easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

spools

adpeterimusque

tickle

voltibusque

nadeen

lochiorrhagia

splanchnotribe

megan

mccarrell

rahka

borgert

thoracicohumeral

runyon

triphthong

hypnum

uwaifo

ghanian

pedrail


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: counterpressure
cipher variations:
dpvoufsqsfttvsf eqwpvgtrtguuwtg frxqwhusuhvvxuh gsyrxivtviwwyvi htzsyjwuwjxxzwj
iuatzkxvxkyyaxk jvbualywylzzbyl kwcvbmzxzmaaczm lxdwcnayanbbdan myexdobzboccebo
nzfyepcacpddfcp oagzfqdbdqeegdq pbhagrecerffher qcibhsfdfsggifs rdjcitgegthhjgt
sekdjuhfhuiikhu tflekvigivjjliv ugmflwjhjwkkmjw vhngmxkikxllnkx wiohnyljlymmoly
xjpiozmkmznnpmz ykqjpanlnaooqna zlrkqbomobpprob amslrcpnpcqqspc bntmsdqoqdrrtqd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: counterpressure
Cipher: xlfmgvikivhhfiv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: counterpressure
Cipher: AAABA ABBAB BAABB ABBAA BAABA AABAA BAAAA ABBBA BAAAA AABAA BAAAB BAAAB BAABB BAAAA AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: counterpressure
cipher variations:
dpvoufsqsfttvsfhrjognauanddjanltxosviyivnnxivpvloedqcqdxxlqdtxzoqlygylhhzylxznoctgkgtrrngtfdpoajwswjllpwjjfdomrewervvder
nhroyzmamzffrmzrjfokhueuhppfuhvltowpcicpzztcpznhoixkmkxjjhkxeqwpvgtrtguuwtgiskphobvboeekbomuyptwjzjwooyjwqwmpferdreyymre
uyaprmzhzmiiazmyaopduhlhussohugeqpbkxtxkmmqxkkgepnsfxfswwefsoispzanbnaggsnaskgplivfviqqgviwmupxqdjdqaaudqaoipjylnlykkily
frxqwhusuhvvxuhjtlqipcwcpfflcpnvzquxkakxppzkxrxnqgfsesfzznsfvzbqsnaianjjbanzbpqevimivttpivhfrqclyuylnnryllhfqotgygtxxfgt
pjtqabocobhhtobtlhqmjwgwjrrhwjxnvqyrekerbbverbpjqkzmomzlljmzgsyrxivtviwwyvikumrjqdxdqggmdqowarvylblyqqalysyorhgtftgaaotg
wacrtobjbokkcboacqrfwjnjwuuqjwigsrdmzvzmooszmmigrpuhzhuyyghuqkurbcpdpciiupcumirnkxhxkssixkyowrzsflfsccwfscqkrlanpnammkna
htzsyjwuwjxxzwjlvnskreyerhhnerpxbswzmcmzrrbmztzpsihuguhbbpuhxbdsupckcplldcpbdrsgxkokxvvrkxjhtsenawanpptannjhsqviaivzzhiv
rlvscdqeqdjjvqdvnjsolyiylttjylzpxsatgmgtddxgtdrlsmboqobnnlobiuatzkxvxkyyaxkmwotlsfzfsiiofsqyctxandnasscnauaqtjivhviccqvi
ycetvqdldqmmedqcesthylplywwslykiutfobxboqqubookitrwjbjwaaijwsmwtderfrekkwrewoktpmzjzmuukzmaqytbuhnhueeyhuesmtncprpcoompc
jvbualywylzzbylnxpumtgagtjjpgtrzduyboeobttdobvbrukjwiwjddrwjzdfuwremernnferdftuizmqmzxxtmzljvugpcycprrvcppljusxkckxbbjkx
tnxuefsgsfllxsfxpluqnakanvvlanbrzucvioivffzivftnuodqsqdppnqdkwcvbmzxzmaaczmoyqvnuhbhukkqhusaevzcpfpcuuepcwcsvlkxjxkeesxk
aegvxsfnfsoogfseguvjanrnayyunamkwvhqdzdqsswdqqmkvtyldlyccklyuoyvfgthtgmmytgyqmvroblbowwmbocsavdwjpjwggajwguovpertreqqore
lxdwcnayanbbdanpzrwovicivllrivtbfwadqgqdvvfqdxdtwmlykylfftylbfhwytgogtpphgtfhvwkbosobzzvobnlxwireaerttxerrnlwuzmemzddlmz
vpzwghuiuhnnzuhzrnwspcmcpxxncpdtbwexkqkxhhbkxhvpwqfsusfrrpsfmyexdobzbocceboqasxpwjdjwmmsjwucgxberhrewwgreyeuxnmzlzmgguzm
cgixzuhphuqqihugiwxlcptpcaawpcomyxjsfbfsuuyfssomxvanfnaeemnawqaxhivjviooaviasoxtqdndqyyodqeucxfylrlyiiclyiwqxrgtvtgssqtg
nzfyepcacpddfcprbtyqxkekxnntkxvdhycfsisfxxhsfzfvyonamanhhvandhjyaviqivrrjivhjxymdquqdbbxqdpnzyktgcgtvvzgttpnywbogobffnob
xrbyijwkwjppbwjbtpyureoerzzperfvdygzmsmzjjdmzjxryshuwuhttruhoagzfqdbdqeegdqscuzrylflyooulyweizdgtjtgyyitgagwzpobnboiiwbo
eikzbwjrjwsskjwikyznervreccyreqoazluhdhuwwahuuqozxcphpcggopcysczjkxlxkqqcxkcuqzvsfpfsaaqfsgwezhantnakkenakysztivxviuusvi
pbhagrecerffhertdvaszmgmzppvmzxfjaehukuhzzjuhbhxaqpcocpjjxcpfjlacxkskxttlkxjlzaofswsfddzsfrpbamvieivxxbivvrpaydqiqdhhpqd
ztdaklymylrrdyldvrawtgqgtbbrgthxfaibouobllfoblztaujwywjvvtwjqcibhsfdfsggifsuewbtanhnaqqwnaygkbfivlviaakviciybrqdpdqkkydq
gkmbdyltlyuumlykmabpgtxtgeeatgsqcbnwjfjwyycjwwsqbzerjreiiqreaueblmznzmssezmewsbxuhrhuccshuiygbjcpvpcmmgpcmaubvkxzxkwwuxk
rdjcitgegthhjgtvfxcuboiobrrxobzhlcgjwmwjbblwjdjzcsreqerllzerhlncezmumzvvnmzlnbcqhuyuhffbuhtrdcoxkgkxzzdkxxtrcafsksfjjrsf
bvfcmnaoanttfanfxtcyvisivddtivjzhckdqwqdnnhqdnbvcwlyaylxxvylsekdjuhfhuiikhuwgydvcpjpcssypcaimdhkxnxkccmxkekadtsfrfsmmafs
imodfanvnawwonamocdrivzviggcviusedpylhlyaaelyyusdbgtltgkkstgcwgdnobpbouugbogyudzwjtjweeujwkaidlerxreooireocwdxmzbzmyywzm
tflekvigivjjlivxhzewdqkqdttzqdbjneilyoylddnylflbeutgsgtnnbgtjnpegbowobxxpobnpdesjwawjhhdwjvtfeqzmimzbbfmzzvtechumuhlltuh
dxheopcqcpvvhcphzveaxkukxffvkxlbjemfsysfppjsfpdxeynacanzzxanugmflwjhjwkkmjwyiafxerlreuuareckofjmzpzmeeozmgmcfvuhthuoochu
koqfhcpxpcyyqpcoqeftkxbxkiiexkwugfranjnaccgnaawufdivnvimmuvieyifpqdrdqwwidqiawfbylvlyggwlymckfngtztgqqktgqeyfzobdboaaybo
vhngmxkikxllnkxzjbgyfsmsfvvbsfdlpgknaqanffpanhndgwviuivppdivlprgidqyqdzzrqdprfgulycyljjfylxvhgsbokobddhobbxvgejwowjnnvwj
fzjgqreserxxjerjbxgczmwmzhhxmzndlgohuauhrrluhrfzgapcecpbbzcpwiohnyljlymmolyakchzgtntgwwctgemqhlobrboggqboioehxwjvjwqqejw
mqshjerzreaasreqsghvmzdzmkkgzmywihtcplpceeipccywhfkxpxkoowxkgakhrsftfsyykfskcyhdanxnaiiynaoemhpivbvissmvisgahbqdfdqccadq
xjpiozmkmznnpmzbldiahuouhxxduhfnrimpcscphhrcpjpfiyxkwkxrrfkxnrtikfsasfbbtsfrthiwnaeanllhanzxjiudqmqdffjqddzxiglyqylppxyl
hblistgugtzzlgtldzieboyobjjzobpfniqjwcwjttnwjthbicregerddberykqjpanlnaooqnacmejbivpviyyevigosjnqdtdqiisdqkqgjzylxlyssgly
osujlgtbtgccutgsuijxobfbommiboaykjvernreggkreeayjhmzrzmqqyzmicmjtuhvhuaamhumeajfcpzpckkapcqgojrkxdxkuuoxkuicjdsfhfseecfs
zlrkqbomobpprobdnfkcjwqwjzzfwjhptkoreuerjjterlrhkazmymztthmzptvkmhucuhddvuhtvjkypcgcpnnjcpbzlkwfsosfhhlsffbzkinasanrrzan
jdnkuviwivbbnivnfbkgdqaqdllbqdrhpkslyeylvvpylvjdketgigtffdgtamslrcpnpcqqspceogldkxrxkaagxkiqulpsfvfskkufsmsilbanznauuina
quwlnivdvieewviuwklzqdhdqookdqcamlxgtptgiimtggcaljobtbossabokeolvwjxjwccojwogclherbremmcresiqltmzfzmwwqzmwkelfuhjhuggehu
bntmsdqoqdrrtqdfphmelysylbbhyljrvmqtgwgtllvgtntjmcboaobvvjobrvxmojwewjffxwjvxlmareierpplerdbnmyhuquhjjnuhhdbmkpcucpttbcp
lfpmwxkykxddpkxphdmifscsfnndsftjrmunaganxxranxlfmgvikivhhfivcounterpressuregqinfmztzmccizmkswnruhxhummwhuoukndcpbpcwwkpc
swynpkxfxkggyxkwymnbsfjfsqqmfseconzivrvikkoviiecnlqdvdquucdqmgqnxylzlyeeqlyqienjgtdtgooetguksnvobhboyysboymgnhwjljwiigjw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: counterpressure
Cipher: pbhagrecerffher

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: counterpressure
Cipher: 314354334451245324513434542451

Extended Methods:
Method #1

Plaintext: counterpressure
method variations:
htzsykwuwkxxzwknyexdpbzbpccebpsdkciugeguhhkguxiphozmkmznnpmz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
c o u n t e r p r e s s u r e 
3 4 5 3 4 5 2 5 2 5 3 3 5 2 5 
1 3 4 3 4 1 4 3 4 1 4 4 4 4 1 
They are then read out in rows:
345345252533525134341434144441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: counterpressure
Cipher: spywwnkessqsqtd

