretalsontiia counterretalsontiai
counterretalsoniati counterretalsoniait counterretalsonitai counterretalsonitia counterretalsoniita counterretalsoniiat
counterretalsoiiant counterretalsoiiatn counterretalsoiinat counterretalsoiinta counterretalsoiitna counterretalsoiitan
counterretalsoiaint counterretalsoiaitn counterretalsoianit counterretalsoianti counterretalsoiatni counterretalsoiatin
counterretalsoinait counterretalsoinati counterretalsoiniat counterretalsoinita counterretalsointia counterretalsointai
counterretalsoitani counterretalsoitain counterretalsoitnai counterretalsoitnia counterretalsoitina counterretalsoitian
counterretalsntioai counterretalsntioia counterretalsntiaoi counterretalsntiaio counterretalsntiiao counterretalsntiioa
counterretalsntoiai counterretalsntoiia counterretalsntoaii counterretalsntoaii counterretalsntoiai counterretalsntoiia
counterretalsntaoii counterretalsntaoii counterretalsntaioi counterretalsntaiio counterretalsntaiio counterretalsntaioi
counterretalsntioai counterretalsntioia counterretalsntiaoi counterretalsntiaio counterretalsntiiao counterretalsntiioa
counterretalsnitoai counterretalsnitoia counterretalsnitaoi counterretalsnitaio counterretalsnitiao counterretalsnitioa
counterretalsniotai counterretalsniotia counterretalsnioati counterretalsnioait counterretalsnioiat counterretalsnioita
counterretalsniaoti counterretalsniaoit counterretalsniatoi counterretalsniatio counterretalsniaito counterretalsniaiot
counterretalsniioat counterretalsniiota counterretalsniiaot counterretalsniiato counterretalsniitao counterretalsniitoa
counterretalsnoitai counterretalsnoitia counterretalsnoiati counterretalsnoiait counterretalsnoiiat counterretalsnoiita
counterretalsnotiai counterretalsnotiia counterretalsnotaii counterretalsnotaii counterretalsnotiai counterretalsnotiia
counterretalsnoatii counterretalsnoatii counterretalsnoaiti counterretalsnoaiit counterretalsnoaiit counterretalsnoaiti
counterretalsnoitai counterretalsnoitia counterretalsnoiati counterretalsnoiait counterretalsnoiiat counterretalsnoiita
counterretalsnaioti counterretalsnaioit counterretalsnaitoi counterretalsnaitio counterretalsnaiito counterretalsnaiiot
counterretalsnaoiti counterretalsnaoiit counterretalsnaotii counterretalsnaotii counterretalsnaoiti counterretalsnaoiit
counterretalsnatoii counterretalsnatoii counterretalsnatioi counterretalsnatiio counterretalsnatiio counterretalsnatioi
counterretalsnaioti counterretalsnaioit counterretalsnaitoi counterretalsnaitio counterretalsnaiito counterretalsnaiiot
counterretalsniioat counterretalsniiota counterretalsniiaot counterretalsniiato counterretalsniitao counterretalsniitoa
counterretalsnioiat counterretalsnioita counterretalsnioait counterretalsnioati counterretalsniotai counterretalsniotia
counterretalsniaoit counterretalsniaoti counterretalsniaiot counterretalsniaito counterretalsniatio counterretalsniatoi
counterretalsnitoai counterretalsnitoia counterretalsnitaoi counterretalsnitaio counterretalsnitiao counterretalsnitioa
counterretalsitiona counterretalsitioan counterretalsitinoa counterretalsitinao counterretalsitiano counterretalsitiaon
counterretalsitoina counterretalsitoian counterretalsitonia counterretalsitonai counterretalsitoani counterretalsitoain
counterretalsitnoia counterretalsitnoai counterretalsitnioa counterretalsitniao counterretalsitnaio counterretalsitnaoi
counterretalsitaoni counterretalsitaoin counterretalsitanoi counterretalsitanio counterretalsitaino counterretalsitaion
counterretalsiitona counterretalsiitoan counterretalsiitnoa counterretalsiitnao counterretalsiitano counterretalsiitaon
counterretalsiiotna counterretalsiiotan counterretalsiionta counterretalsiionat counterretalsiioant counterretalsiioatn
counterretalsiinota counterretalsiinoat counterretalsiintoa counterretalsiintao counterretalsiinato counterretalsiinaot
counterretalsiiaont counterretalsiiaotn counterretalsiianot counterretalsiianto counterretalsiiatno counterretalsiiaton
counterretalsioitna counterretalsioitan counterretalsiointa counterretalsioinat counterretalsioiant counterretalsioiatn
counterretalsiotina counterretalsiotian counterretalsiotnia counterretalsiotnai counterretalsiotani counterretalsiotain
counterretalsiontia counterretalsiontai counterretalsionita counterretalsioniat counterretalsionait counterretalsionati
counterretalsioatni counterretalsioatin counterretalsioanti counterretalsioanit counterretalsioaint counterretalsioaitn
counterretalsiniota counterretalsinioat counterretalsinitoa counterretalsinitao counterretalsiniato counterretalsiniaot
counterretalsinoita counterretalsinoiat counterretalsinotia counterretalsinotai counterretalsinoati counterretalsinoait
counterretalsintoia counterretalsintoai counterretalsintioa counterretalsintiao counterretalsintaio counterretalsintaoi
counterretalsinaoti counterretalsinaoit counterretalsinatoi counterretalsinatio counterretalsinaito counterretalsinaiot
counterretalsiaiont counterretalsiaiotn counterretalsiainot counterretalsiainto counterretalsiaitno counterretalsiaiton
counterretalsiaoint counterretalsiaoitn counterretalsiaonit counterretalsiaonti counterretalsiaotni counterretalsiaotin
counterretalsianoit counterretalsianoti counterretalsianiot counterretalsianito counterretalsiantio counterretalsiantoi
counterretalsiatoni counterretalsiatoin counterretalsiatnoi counterretalsiatnio counterretalsiatino counterretalsiation

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us