Read more ...
Method #3

Plaintext: counterpressure
method variations:
qxosyfyhyloyiyl xosyfyhyloyiylq osyfyhyloyiylqx
syfyhyloyiylqxo yfyhyloyiylqxos fyhyloyiylqxosy
yhyloyiylqxosyf hyloyiylqxosyfy yloyiylqxosyfyh
loyiylqxosyfyhy oyiylqxosyfyhyl yiylqxosyfyhylo
iylqxosyfyhyloy ylqxosyfyhyloyi lqxosyfyhyloyiy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: counterpressure

first 5040 cipher variations(1300430725494 total)
counterpressure counterpressuer counterpressrue counterpressreu counterpresseru counterpresseur counterpresusre
counterpresuser counterpresurse counterpresures counterpresuers counterpresuesr counterpresruse counterpresrues
counterpresrsue counterpresrseu counterpresresu counterpresreus counterpreseurs counterpreseusr counterpreserus
counterpresersu counterpresesru counterpresesur counterpressure counterpressuer counterpressrue counterpressreu
counterpresseru counterpresseur counterpresusre counterpresuser counterpresurse counterpresures counterpresuers
counterpresuesr counterpresruse counterpresrues counterpresrsue counterpresrseu counterpresresu counterpresreus
counterpreseurs counterpreseusr counterpreserus counterpresersu counterpresesru counterpresesur counterpreussre
counterpreusser counterpreusrse counterpreusres counterpreusers counterpreusesr counterpreussre counterpreusser
counterpreusrse counterpreusres counterpreusers counterpreusesr counterpreursse counterpreurses counterpreursse
counterpreurses counterpreuress counterpreuress counterpreuesrs counterpreuessr counterpreuerss counterpreuerss
counterpreuesrs counterpreuessr counterprersuse counterprersues counterprerssue counterprersseu counterprersesu
counterprerseus counterprerusse counterpreruses counterprerusse counterpreruses counterpreruess counterpreruess
counterprersuse counterprersues counterprerssue counterprersseu counterprersesu counterprerseus counterprereuss
counterprereuss counterpreresus counterpreressu counterpreressu counterpreresus counterpreesurs counterpreesusr
counterpreesrus counterpreesrsu counterpreessru counterpreessur counterpreeusrs counterpreeussr counterpreeurss
counterpreeurss counterpreeusrs counterpreeussr counterpreeruss counterpreeruss counterpreersus counterpreerssu
counterpreerssu counterpreersus counterpreesurs counterpreesusr counterpreesrus counterpreesrsu counterpreessru
counterpreessur counterprsesure counterprsesuer counterprsesrue counterprsesreu counterprseseru counterprseseur
counterprseusre counterprseuser counterprseurse counterprseures counterprseuers counterprseuesr counterprseruse
counterprserues counterprsersue counterprserseu counterprseresu counterprsereus counterprseeurs counterprseeusr
counterprseerus counterprseersu counterprseesru counterprseesur counterprsseure counterprsseuer counterprsserue
counterprssereu counterprsseeru counterprsseeur counterprssuere counterprssueer counterprssuree counterprssuree
counterprssuere counterprssueer counterprssruee counterprssruee counterprssreue counterprssreeu counterprssreeu
counterprssreue counterprsseure counterprsseuer counterprsserue counterprssereu counterprsseeru counterprsseeur
counterprsusere counterprsuseer counterprsusree counterprsusree counterprsusere counterprsuseer counterprsuesre
counterprsueser counterprsuerse counterprsueres counterprsueers counterprsueesr counterprsurese counterprsurees
counterprsursee counterprsursee counterprsurese counterprsurees counterprsueers counterprsueesr counterprsueres
counterprsuerse counterprsuesre counterprsueser counterprsrsuee counterprsrsuee counterprsrseue counterprsrseeu
counterprsrseeu counterprsrseue counterprsrusee counterprsrusee counterprsruese counterprsruees counterprsruees
counterprsruese counterprsreuse counterprsreues counterprsresue counterprsreseu counterprsreesu counterprsreeus
counterprsreues counterprsreuse counterprsreeus counterprsreesu counterprsreseu counterprsresue counterprsesure
counterprsesuer counterprsesrue counterprsesreu counterprseseru counterprseseur counterprseusre counterprseuser
counterprseurse counterprseures counterprseuers counterprseuesr counterprseruse counterprserues counterprsersue
counterprserseu counterprseresu counterprsereus counterprseeurs counterprseeusr counterprseerus counterprseersu
counterprseesru counterprseesur counterprsseure counterprsseuer counterprsserue counterprssereu counterprsseeru
counterprsseeur counterprssuere counterprssueer counterprssuree counterprssuree counterprssuere counterprssueer
counterprssruee counterprssruee counterprssreue counterprssreeu counterprssreeu counterprssreue counterprsseure
counterprsseuer counterprsserue counterprssereu counterprsseeru counterprsseeur counterprsesure counterprsesuer
counterprsesrue counterprsesreu counterprseseru counterprseseur counterprseusre counterprseuser counterprseurse
counterprseures counterprseuers counterprseuesr counterprseruse counterprserues counterprsersue counterprserseu
counterprseresu counterprsereus counterprseeurs counterprseeusr counterprseerus counterprseersu counterprseesru
counterprseesur counterprsuesre counterprsueser counterprsuerse counterprsueres counterprsueers counterprsueesr
counterprsusere counterprsuseer counterprsusree counterprsusree counterprsusere counterprsuseer counterprsursee
counterprsursee counterprsurese counterprsurees counterprsurees counterprsurese counterprsuesre counterprsueser
counterprsuerse counterprsueres counterprsueers counterprsueesr counterprsreuse counterprsreues counterprsresue
counterprsreseu counterprsreesu counterprsreeus counterprsruese counterprsruees counterprsrusee counterprsrusee
counterprsruese counterprsruees counterprsrsuee counterprsrsuee counterprsrseue counterprsrseeu counterprsrseeu
counterprsrseue counterprsreuse counterprsreues counterprsresue counterprsreseu counterprsreesu counterprsreeus
counterprseeurs counterprseeusr counterprseerus counterprseersu counterprseesru counterprseesur counterprseuers
counterprseuesr counterprseures counterprseurse counterprseusre counterprseuser counterprserues counterprseruse
counterprsereus counterprseresu counterprserseu counterprsersue counterprsesure counterprsesuer counterprsesrue
counterprsesreu counterprseseru counterprseseur counterprussere counterprusseer counterprussree counterprussree
counterprussere counterprusseer counterprusesre counterpruseser counterpruserse counterpruseres counterpruseers
counterpruseesr counterprusrese counterprusrees counterprusrsee counterprusrsee counterprusrese counterprusrees
counterpruseers counterpruseesr counterpruseres counterpruserse counterprusesre counterpruseser counterprussere
counterprusseer counterprussree counterprussree counterprussere counterprusseer counterprusesre counterpruseser
counterpruserse counterpruseres counterpruseers counterpruseesr counterprusrese counterprusrees counterprusrsee
counterprusrsee counterprusrese counterprusrees counterpruseers counterpruseesr counterpruseres counterpruserse
counterprusesre counterpruseser counterpruessre counterpruesser counterpruesrse counterpruesres counterpruesers
counterpruesesr counterpruessre counterpruesser counterpruesrse counterpruesres counterpruesers counterpruesesr
counterpruersse counterpruerses counterpruersse counterpruerses counterprueress counterprueress counterprueesrs
counterprueessr counterprueerss counterprueerss counterprueesrs counterprueessr counterprursese counterprursees
counterprurssee counterprurssee counterprursese counterprursees counterpruresse counterprureses counterpruresse
counterprureses counterprureess counterprureess counterprursese counterprursees counterprurssee counterprurssee
counterprursese counterprursees counterprureess counterprureess counterprureses counterpruresse counterpruresse
counterprureses counterpruesers counterpruesesr counterpruesres counterpruesrse counterpruessre counterpruesser
counterprueesrs counterprueessr counterprueerss counterprueerss counterprueesrs counterprueessr counterprueress
counterprueress counterpruerses counterpruersse counterpruersse counterpruerses counterpruesers counterpruesesr
counterpruesres counterpruesrse counterpruessre counterpruesser counterprrssuee counterprrssuee counterprrsseue
counterprrsseeu counterprrsseeu counterprrsseue counterprrsusee counterprrsusee counterprrsuese counterprrsuees
counterprrsuees counterprrsuese counterprrseuse counterprrseues counterprrsesue counterprrseseu counterprrseesu
counterprrseeus counterprrseues counterprrseuse counterprrseeus counterprrseesu counterprrseseu counterprrsesue
counterprrssuee counterprrssuee counterprrsseue counterprrsseeu counterprrsseeu counterprrsseue counterprrsusee
counterprrsusee counterprrsuese counterprrsuees counterprrsuees counterprrsuese counterprrseuse counterprrseues
counterprrsesue counterprrseseu counterprrseesu counterprrseeus counterprrseues counterprrseuse counterprrseeus
counterprrseesu counterprrseseu counterprrsesue counterprrussee counterprrussee counterprrusese counterprrusees
counterprrusees counterprrusese counterprrussee counterprrussee counterprrusese counterprrusees counterprrusees
counterprrusese counterprruesse counterprrueses counterprruesse counterprrueses counterprrueess counterprrueess
counterprrueses counterprruesse counterprrueess counterprrueess counterprrueses counterprruesse counterprresuse
counterprresues counterprressue counterprresseu counterprresesu counterprreseus counterprreusse counterprreuses
counterprreusse counterprreuses counterprreuess counterprreuess counterprresuse counterprresues counterprressue
counterprresseu counterprresesu counterprreseus counterprreeuss counterprreeuss counterprreesus counterprreessu
counterprreessu counterprreesus counterprresues counterprresuse counterprreseus counterprresesu counterprresseu
counterprressue counterprreuses counterprreusse counterprreuess counterprreuess counterprreuses counterprreusse
counterprreeuss counterprreeuss counterprreesus counterprreessu counterprreessu counterprreesus counterprresues
counterprresuse counterprreseus counterprresesu counterprresseu counterprressue counterpressure counterpressuer
counterpressrue counterpressreu counterpresseru counterpresseur counterpresusre counterpresuser counterpresurse
counterpresures counterpresuers counterpresuesr counterpresruse counterpresrues counterpresrsue counterpresrseu
counterpresresu counterpresreus counterpreseurs counterpreseusr counterpreserus counterpresersu counterpresesru
counterpresesur counterpressure counterpressuer counterpressrue counterpressreu counterpresseru counterpresseur
counterpresusre counterpresuser counterpresurse counterpresures counterpresuers counterpresuesr counterpresruse
counterpresrues counterpresrsue counterpresrseu counterpresresu counterpresreus counterpreseurs counterpreseusr
counterpreserus counterpresersu counterpresesru counterpresesur counterpreussre counterpreusser counterpreusrse
counterpreusres counterpreusers counterpreusesr counterpreussre counterpreusser counterpreusrse counterpreusres
counterpreusers counterpreusesr counterpreursse counterpreurses counterpreursse counterpreurses counterpreuress
counterpreuress counterpreuesrs counterpreuessr counterpreuerss counterpreuerss counterpreuesrs counterpreuessr
counterprersuse counterprersues counterprerssue counterprersseu counterprersesu counterprerseus counterprerusse
counterpreruses counterprerusse counterpreruses counterpreruess counterpreruess counterprersuse counterprersues
counterprerssue counterprersseu counterprersesu counterprerseus counterprereuss counterprereuss counterpreresus
counterpreressu counterpreressu counterpreresus counterpreesurs counterpreesusr counterpreesrus counterpreesrsu
counterpreessru counterpreessur counterpreeusrs counterpreeussr counterpreeurss counterpreeurss counterpreeusrs
counterpreeussr counterpreeruss counterpreeruss counterpreersus counterpreerssu counterpreerssu counterpreersus
counterpreesurs counterpreesusr counterpreesrus counterpreesrsu counterpreessru counterpreessur counterperssure
counterperssuer counterperssrue counterperssreu counterpersseru counterpersseur counterpersusre counterpersuser
counterpersurse counterpersures counterpersuers counterpersuesr counterpersruse counterpersrues counterpersrsue
counterpersrseu counterpersresu counterpersreus counterperseurs counterperseusr counterperserus counterpersersu
counterpersesru counterpersesur counterperssure counterperssuer counterperssrue counterperssreu counterpersseru
counterpersseur counterpersusre counterpersuser counterpersurse counterpersures counterpersuers counterpersuesr
counterpersruse counterpersrues counterpersrsue counterpersrseu counterpersresu counterpersreus counterperseurs
counterperseusr counterperserus counterpersersu counterpersesru counterpersesur counterperussre counterperusser
counterperusrse counterperusres counterperusers counterperusesr counterperussre counterperusser counterperusrse
counterperusres counterperusers counterperusesr counterperursse counterperurses counterperursse counterperurses
counterperuress counterperuress counterperuesrs counterperuessr counterperuerss counterperuerss counterperuesrs
counterperuessr counterperrsuse counterperrsues counterperrssue counterperrsseu counterperrsesu counterperrseus
counterperrusse counterperruses counterperrusse counterperruses counterperruess counterperruess counterperrsuse
counterperrsues counterperrssue counterperrsseu counterperrsesu counterperrseus counterperreuss counterperreuss
counterperresus counterperressu counterperressu counterperresus counterperesurs counterperesusr counterperesrus
counterperesrsu counterperessru counterperessur counterpereusrs counterpereussr counterpereurss counterpereurss
counterpereusrs counterpereussr counterpereruss counterpereruss counterperersus counterpererssu counterpererssu
counterperersus counterperesurs counterperesusr counterperesrus counterperesrsu counterperessru counterperessur
counterpesrsure counterpesrsuer counterpesrsrue counterpesrsreu counterpesrseru counterpesrseur counterpesrusre
counterpesruser counterpesrurse counterpesrures counterpesruers counterpesruesr counterpesrruse counterpesrrues
counterpesrrsue counterpesrrseu counterpesrresu counterpesrreus counterpesreurs counterpesreusr counterpesrerus
counterpesrersu counterpesresru counterpesresur counterpessrure counterpessruer counterpessrrue counterpessrreu
counterpessreru counterpessreur counterpessurre counterpessurer counterpessurre counterpessurer counterpessuerr
counterpessuerr counterpessrure counterpessruer counterpessrrue counterpessrreu counterpessreru counterpessreur
counterpesseurr counterpesseurr counterpesserur counterpesserru counterpesserru counterpesserur counterpesusrre
counterpesusrer counterpesusrre counterpesusrer counterpesuserr counterpesuserr counterpesursre counterpesurser
counterpesurrse counterpesurres counterpesurers counterpesuresr counterpesurrse counterpesurres counterpesursre
counterpesurser counterpesuresr counterpesurers counterpesuerrs counterpesuersr counterpesuerrs counterpesuersr
counterpesuesrr counterpesuesrr counterpesrsure counterpesrsuer counterpesrsrue counterpesrsreu counterpesrseru
counterpesrseur counterpesrusre counterpesruser counterpesrurse counterpesrures counterpesruers counterpesruesr
counterpesrruse counterpesrrues counterpesrrsue counterpesrrseu counterpesrresu counterpesrreus counterpesreurs
counterpesreusr counterpesrerus counterpesrersu counterpesresru counterpesresur counterpesesurr counterpesesurr
counterpesesrur counterpesesrru counterpesesrru counterpesesrur counterpeseusrr counterpeseusrr counterpeseursr
counterpeseurrs counterpeseurrs counterpeseursr counterpeserusr counterpeserurs counterpesersur counterpesersru
counterpeserrsu counterpeserrus counterpeserurs counterpeserusr counterpeserrus counterpeserrsu counterpesersru
counterpesersur counterpessrure counterpessruer counterpessrrue counterpessrreu counterpessreru counterpessreur
counterpessurre counterpessurer counterpessurre counterpessurer counterpessuerr counterpessuerr counterpessrure
counterpessruer counterpessrrue counterpessrreu counterpessreru counterpessreur counterpesseurr counterpesseurr
counterpesserur counterpesserru counterpesserru counterpesserur counterpesrsure counterpesrsuer counterpesrsrue
counterpesrsreu counterpesrseru counterpesrseur counterpesrusre counterpesruser counterpesrurse counterpesrures
counterpesruers counterpesruesr counterpesrruse counterpesrrues counterpesrrsue counterpesrrseu counterpesrresu
counterpesrreus counterpesreurs counterpesreusr counterpesrerus counterpesrersu counterpesresru counterpesresur
counterpesursre counterpesurser counterpesurrse counterpesurres counterpesurers counterpesuresr counterpesusrre
counterpesusrer counterpesusrre counterpesusrer counterpesuserr counterpesuserr counterpesursre counterpesurser
counterpesurrse counterpesurres counterpesurers counterpesuresr counterpesuesrr counterpesuesrr counterpesuersr
counterpesuerrs counterpesuerrs counterpesuersr counterpesrruse counterpesrrues counterpesrrsue counterpesrrseu
counterpesrresu counterpesrreus counterpesrurse counterpesrures counterpesrusre counterpesruser counterpesruesr
counterpesruers counterpesrsure counterpesrsuer counterpesrsrue counterpesrsreu counterpesrseru counterpesrseur
counterpesreusr counterpesreurs counterpesresur counterpesresru counterpesrersu counterpesrerus counterpeserurs
counterpeserusr counterpeserrus counterpeserrsu counterpesersru counterpesersur counterpeseurrs counterpeseursr
counterpeseurrs counterpeseursr counterpeseusrr counterpeseusrr counterpeserurs counterpeserusr counterpeserrus
counterpeserrsu counterpesersru counterpesersur counterpesesurr counterpesesurr counterpesesrur counterpesesrru
counterpesesrru counterpesesrur counterpeussrre counterpeussrer counterpeussrre counterpeussrer counterpeusserr
counterpeusserr counterpeusrsre counterpeusrser counterpeusrrse counterpeusrres counterpeusrers counterpeusresr
counterpeusrrse counterpeusrres counterpeusrsre counterpeusrser counterpeusresr counterpeusrers counterpeuserrs
counterpeusersr counterpeuserrs counterpeusersr counterpeusesrr counterpeusesrr counterpeussrre counterpeussrer
counterpeussrre counterpeussrer counterpeusserr counterpeusserr counterpeusrsre counterpeusrser counterpeusrrse
counterpeusrres counterpeusrers counterpeusresr counterpeusrrse counterpeusrres counterpeusrsre counterpeusrser
counterpeusresr counterpeusrers counterpeuserrs counterpeusersr counterpeuserrs counterpeusersr counterpeusesrr
counterpeusesrr counterpeurssre counterpeursser counterpeursrse counterpeursres counterpeursers counterpeursesr
counterpeurssre counterpeursser counterpeursrse counterpeursres counterpeursers counterpeursesr counterpeurrsse
counterpeurrses counterpeurrsse counterpeurrses counterpeurress counterpeurress counterpeuresrs counterpeuressr
counterpeurerss counterpeurerss counterpeuresrs counterpeuressr counterpeursrse counterpeursres counterpeurssre
counterpeursser counterpeursesr counterpeursers counterpeurrsse counterpeurrses counterpeurrsse counterpeurrses
counterpeurress counterpeurress counterpeursrse counterpeursres counterpeurssre counterpeursser counterpeursesr
counterpeursers counterpeurerss counterpeurerss counterpeuresrs counterpeuressr counterpeuressr counterpeuresrs
counterpeuesrrs counterpeuesrsr counterpeuesrrs counterpeuesrsr counterpeuessrr counterpeuessrr counterpeuersrs
counterpeuerssr counterpeuerrss counterpeuerrss counterpeuersrs counterpeuerssr counterpeuerrss counterpeuerrss
counterpeuersrs counterpeuerssr counterpeuerssr counterpeuersrs counterpeuesrrs counterpeuesrsr counterpeuesrrs
counterpeuesrsr counterpeuessrr counterpeuessrr counterperssure counterperssuer counterperssrue counterperssreu
counterpersseru counterpersseur counterpersusre counterpersuser counterpersurse counterpersures counterpersuers
counterpersuesr counterpersruse counterpersrues counterpersrsue counterpersrseu counterpersresu counterpersreus
counterperseurs counterperseusr counterperserus counterpersersu counterpersesru counterpersesur counterperssure
counterperssuer counterperssrue counterperssreu counterpersseru counterpersseur counterpersusre counterpersuser
counterpersurse counterpersures counterpersuers counterpersuesr counterpersruse counterpersrues counterpersrsue
counterpersrseu counterpersresu counterpersreus counterperseurs counterperseusr counterperserus counterpersersu
counterpersesru counterpersesur counterperussre counterperusser counterperusrse counterperusres counterperusers
counterperusesr counterperussre counterperusser counterperusrse counterperusres counterperusers counterperusesr
counterperursse counterperurses counterperursse counterperurses counterperuress counterperuress counterperuesrs
counterperuessr counterperuerss counterperuerss counterperuesrs counterperuessr counterperrsuse counterperrsues
counterperrssue counterperrsseu counterperrsesu counterperrseus counterperrusse counterperruses counterperrusse
counterperruses counterperruess counterperruess counterperrsuse counterperrsues counterperrssue counterperrsseu
counterperrsesu counterperrseus counterperreuss counterperreuss counterperresus counterperressu counterperressu
counterperresus counterperesurs counterperesusr counterperesrus counterperesrsu counterperessru counterperessur
counterpereusrs counterpereussr counterpereurss counterpereurss counterpereusrs counterpereussr counterpereruss
counterpereruss counterperersus counterpererssu counterpererssu counterperersus counterperesurs counterperesusr
counterperesrus counterperesrsu counterperessru counterperessur counterpeessurr counterpeessurr counterpeessrur
counterpeessrru counterpeessrru counterpeessrur counterpeesusrr counterpeesusrr counterpeesursr counterpeesurrs
counterpeesurrs counterpeesursr counterpeesrusr counterpeesrurs counterpeesrsur counterpeesrsru counterpeesrrsu
counterpeesrrus counterpeesrurs counterpeesrusr counterpeesrrus counterpeesrrsu counterpeesrsru counterpeesrsur
counterpeessurr counterpeessurr counterpeessrur counterpeessrru counterpeessrru counterpeessrur counterpeesusrr
counterpeesusrr counterpeesursr counterpeesurrs counterpeesurrs counterpeesursr counterpeesrusr counterpeesrurs
counterpeesrsur counterpeesrsru counterpeesrrsu counterpeesrrus counterpeesrurs counterpeesrusr counterpeesrrus
counterpeesrrsu counterpeesrsru counterpeesrsur counterpeeussrr counterpeeussrr counterpeeusrsr counterpeeusrrs
counterpeeusrrs counterpeeusrsr counterpeeussrr counterpeeussrr counterpeeusrsr counterpeeusrrs counterpeeusrrs
counterpeeusrsr counterpeeurssr counterpeeursrs counterpeeurssr counterpeeursrs counterpeeurrss counterpeeurrss
counterpeeursrs counterpeeurssr counterpeeurrss counterpeeurrss counterpeeursrs counterpeeurssr counterpeersusr
counterpeersurs counterpeerssur counterpeerssru counterpeersrsu counterpeersrus counterpeerussr counterpeerusrs
counterpeerussr counterpeerusrs counterpeerurss counterpeerurss counterpeersusr counterpeersurs counterpeerssur
counterpeerssru counterpeersrsu counterpeersrus counterpeerruss counterpeerruss counterpeerrsus counterpeerrssu
counterpeerrssu counterpeerrsus counterpeersurs counterpeersusr counterpeersrus counterpeersrsu counterpeerssru
counterpeerssur counterpeerusrs counterpeerussr counterpeerurss counterpeerurss counterpeerusrs counterpeerussr
counterpeerruss counterpeerruss counterpeerrsus counterpeerrssu counterpeerrssu counterpeerrsus counterpeersurs
counterpeersusr counterpeersrus counterpeersrsu counterpeerssru counterpeerssur counterpsersure counterpsersuer
counterpsersrue counterpsersreu counterpserseru counterpserseur counterpserusre counterpseruser counterpserurse
counterpserures counterpseruers counterpseruesr counterpserruse counterpserrues counterpserrsue counterpserrseu
counterpserresu counterpserreus counterpsereurs counterpsereusr counterpsererus counterpserersu counterpseresru
counterpseresur counterpsesrure counterpsesruer counterpsesrrue counterpsesrreu counterpsesreru counterpsesreur
counterpsesurre counterpsesurer counterpsesurre counterpsesurer counterpsesuerr counterpsesuerr counterpsesrure
counterpsesruer counterpsesrrue counterpsesrreu counterpsesreru counterpsesreur counterpseseurr counterpseseurr
counterpseserur counterpseserru counterpseserru counterpseserur counterpseusrre counterpseusrer counterpseusrre
counterpseusrer counterpseuserr counterpseuserr counterpseursre counterpseurser counterpseurrse counterpseurres
counterpseurers counterpseuresr counterpseurrse counterpseurres counterpseursre counterpseurser counterpseuresr
counterpseurers counterpseuerrs counterpseuersr counterpseuerrs counterpseuersr counterpseuesrr counterpseuesrr
counterpsersure counterpsersuer counterpsersrue counterpsersreu counterpserseru counterpserseur counterpserusre
counterpseruser counterpserurse counterpserures counterpseruers counterpseruesr counterpserruse counterpserrues
counterpserrsue counterpserrseu counterpserresu counterpserreus counterpsereurs counterpsereusr counterpsererus
counterpserersu counterpseresru counterpseresur counterpseesurr counterpseesurr counterpseesrur counterpseesrru
counterpseesrru counterpseesrur counterpseeusrr counterpseeusrr counterpseeursr counterpseeurrs counterpseeurrs
counterpseeursr counterpseerusr counterpseerurs counterpseersur counterpseersru counterpseerrsu counterpseerrus
counterpseerurs counterpseerusr counterpseerrus counterpseerrsu counterpseersru counterpseersur counterpsresure
counterpsresuer counterpsresrue counterpsresreu counterpsreseru counterpsreseur counterpsreusre counterpsreuser
counterpsreurse counterpsreures counterpsreuers counterpsreuesr counterpsreruse counterpsrerues counterpsrersue
counterpsrerseu counterpsreresu counterpsrereus counterpsreeurs counterpsreeusr counterpsreerus counterpsreersu
counterpsreesru counterpsreesur counterpsrseure counterpsrseuer counterpsrserue counterpsrsereu counterpsrseeru
counterpsrseeur counterpsrsuere counterpsrsueer counterpsrsuree counterpsrsuree counterpsrsuere counterpsrsueer
counterpsrsruee counterpsrsruee counterpsrsreue counterpsrsreeu counterpsrsreeu counterpsrsreue counterpsrseure
counterpsrseuer counterpsrserue counterpsrsereu counterpsrseeru counterpsrseeur counterpsrusere counterpsruseer
counterpsrusree counterpsrusree counterpsrusere counterpsruseer counterpsruesre counterpsrueser counterpsruerse
counterpsrueres counterpsrueers counterpsrueesr counterpsrurese counterpsrurees counterpsrursee counterpsrursee
counterpsrurese counterpsrurees counterpsrueers counterpsrueesr counterpsrueres counterpsruerse counterpsruesre
counterpsrueser counterpsrrsuee counterpsrrsuee counterpsrrseue counterpsrrseeu counterpsrrseeu counterpsrrseue
counterpsrrusee counterpsrrusee counterpsrruese counterpsrruees counterpsrruees counterpsrruese counterpsrreuse
counterpsrreues counterpsrresue counterpsrreseu counterpsrreesu counterpsrreeus counterpsrreues counterpsrreuse
counterpsrreeus counterpsrreesu counterpsrreseu counterpsrresue counterpsresure counterpsresuer counterpsresrue
counterpsresreu counterpsreseru counterpsreseur counterpsreusre counterpsreuser counterpsreurse counterpsreures
counterpsreuers counterpsreuesr counterpsreruse counterpsrerues counterpsrersue counterpsrerseu counterpsreresu
counterpsrereus counterpsreeurs counterpsreeusr counterpsreerus counterpsreersu counterpsreesru counterpsreesur
counterpssreure counterpssreuer counterpssrerue counterpssrereu counterpssreeru counterpssreeur counterpssruere
counterpssrueer counterpssruree counterpssruree counterpssruere counterpssrueer counterpssrruee counterpssrruee
counterpssrreue counterpssrreeu counterpssrreeu counterpssrreue counterpssreure counterpssreuer counterpssrerue
counterpssrereu counterpssreeru counterpssreeur counterpsserure counterpsseruer counterpsserrue counterpsserreu
counterpssereru counterpssereur counterpsseurre counterpsseurer counterpsseurre counterpsseurer counterpsseuerr
counterpsseuerr counterpsserure counterpsseruer counterpsserrue counterpsserreu counterpssereru counterpssereur
counterpsseeurr counterpsseeurr counterpsseerur counterpsseerru counterpsseerru counterpsseerur counterpssuerre
counterpssuerer counterpssuerre counterpssuerer counterpssueerr counterpssueerr counterpssurere counterpssureer
counterpssurree counterpssurree counterpssurere counterpssureer counterpssurree counterpssurree counterpssurere
counterpssureer counterpssureer counterpssurere counterpssuerre counterpssuerer counterpssuerre counterpssuerer
counterpssueerr counterpssueerr counterpssreure counterpssreuer counterpssrerue counterpssrereu counterpssreeru
counterpssreeur counterpssruere counterpssrueer counterpssruree counterpssruree counterpssruere counterpssrueer
counterpssrruee counterpssrruee counterpssrreue counterpssrreeu counterpssrreeu counterpssrreue counterpssreure
counterpssreuer counterpssrerue counterpssrereu counterpssreeru counterpssreeur counterpsseeurr counterpsseeurr
counterpsseerur counterpsseerru counterpsseerru counterpsseerur counterpsseuerr counterpsseuerr counterpsseurer
counterpsseurre counterpsseurre counterpsseurer counterpsseruer counterpsserure counterpssereur counterpssereru
counterpsserreu counterpsserrue counterpsserure counterpsseruer counterpsserrue counterpsserreu counterpssereru
counterpssereur counterpsursere counterpsurseer counterpsursree counterpsursree counterpsursere counterpsurseer
counterpsuresre counterpsureser counterpsurerse counterpsureres counterpsureers counterpsureesr counterpsurrese
counterpsurrees counterpsurrsee counterpsurrsee counterpsurrese counterpsurrees counterpsureers counterpsureesr
counterpsureres counterpsurerse counterpsuresre counterpsureser counterpsusrere counterpsusreer counterpsusrree
counterpsusrree counterpsusrere counterpsusreer counterpsuserre counterpsuserer counterpsuserre counterpsuserer
counterpsuseerr counterpsuseerr counterpsusrere counterpsusreer counterpsusrree counterpsusrree counterpsusrere
counterpsusreer counterpsuseerr counterpsuseerr counterpsuserer counterpsuserre counterpsuserre counterpsuserer
counterpsuesrre counterpsuesrer counterpsuesrre counterpsuesrer counterpsueserr counterpsueserr counterpsuersre
counterpsuerser counterpsuerrse counterpsuerres counterpsuerers counterpsueresr counterpsuerrse counterpsuerres
counterpsuersre counterpsuerser counterpsueresr counterpsuerers counterpsueerrs counterpsueersr counterpsueerrs
counterpsueersr counterpsueesrr counterpsueesrr counterpsursere counterpsurseer counterpsursree counterpsursree
counterpsursere counterpsurseer counterpsuresre counterpsureser counterpsurerse counterpsureres counterpsureers
counterpsureesr counterpsurrese counterpsurrees counterpsurrsee counterpsurrsee counterpsurrese counterpsurrees
counterpsureers counterpsureesr counterpsureres counterpsurerse counterpsuresre counterpsureser counterpsueserr
counterpsueserr counterpsuesrer counterpsuesrre counterpsuesrre counterpsuesrer counterpsueesrr counterpsueesrr
counterpsueersr counterpsueerrs counterpsueerrs counterpsueersr counterpsueresr counterpsuerers counterpsuerser
counterpsuersre counterpsuerrse counterpsuerres counterpsuerers counterpsueresr counterpsuerres counterpsuerrse
counterpsuersre counterpsuerser counterpsrrsuee counterpsrrsuee counterpsrrseue counterpsrrseeu counterpsrrseeu
counterpsrrseue counterpsrrusee counterpsrrusee counterpsrruese counterpsrruees counterpsrruees counterpsrruese
counterpsrreuse counterpsrreues counterpsrresue counterpsrreseu counterpsrreesu counterpsrreeus counterpsrreues
counterpsrreuse counterpsrreeus counterpsrreesu counterpsrreseu counterpsrresue counterpsrsruee counterpsrsruee
counterpsrsreue counterpsrsreeu counterpsrsreeu counterpsrsreue counterpsrsuree counterpsrsuree counterpsrsuere
counterpsrsueer counterpsrsueer counterpsrsuere counterpsrseure counterpsrseuer counterpsrserue counterpsrsereu
counterpsrseeru counterpsrseeur counterpsrseuer counterpsrseure counterpsrseeur counterpsrseeru counterpsrsereu
counterpsrserue counterpsrusree counterpsrusree counterpsrusere counterpsruseer counterpsruseer counterpsrusere
counterpsrursee counterpsrursee counterpsrurese counterpsrurees counterpsrurees counterpsrurese counterpsruerse
counterpsrueres counterpsruesre counterpsrueser counterpsrueesr counterpsrueers counterpsrueres counterpsruerse
counterpsrueers counterpsrueesr counterpsrueser counterpsruesre counterpsresure counterpsresuer counterpsresrue
counterpsresreu counterpsreseru counterpsreseur counterpsreusre counterpsreuser counterpsreurse counterpsreures
counterpsreuers counterpsreuesr counterpsreruse counterpsrerues counterpsrersue counterpsrerseu counterpsreresu
counterpsrereus counterpsreeurs counterpsreeusr counterpsreerus counterpsreersu counterpsreesru counterpsreesur
counterpsresuer counterpsresure counterpsreseur counterpsreseru counterpsresreu counterpsresrue counterpsreuser
counterpsreusre counterpsreuesr counterpsreuers counterpsreures counterpsreurse counterpsreeusr counterpsreeurs
counterpsreesur counterpsreesru counterpsreersu counterpsreerus counterpsrerues counterpsreruse counterpsrereus
counterpsreresu counterpsrerseu counterpsrersue counterpsersure counterpsersuer counterpsersrue counterpsersreu
counterpserseru counterpserseur counterpserusre counterpseruser counterpserurse counterpserures counterpseruers
counterpseruesr counterpserruse counterpserrues counterpserrsue counterpserrseu counterpserresu counterpserreus
counterpsereurs counterpsereusr counterpsererus counterpserersu counterpseresru counterpseresur counterpsesrure
counterpsesruer counterpsesrrue counterpsesrreu counterpsesreru counterpsesreur counterpsesurre counterpsesurer
counterpsesurre counterpsesurer counterpsesuerr counterpsesuerr counterpsesrure counterpsesruer counterpsesrrue
counterpsesrreu counterpsesreru counterpsesreur counterpseseurr counterpseseurr counterpseserur counterpseserru
counterpseserru counterpseserur counterpseusrre counterpseusrer counterpseusrre counterpseusrer counterpseuserr
counterpseuserr counterpseursre counterpseurser counterpseurrse counterpseurres counterpseurers counterpseuresr
counterpseurrse counterpseurres counterpseursre counterpseurser counterpseuresr counterpseurers counterpseuerrs
counterpseuersr counterpseuerrs counterpseuersr counterpseuesrr counterpseuesrr counterpsersure counterpsersuer
counterpsersrue counterpsersreu counterpserseru counterpserseur counterpserusre counterpseruser counterpserurse
counterpserures counterpseruers counterpseruesr counterpserruse counterpserrues counterpserrsue counterpserrseu
counterpserresu counterpserreus counterpsereurs counterpsereusr counterpsererus counterpserersu counterpseresru
counterpseresur counterpseesurr counterpseesurr counterpseesrur counterpseesrru counterpseesrru counterpseesrur
counterpseeusrr counterpseeusrr counterpseeursr counterpseeurrs counterpseeurrs counterpseeursr counterpseerusr
counterpseerurs counterpseersur counterpseersru counterpseerrsu counterpseerrus counterpseerurs counterpseerusr
counterpseerrus counterpseerrsu counterpseersru counterpseersur counterpsesrure counterpsesruer counterpsesrrue
counterpsesrreu counterpsesreru counterpsesreur counterpsesurre counterpsesurer counterpsesurre counterpsesurer
counterpsesuerr counterpsesuerr counterpsesrure counterpsesruer counterpsesrrue counterpsesrreu counterpsesreru
counterpsesreur counterpseseurr counterpseseurr counterpseserur counterpseserru counterpseserru counterpseserur
counterpsersure counterpsersuer counterpsersrue counterpsersreu counterpserseru counterpserseur counterpserusre
counterpseruser counterpserurse counterpserures counterpseruers counterpseruesr counterpserruse counterpserrues
counterpserrsue counterpserrseu counterpserresu counterpserreus counterpsereurs counterpsereusr counterpsererus
counterpserersu counterpseresru counterpseresur counterpseursre counterpseurser counterpseurrse counterpseurres
counterpseurers counterpseuresr counterpseusrre counterpseusrer counterpseusrre counterpseusrer counterpseuserr
counterpseuserr counterpseursre counterpseurser counterpseurrse counterpseurres counterpseurers counterpseuresr
counterpseuesrr counterpseuesrr counterpseuersr counterpseuerrs counterpseuerrs counterpseuersr counterpserruse
counterpserrues counterpserrsue counterpserrseu counterpserresu counterpserreus counterpserurse counterpserures
counterpserusre counterpseruser counterpseruesr counterpseruers counterpsersure counterpsersuer counterpsersrue
counterpsersreu counterpserseru counterpserseur counterpsereusr counterpsereurs counterpseresur counterpseresru
counterpserersu counterpsererus counterpseerurs counterpseerusr counterpseerrus counterpseerrsu counterpseersru
counterpseersur counterpseeurrs counterpseeursr counterpseeurrs counterpseeursr counterpseeusrr counterpseeusrr
counterpseerurs counterpseerusr counterpseerrus counterpseerrsu counterpseersru counterpseersur counterpseesurr
counterpseesurr counterpseesrur counterpseesrru counterpseesrru counterpseesrur counterpsserure counterpsseruer
counterpsserrue counterpsserreu counterpssereru counterpssereur counterpsseurre counterpsseurer counterpsseurre
counterpsseurer counterpsseuerr counterpsseuerr counterpsserure counterpsseruer counterpsserrue counterpsserreu
counterpssereru counterpssereur counterpsseeurr counterpsseeurr counterpsseerur counterpsseerru counterpsseerru
counterpsseerur counterpssreure counterpssreuer counterpssrerue counterpssrereu counterpssreeru counterpssreeur
counterpssruere counterpssrueer counterpssruree counterpssruree counterpssruere counterpssrueer counterpssrruee
counterpssrruee counterpssrreue counterpssrreeu counterpssrreeu counterpssrreue counterpssreure counterpssreuer
counterpssrerue counterpssrereu counterpssreeru counterpssreeur counterpssurere counterpssureer counterpssurree
counterpssurree counterpssurere counterpssureer counterpssuerre counterpssuerer counterpssuerre counterpssuerer
counterpssueerr counterpssueerr counterpssurere counterpssureer counterpssurree counterpssurree counterpssurere
counterpssureer counterpssueerr counterpssueerr counterpssuerer counterpssuerre counterpssuerre counterpssuerer
counterpssrruee counterpssrruee counterpssrreue counterpssrreeu counterpssrreeu counterpssrreue counterpssruree
counterpssruree counterpssruere counterpssrueer counterpssrueer counterpssruere counterpssreure counterpssreuer
counterpssrerue counterpssrereu counterpssreeru counterpssreeur counterpssreuer counterpssreure counterpssreeur
counterpssreeru counterpssrereu counterpssrerue counterpsserure counterpsseruer counterpsserrue counterpsserreu
counterpssereru counterpssereur counterpsseurre counterpsseurer counterpsseurre counterpsseurer counterpsseuerr
counterpsseuerr counterpsserure counterpsseruer counterpsserrue counterpsserreu counterpssereru counterpssereur
counterpsseeurr counterpsseeurr counterpsseerur counterpsseerru counterpsseerru counterpsseerur counterpsrseure
counterpsrseuer counterpsrserue counterpsrsereu counterpsrseeru counterpsrseeur counterpsrsuere counterpsrsueer
counterpsrsuree counterpsrsuree counterpsrsuere counterpsrsueer counterpsrsruee counterpsrsruee counterpsrsreue
counterpsrsreeu counterpsrsreeu counterpsrsreue counterpsrseure counterpsrseuer counterpsrserue counterpsrsereu
counterpsrseeru counterpsrseeur counterpsresure counterpsresuer counterpsresrue counterpsresreu counterpsreseru
counterpsreseur counterpsreusre counterpsreuser counterpsreurse counterpsreures counterpsreuers counterpsreuesr
counterpsreruse counterpsrerues counterpsrersue counterpsrerseu counterpsreresu counterpsrereus counterpsreeurs
counterpsreeusr counterpsreerus counterpsreersu counterpsreesru counterpsreesur counterpsruesre counterpsrueser
counterpsruerse counterpsrueres counterpsrueers counterpsrueesr counterpsrusere counterpsruseer counterpsrusree
counterpsrusree counterpsrusere counterpsruseer counterpsrursee counterpsrursee counterpsrurese counterpsrurees
counterpsrurees counterpsrurese counterpsruesre counterpsrueser counterpsruerse counterpsrueres counterpsrueers
counterpsrueesr counterpsrreuse counterpsrreues counterpsrresue counterpsrreseu counterpsrreesu counterpsrreeus
counterpsrruese counterpsrruees counterpsrrusee counterpsrrusee counterpsrruese counterpsrruees counterpsrrsuee
counterpsrrsuee counterpsrrseue counterpsrrseeu counterpsrrseeu counterpsrrseue counterpsrreuse counterpsrreues
counterpsrresue counterpsrreseu counterpsrreesu counterpsrreeus counterpsreeurs counterpsreeusr counterpsreerus
counterpsreersu counterpsreesru counterpsreesur counterpsreuers counterpsreuesr counterpsreures counterpsreurse
counterpsreusre counterpsreuser counterpsrerues counterpsreruse counterpsrereus counterpsreresu counterpsrerseu
counterpsrersue counterpsresure counterpsresuer counterpsresrue counterpsresreu counterpsreseru counterpsreseur
counterpsusrere counterpsusreer counterpsusrree counterpsusrree counterpsusrere counterpsusreer counterpsuserre
counterpsuserer counterpsuserre counterpsuserer counterpsuseerr counterpsuseerr counterpsusrere counterpsusreer
counterpsusrree counterpsusrree counterpsusrere counterpsusreer counterpsuseerr counterpsuseerr counterpsuserer
counterpsuserre counterpsuserre counterpsuserer counterpsursere counterpsurseer counterpsursree counterpsursree
counterpsursere counterpsurseer counterpsuresre counterpsureser counterpsurerse counterpsureres counterpsureers
counterpsureesr counterpsurrese counterpsurrees counterpsurrsee counterpsurrsee counterpsurrese counterpsurrees
counterpsureers counterpsureesr counterpsureres counterpsurerse counterpsuresre counterpsureser counterpsuersre
counterpsuerser counterpsuerrse counterpsuerres counterpsuerers counterpsueresr counterpsuesrre counterpsuesrer
counterpsuesrre counterpsuesrer counterpsueserr counterpsueserr counterpsuersre counterpsuerser counterpsuerrse
counterpsuerres counterpsuerers counterpsueresr counterpsueesrr counterpsueesrr counterpsueersr counterpsueerrs
counterpsueerrs counterpsueersr counterpsurrese counterpsurrees counterpsurrsee counterpsurrsee counterpsurrese
counterpsurrees counterpsurerse counterpsureres counterpsuresre counterpsureser counterpsureesr counterpsureers
counterpsursere counterpsurseer counterpsursree counterpsursree counterpsursere counterpsurseer counterpsureesr
counterpsureers counterpsureser counterpsuresre counterpsurerse counterpsureres counterpsuerers counterpsueresr
counterpsuerres counterpsuerrse counterpsuersre counterpsuerser counterpsueerrs counterpsueersr counterpsueerrs
counterpsueersr counterpsueesrr counterpsueesrr counterpsuerers counterpsueresr counterpsuerres counterpsuerrse
counterpsuersre counterpsuerser counterpsueserr counterpsueserr counterpsuesrer counterpsuesrre counterpsuesrre
counterpsuesrer counterpsrsruee counterpsrsruee counterpsrsreue counterpsrsreeu counterpsrsreeu counterpsrsreue
counterpsrsuree counterpsrsuree counterpsrsuere counterpsrsueer counterpsrsueer counterpsrsuere counterpsrseure
counterpsrseuer counterpsrserue counterpsrsereu counterpsrseeru counterpsrseeur counterpsrseuer counterpsrseure
counterpsrseeur counterpsrseeru counterpsrsereu counterpsrserue counterpsrrsuee counterpsrrsuee counterpsrrseue
counterpsrrseeu counterpsrrseeu counterpsrrseue counterpsrrusee counterpsrrusee counterpsrruese counterpsrruees
counterpsrruees counterpsrruese counterpsrreuse counterpsrreues counterpsrresue counterpsrreseu counterpsrreesu
counterpsrreeus counterpsrreues counterpsrreuse counterpsrreeus counterpsrreesu counterpsrreseu counterpsrresue
counterpsrursee counterpsrursee counterpsrurese counterpsrurees counterpsrurees counterpsrurese counterpsrusree
counterpsrusree counterpsrusere counterpsruseer counterpsruseer counterpsrusere counterpsruesre counterpsrueser
counterpsruerse counterpsrueres counterpsrueers counterpsrueesr counterpsrueser counterpsruesre counterpsrueesr
counterpsrueers counterpsrueres counterpsruerse counterpsreruse counterpsrerues counterpsrersue counterpsrerseu
counterpsreresu counterpsrereus counterpsreurse counterpsreures counterpsreusre counterpsreuser counterpsreuesr
counterpsreuers counterpsresure counterpsresuer counterpsresrue counterpsresreu counterpsreseru counterpsreseur
counterpsreeusr counterpsreeurs counterpsreesur counterpsreesru counterpsreersu counterpsreerus counterpsrerues
counterpsreruse counterpsrereus counterpsreresu counterpsrerseu counterpsrersue counterpsreures counterpsreurse
counterpsreuers counterpsreuesr counterpsreuser counterpsreusre counterpsreeurs counterpsreeusr counterpsreerus
counterpsreersu counterpsreesru counterpsreesur counterpsresuer counterpsresure counterpsreseur counterpsreseru
counterpsresreu counterpsresrue counterpsesrure counterpsesruer counterpsesrrue counterpsesrreu counterpsesreru
counterpsesreur counterpsesurre counterpsesurer counterpsesurre counterpsesurer counterpsesuerr counterpsesuerr
counterpsesrure counterpsesruer counterpsesrrue counterpsesrreu counterpsesreru counterpsesreur counterpseseurr
counterpseseurr counterpseserur counterpseserru counterpseserru counterpseserur counterpsersure counterpsersuer
counterpsersrue counterpsersreu counterpserseru counterpserseur counterpserusre counterpseruser counterpserurse
counterpserures counterpseruers counterpseruesr counterpserruse counterpserrues counterpserrsue counterpserrseu
counterpserresu counterpserreus counterpsereurs counterpsereusr counterpsererus counterpserersu counterpseresru
counterpseresur counterpseursre counterpseurser counterpseurrse counterpseurres counterpseurers counterpseuresr
counterpseusrre counterpseusrer counterpseusrre counterpseusrer counterpseuserr counterpseuserr counterpseursre
counterpseurser counterpseurrse counterpseurres counterpseurers counterpseuresr counterpseuesrr counterpseuesrr
counterpseuersr counterpseuerrs counterpseuerrs counterpseuersr counterpserruse counterpserrues counterpserrsue
counterpserrseu counterpserresu counterpserreus counterpserurse counterpserures counterpserusre counterpseruser
counterpseruesr counterpseruers counterpsersure counterpsersuer counterpsersrue counterpsersreu counterpserseru
counterpserseur counterpsereusr counterpsereurs counterpseresur counterpseresru counterpserersu counterpsererus
counterpseerurs counterpseerusr counterpseerrus counterpseerrsu counterpseersru counterpseersur counterpseeurrs
counterpseeursr counterpseeurrs counterpseeursr counterpseeusrr counterpseeusrr counterpseerurs counterpseerusr
counterpseerrus counterpseerrsu counterpseersru counterpseersur counterpseesurr counterpseesurr counterpseesrur
counterpseesrru counterpseesrru counterpseesrur counterpuessrre counterpuessrer counterpuessrre counterpuessrer
counterpuesserr counterpuesserr counterpuesrsre counterpuesrser counterpuesrrse counterpuesrres counterpuesrers
counterpuesresr counterpuesrrse counterpuesrres counterpuesrsre counterpuesrser counterpuesresr counterpuesrers
counterpueserrs counterpuesersr counterpueserrs counterpuesersr counterpuesesrr counterpuesesrr counterpuessrre
counterpuessrer counterpuessrre counterpuessrer counterpuesserr counterpuesserr counterpuesrsre counterpuesrser
counterpuesrrse counterpuesrres counterpuesrers counterpuesresr counterpuesrrse counterpuesrres counterpuesrsre
counterpuesrser counterpuesresr counterpuesrers counterpueserrs counterpuesersr counterpueserrs counterpuesersr
counterpuesesrr counterpuesesrr counterpuerssre counterpuersser counterpuersrse counterpuersres counterpuersers
counterpuersesr counterpuerssre counterpuersser counterpuersrse counterpuersres counterpuersers counterpuersesr
counterpuerrsse counterpuerrses counterpuerrsse counterpuerrses counterpuerress counterpuerress counterpueresrs
counterpueressr counterpuererss counterpuererss counterpueresrs counterpueressr counterpuersrse counterpuersres
counterpuerssre counterpuersser counterpuersesr counterpuersers counterpuerrsse counterpuerrses counterpuerrsse
counterpuerrses counterpuerress counterpuerress counterpuersrse counterpuersres counterpuerssre counterpuersser
counterpuersesr counterpuersers counterpuererss counterpuererss counterpueresrs counterpueressr counterpueressr
counterpueresrs counterpueesrrs counterpueesrsr counterpueesrrs counterpueesrsr counterpueessrr counterpueessrr
counterpueersrs counterpueerssr counterpueerrss counterpueerrss counterpueersrs counterpueerssr counterpueerrss
counterpueerrss counterpueersrs counterpueerssr counterpueerssr counterpueersrs counterpueesrrs counterpueesrsr
counterpueesrrs counterpueesrsr counterpueessrr counterpueessrr counterpusesrre counterpusesrer counterpusesrre
counterpusesrer counterpuseserr counterpuseserr counterpusersre counterpuserser counterpuserrse counterpuserres
counterpuserers counterpuseresr counterpuserrse counterpuserres counterpusersre counterpuserser counterpuseresr
counterpuserers counterpuseerrs counterpuseersr counterpuseerrs counterpuseersr counterpuseesrr counterpuseesrr
counterpusserre counterpusserer counterpusserre counterpusserer counterpusseerr counterpusseerr counterpussrere
counterpussreer counterpussrree counterpussrree counterpussrere counterpussreer counterpussrree counterpussrree
counterpussrere counterpussreer counterpussreer counterpussrere counterpusserre counterpusserer counterpusserre
counterpusserer counterpusseerr counterpusseerr counterpusrsere counterpusrseer counterpusrsree counterpusrsree
counterpusrsere counterpusrseer counterpusresre counterpusreser counterpusrerse counterpusreres counterpusreers
counterpusreesr counterpusrrese counterpusrrees counterpusrrsee counterpusrrsee counterpusrrese counterpusrrees
counterpusreers counterpusreesr counterpusreres counterpusrerse counterpusresre counterpusreser counterpusrsree
counterpusrsree counterpusrsere counterpusrseer counterpusrseer counterpusrsere counterpusrrsee counterpusrrsee
counterpusrrese counterpusrrees counterpusrrees counterpusrrese counterpusrerse counterpusreres counterpusresre
counterpusreser counterpusreesr counterpusreers counterpusreres counterpusrerse counterpusreers counterpusreesr
counterpusreser counterpusresre counterpusesrre counterpusesrer counterpusesrre counterpusesrer counterpuseserr
counterpuseserr counterpusersre counterpuserser counterpuserrse counterpuserres counterpuserers counterpuseresr
counterpuserrse counterpuserres counterpusersre counterpuserser counterpuseresr counterpuserers counterpuseerrs
counterpuseersr counterpuseerrs counterpuseersr counterpuseesrr counterpuseesrr counterpusserre counterpusserer
counterpusserre counterpusserer counterpusseerr counterpusseerr counterpussrere counterpussreer counterpussrree
counterpussrree counterpussrere counterpussreer counterpussrree counterpussrree counterpussrere counterpussreer
counterpussreer counterpussrere counterpusserre counterpusserer counterpusserre counterpusserer counterpusseerr
counterpusseerr counterpusesrre counterpusesrer counterpusesrre counterpusesrer counterpuseserr counterpuseserr
counterpusersre counterpuserser counterpuserrse counterpuserres counterpuserers counterpuseresr counterpuserrse
counterpuserres counterpusersre counterpuserser counterpuseresr counterpuserers counterpuseerrs counterpuseersr
counterpuseerrs counterpuseersr counterpuseesrr counterpuseesrr counterpusresre counterpusreser counterpusrerse
counterpusreres counterpusreers counterpusreesr counterpusrsere counterpusrseer counterpusrsree counterpusrsree
counterpusrsere counterpusrseer counterpusrrsee counterpusrrsee counterpusrrese counterpusrrees counterpusrrees
counterpusrrese counterpusresre counterpusreser counterpusrerse counterpusreres counterpusreers counterpusreesr
counterpusrerse counterpusreres counterpusresre counterpusreser counterpusreesr counterpusreers counterpusrrese
counterpusrrees counterpusrrsee counterpusrrsee counterpusrrese counterpusrrees counterpusrsree counterpusrsree
counterpusrsere counterpusrseer counterpusrseer counterpusrsere counterpusrerse counterpusreres counterpusresre
counterpusreser counterpusreesr counterpusreers counterpuseerrs counterpuseersr counterpuseerrs counterpuseersr
counterpuseesrr counterpuseesrr counterpuserers counterpuseresr counterpuserres counterpuserrse counterpusersre
counterpuserser counterpuserres counterpuserrse counterpuserers counterpuseresr counterpuserser counterpusersre
counterpusesrre counterpusesrer counterpusesrre counterpusesrer counterpuseserr counterpuseserr counterpurssere
counterpursseer counterpurssree counterpurssree counterpurssere counterpursseer counterpursesre counterpurseser
counterpurserse counterpurseres counterpurseers counterpurseesr counterpursrese counterpursrees counterpursrsee
counterpursrsee counterpursrese counterpursrees counterpurseers counterpurseesr counterpurseres counterpurserse
counterpursesre counterpurseser counterpurssere counterpursseer counterpurssree counterpurssree counterpurssere
counterpursseer counterpursesre counterpurseser counterpurserse counterpurseres counterpurseers counterpurseesr
counterpursrese counterpursrees counterpursrsee counterpursrsee counterpursrese counterpursrees counterpurseers
counterpurseesr counterpurseres counterpurserse counterpursesre counterpurseser counterpuressre counterpuresser
counterpuresrse counterpuresres counterpuresers counterpuresesr counterpuressre counterpuresser counterpuresrse
counterpuresres counterpuresers counterpuresesr counterpurersse counterpurerses counterpurersse counterpurerses
counterpureress counterpureress counterpureesrs counterpureessr counterpureerss counterpureerss counterpureesrs
counterpureessr counterpurrsese counterpurrsees counterpurrssee counterpurrssee counterpurrsese counterpurrsees
counterpurresse counterpurreses counterpurresse counterpurreses counterpurreess counterpurreess counterpurrsese
counterpurrsees counterpurrssee counterpurrssee counterpurrsese counterpurrsees counterpurreess counterpurreess
counterpurreses counterpurresse counterpurresse counterpurreses counterpuresers counterpuresesr counterpuresres
counterpuresrse counterpuressre counterpuresser counterpureesrs counterpureessr counterpureerss counterpureerss
counterpureesrs counterpureessr counterpureress counterpureress counterpurerses counterpurersse counterpurersse
counterpurerses counterpuresers counterpuresesr counterpuresres counterpuresrse counterpuressre counterpuresser
counterpurssree counterpurssree counterpurssere counterpursseer counterpursseer counterpurssere counterpursrsee
counterpursrsee counterpursrese counterpursrees counterpursrees counterpursrese counterpurserse counterpurseres
counterpursesre counterpurseser counterpurseesr counterpurseers counterpurseres counterpurserse counterpurseers
counterpurseesr counterpurseser counterpursesre counterpurssree counterpurssree counterpurssere counterpursseer
counterpursseer counterpurssere counterpursrsee counterpursrsee counterpursrese counterpursrees counterpursrees
counterpursrese counterpurserse counterpurseres counterpursesre counterpurseser counterpurseesr counterpurseers
counterpurseres counterpurserse counterpurseers counterpurseesr counterpurseser counterpursesre counterpurrssee
counterpurrssee counterpurrsese counterpurrsees counterpurrsees counterpurrsese counterpurrssee counterpurrssee
counterpurrsese counterpurrsees counterpurrsees counterpurrsese counterpurresse counterpurreses counterpurresse
counterpurreses counterpurreess counterpurreess counterpurreses counterpurresse counterpurreess counterpurreess
counterpurreses counterpurresse counterpuresrse counterpuresres counterpuressre counterpuresser counterpuresesr
counterpuresers counterpurersse counterpurerses counterpurersse counterpurerses counterpureress counterpureress
counterpuresrse counterpuresres counterpuressre counterpuresser counterpuresesr counterpuresers counterpureerss
counterpureerss counterpureesrs counterpureessr counterpureessr counterpureesrs counterpuresres counterpuresrse
counterpuresers counterpuresesr counterpuresser counterpuressre counterpurerses counterpurersse counterpureress
counterpureress counterpurerses counterpurersse counterpureerss counterpureerss counterpureesrs counterpureessr
counterpureessr counterpureesrs counterpuresres counterpuresrse counterpuresers counterpuresesr counterpuresser
counterpuressre counterpuessrre counterpuessrer counterpuessrre counterpuessrer counterpuesserr counterpuesserr
counterpuesrsre counterpuesrser counterpuesrrse counterpuesrres counterpuesrers counterpuesresr counterpuesrrse
counterpuesrres counterpuesrsre counterpuesrser counterpuesresr counterpuesrers counterpueserrs counterpuesersr
counterpueserrs counterpuesersr counterpuesesrr counterpuesesrr counterpuessrre counterpuessrer counterpuessrre
counterpuessrer counterpuesserr counterpuesserr counterpuesrsre counterpuesrser counterpuesrrse counterpuesrres
counterpuesrers counterpuesresr counterpuesrrse counterpuesrres counterpuesrsre counterpuesrser counterpuesresr
counterpuesrers counterpueserrs counterpuesersr counterpueserrs counterpuesersr counterpuesesrr counterpuesesrr
counterpuerssre counterpuersser counterpuersrse counterpuersres counterpuersers counterpuersesr counterpuerssre
counterpuersser counterpuersrse counterpuersres counterpuersers counterpuersesr counterpuerrsse counterpuerrses
counterpuerrsse counterpuerrses counterpuerress counterpuerress counterpueresrs counterpueressr counterpuererss
counterpuererss counterpueresrs counterpueressr counterpuersrse counterpuersres counterpuerssre counterpuersser
counterpuersesr counterpuersers counterpuerrsse counterpuerrses counterpuerrsse counterpuerrses counterpuerress
counterpuerress counterpuersrse counterpuersres counterpuerssre counterpuersser counterpuersesr counterpuersers
counterpuererss counterpuererss counterpueresrs counterpueressr counterpueressr counterpueresrs counterpueesrrs
counterpueesrsr counterpueesrrs counterpueesrsr counterpueessrr counterpueessrr counterpueersrs counterpueerssr
counterpueerrss counterpueerrss counterpueersrs counterpueerssr counterpueerrss counterpueerrss counterpueersrs
counterpueerssr counterpueerssr counterpueersrs counterpueesrrs counterpueesrsr counterpueesrrs counterpueesrsr
counterpueessrr counterpueessrr counterpressure counterpressuer counterpressrue counterpressreu counterpresseru
counterpresseur counterpresusre counterpresuser counterpresurse counterpresures counterpresuers counterpresuesr
counterpresruse counterpresrues counterpresrsue counterpresrseu counterpresresu counterpresreus counterpreseurs
counterpreseusr counterpreserus counterpresersu counterpresesru counterpresesur counterpressure counterpressuer
counterpressrue counterpressreu counterpresseru counterpresseur counterpresusre counterpresuser counterpresurse
counterpresures counterpresuers counterpresuesr counterpresruse counterpresrues counterpresrsue counterpresrseu
counterpresresu counterpresreus counterpreseurs counterpreseusr counterpreserus counterpresersu counterpresesru
counterpresesur counterpreussre counterpreusser counterpreusrse counterpreusres counterpreusers counterpreusesr
counterpreussre counterpreusser counterpreusrse counterpreusres counterpreusers counterpreusesr counterpreursse
counterpreurses counterpreursse counterpreurses counterpreuress counterpreuress counterpreuesrs counterpreuessr
counterpreuerss counterpreuerss counterpreuesrs counterpreuessr counterprersuse counterprersues counterprerssue
counterprersseu counterprersesu counterprerseus counterprerusse counterpreruses counterprerusse counterpreruses
counterpreruess counterpreruess counterprersuse counterprersues counterprerssue counterprersseu counterprersesu
counterprerseus counterprereuss counterprereuss counterpreresus counterpreressu counterpreressu counterpreresus
counterpreesurs counterpreesusr counterpreesrus counterpreesrsu counterpreessru counterpreessur counterpreeusrs
counterpreeussr counterpreeurss counterpreeurss counterpreeusrs counterpreeussr counterpreeruss counterpreeruss
counterpreersus counterpreerssu counterpreerssu counterpreersus counterpreesurs counterpreesusr counterpreesrus
counterpreesrsu counterpreessru counterpreessur counterprsesure counterprsesuer counterprsesrue counterprsesreu
counterprseseru counterprseseur counterprseusre counterprseuser counterprseurse counterprseures counterprseuers
counterprseuesr counterprseruse counterprserues counterprsersue counterprserseu counterprseresu counterprsereus
counterprseeurs counterprseeusr counterprseerus counterprseersu counterprseesru counterprseesur counterprsseure
counterprsseuer counterprsserue counterprssereu counterprsseeru counterprsseeur counterprssuere counterprssueer
counterprssuree counterprssuree counterprssuere counterprssueer counterprssruee counterprssruee counterprssreue
counterprssreeu counterprssreeu counterprssreue counterprsseure counterprsseuer counterprsserue counterprssereu
counterprsseeru counterprsseeur counterprsusere counterprsuseer counterprsusree counterprsusree counterprsusere
counterprsuseer counterprsuesre counterprsueser counterprsuerse counterprsueres counterprsueers counterprsueesr
counterprsurese counterprsurees counterprsursee counterprsursee counterprsurese counterprsurees counterprsueers
counterprsueesr counterprsueres counterprsuerse counterprsuesre counterprsueser counterprsrsuee counterprsrsuee
counterprsrseue counterprsrseeu counterprsrseeu counterprsrseue counterprsrusee counterprsrusee counterprsruese
counterprsruees counterprsruees counterprsruese counterprsreuse counterprsreues counterprsresue counterprsreseu
counterprsreesu counterprsreeus counterprsreues counterprsreuse counterprsreeus counterprsreesu counterprsreseu
counterprsresue counterprsesure counterprsesuer counterprsesrue counterprsesreu counterprseseru counterprseseur
counterprseusre counterprseuser counterprseurse counterprseures counterprseuers counterprseuesr counterprseruse
counterprserues counterprsersue counterprserseu counterprseresu counterprsereus counterprseeurs counterprseeusr
counterprseerus counterprseersu counterprseesru counterprseesur counterprsseure counterprsseuer counterprsserue
counterprssereu counterprsseeru counterprsseeur counterprssuere counterprssueer counterprssuree counterprssuree
counterprssuere counterprssueer counterprssruee counterprssruee counterprssreue counterprssreeu counterprssreeu
counterprssreue counterprsseure counterprsseuer counterprsserue counterprssereu counterprsseeru counterprsseeur
counterprsesure counterprsesuer counterprsesrue counterprsesreu counterprseseru counterprseseur counterprseusre
counterprseuser counterprseurse counterprseures counterprseuers counterprseuesr counterprseruse counterprserues
counterprsersue counterprserseu counterprseresu counterprsereus counterprseeurs counterprseeusr counterprseerus
counterprseersu counterprseesru counterprseesur counterprsuesre counterprsueser counterprsuerse counterprsueres
counterprsueers counterprsueesr counterprsusere counterprsuseer counterprsusree counterprsusree counterprsusere
counterprsuseer counterprsursee counterprsursee counterprsurese counterprsurees counterprsurees counterprsurese
counterprsuesre counterprsueser counterprsuerse counterprsueres counterprsueers counterprsueesr counterprsreuse
counterprsreues counterprsresue counterprsreseu counterprsreesu counterprsreeus counterprsruese counterprsruees
counterprsrusee counterprsrusee counterprsruese counterprsruees counterprsrsuee counterprsrsuee counterprsrseue
counterprsrseeu counterprsrseeu counterprsrseue counterprsreuse counterprsreues counterprsresue counterprsreseu
counterprsreesu counterprsreeus counterprseeurs counterprseeusr counterprseerus counterprseersu counterprseesru
counterprseesur counterprseuers counterprseuesr counterprseures counterprseurse counterprseusre counterprseuser
counterprserues counterprseruse counterprsereus counterprseresu counterprserseu counterprsersue counterprsesure
counterprsesuer counterprsesrue counterprsesreu counterprseseru counterprseseur counterprussere counterprusseer
counterprussree counterprussree counterprussere counterprusseer counterprusesre counterpruseser counterpruserse
counterpruseres counterpruseers counterpruseesr counterprusrese counterprusrees counterprusrsee counterprusrsee
counterprusrese counterprusrees counterpruseers counterpruseesr counterpruseres counterpruserse counterprusesre
counterpruseser counterprussere counterprusseer counterprussree counterprussree counterprussere counterprusseer
counterprusesre counterpruseser counterpruserse counterpruseres counterpruseers counterpruseesr counterprusrese
counterprusrees counterprusrsee counterprusrsee counterprusrese counterprusrees counterpruseers counterpruseesr
counterpruseres counterpruserse counterprusesre counterpruseser counterpruessre counterpruesser counterpruesrse
counterpruesres counterpruesers counterpruesesr counterpruessre counterpruesser counterpruesrse counterpruesres
counterpruesers counterpruesesr counterpruersse counterpruerses counterpruersse counterpruerses counterprueress
counterprueress counterprueesrs counterprueessr counterprueerss counterprueerss counterprueesrs counterprueessr
counterprursese counterprursees counterprurssee counterprurssee counterprursese counterprursees counterpruresse
counterprureses counterpruresse counterprureses counterprureess counterprureess counterprursese counterprursees
counterprurssee counterprurssee counterprursese counterprursees counterprureess counterprureess counterprureses
counterpruresse counterpruresse counterprureses counterpruesers counterpruesesr counterpruesres counterpruesrse
counterpruessre counterpruesser counterprueesrs counterprueessr counterprueerss counterprueerss counterprueesrs
counterprueessr counterprueress counterprueress counterpruerses counterpruersse counterpruersse counterpruerses
counterpruesers counterpruesesr counterpruesres counterpruesrse counterpruessre counterpruesser counterprrssuee
counterprrssuee counterprrsseue counterprrsseeu counterprrsseeu counterprrsseue counterprrsusee counterprrsusee
counterprrsuese counterprrsuees counterprrsuees counterprrsuese counterprrseuse counterprrseues counterprrsesue
counterprrseseu counterprrseesu counterprrseeus counterprrseues counterprrseuse counterprrseeus counterprrseesu
counterprrseseu counterprrsesue counterprrssuee counterprrssuee counterprrsseue counterprrsseeu counterprrsseeu
counterprrsseue counterprrsusee counterprrsusee counterprrsuese counterprrsuees counterprrsuees counterprrsuese
counterprrseuse counterprrseues counterprrsesue counterprrseseu counterprrseesu counterprrseeus counterprrseues
counterprrseuse counterprrseeus counterprrseesu counterprrseseu counterprrsesue counterprrussee counterprrussee
counterprrusese counterprrusees counterprrusees counterprrusese counterprrussee counterprrussee counterprrusese
counterprrusees counterprrusees counterprrusese counterprruesse counterprrueses counterprruesse counterprrueses
counterprrueess counterprrueess counterprrueses counterprruesse counterprrueess counterprrueess counterprrueses
counterprruesse counterprresuse counterprresues counterprressue counterprresseu counterprresesu counterprreseus
counterprreusse counterprreuses counterprreusse counterprreuses counterprreuess counterprreuess counterprresuse
counterprresues counterprressue counterprresseu counterprresesu counterprreseus counterprreeuss counterprreeuss
counterprreesus counterprreessu counterprreessu counterprreesus counterprresues counterprresuse counterprreseus
counterprresesu counterprresseu counterprressue counterprreuses counterprreusse counterprreuess counterprreuess
counterprreuses counterprreusse counterprreeuss counterprreeuss counterprreesus counterprreessu counterprreessu
counterprreesus counterprresues counterprresuse counterprreseus counterprresesu counterprresseu counterprressue
counterpressure counterpressuer counterpressrue counterpressreu counterpresseru counterpresseur counterpresusre
counterpresuser counterpresurse counterpresures counterpresuers counterpresuesr counterpresruse counterpresrues
counterpresrsue counterpresrseu counterpresresu counterpresreus counterpreseurs counterpreseusr counterpreserus
counterpresersu counterpresesru counterpresesur counterpressure counterpressuer counterpressrue counterpressreu
counterpresseru counterpresseur counterpresusre counterpresuser counterpresurse counterpresures counterpresuers
counterpresuesr counterpresruse counterpresrues counterpresrsue counterpresrseu counterpresresu counterpresreus
counterpreseurs counterpreseusr counterpreserus counterpresersu counterpresesru counterpresesur counterpreussre
counterpreusser counterpreusrse counterpreusres counterpreusers counterpreusesr counterpreussre counterpreusser
counterpreusrse counterpreusres counterpreusers counterpreusesr counterpreursse counterpreurses counterpreursse
counterpreurses counterpreuress counterpreuress counterpreuesrs counterpreuessr counterpreuerss counterpreuerss
counterpreuesrs counterpreuessr counterprersuse counterprersues counterprerssue counterprersseu counterprersesu
counterprerseus counterprerusse counterpreruses counterprerusse counterpreruses counterpreruess counterpreruess
counterprersuse counterprersues counterprerssue counterprersseu counterprersesu counterprerseus counterprereuss
counterprereuss counterpreresus counterpreressu counterpreressu counterpreresus counterpreesurs counterpreesusr
counterpreesrus counterpreesrsu counterpreessru counterpreessur counterpreeusrs counterpreeussr counterpreeurss
counterpreeurss counterpreeusrs counterpreeussr counterpreeruss counterpreeruss counterpreersus counterpreerssu
counterpreerssu counterpreersus counterpreesurs counterpreesusr counterpreesrus counterpreesrsu counterpreessru
counterpreessur counterpeessurr counterpeessurr counterpeessrur counterpeessrru counterpeessrru counterpeessrur
counterpeesusrr counterpeesusrr counterpeesursr counterpeesurrs counterpeesurrs counterpeesursr counterpeesrusr
counterpeesrurs counterpeesrsur counterpeesrsru counterpeesrrsu counterpeesrrus counterpeesrurs counterpeesrusr
counterpeesrrus counterpeesrrsu counterpeesrsru counterpeesrsur counterpeessurr counterpeessurr counterpeessrur
counterpeessrru counterpeessrru counterpeessrur counterpeesusrr counterpeesusrr counterpeesursr counterpeesurrs
counterpeesurrs counterpeesursr counterpeesrusr counterpeesrurs counterpeesrsur counterpeesrsru counterpeesrrsu
counterpeesrrus counterpeesrurs counterpeesrusr counterpeesrrus counterpeesrrsu counterpeesrsru counterpeesrsur
counterpeeussrr counterpeeussrr counterpeeusrsr counterpeeusrrs counterpeeusrrs counterpeeusrsr counterpeeussrr
counterpeeussrr counterpeeusrsr counterpeeusrrs counterpeeusrrs counterpeeusrsr counterpeeurssr counterpeeursrs
counterpeeurssr counterpeeursrs counterpeeurrss counterpeeurrss counterpeeursrs counterpeeurssr counterpeeurrss
counterpeeurrss counterpeeursrs counterpeeurssr counterpeersusr counterpeersurs counterpeerssur counterpeerssru
counterpeersrsu counterpeersrus counterpeerussr counterpeerusrs counterpeerussr counterpeerusrs counterpeerurss
counterpeerurss counterpeersusr counterpeersurs counterpeerssur counterpeerssru counterpeersrsu counterpeersrus
counterpeerruss counterpeerruss counterpeerrsus counterpeerrssu counterpeerrssu counterpeerrsus counterpeersurs
counterpeersusr counterpeersrus counterpeersrsu counterpeerssru counterpeerssur counterpeerusrs counterpeerussr
counterpeerurss counterpeerurss counterpeerusrs counterpeerussr counterpeerruss counterpeerruss counterpeerrsus
counterpeerrssu counterpeerrssu counterpeerrsus counterpeersurs counterpeersusr counterpeersrus counterpeersrsu
counterpeerssru counterpeerssur counterpesesurr counterpesesurr counterpesesrur counterpesesrru counterpesesrru
counterpesesrur counterpeseusrr counterpeseusrr counterpeseursr counterpeseurrs counterpeseurrs counterpeseursr
counterpeserusr counterpeserurs counterpesersur counterpesersru counterpeserrsu counterpeserrus counterpeserurs
counterpeserusr counterpeserrus counterpeserrsu counterpesersru counterpesersur counterpesseurr counterpesseurr
counterpesserur counterpesserru counterpesserru counterpesserur counterpessuerr counterpessuerr counterpessurer
counterpessurre counterpessurre counterpessurer counterpessruer counterpessrure counterpessreur counterpessreru
counterpessrreu counterpessrrue counterpessrure counterpessruer counterpessrrue counterpessrreu counterpessreru
counterpessreur counterpesuserr counterpesuserr counterpesusrer counterpesusrre counterpesusrre counterpesusrer
counterpesuesrr counterpesuesrr counterpesuersr counterpesuerrs counterpesuerrs counterpesuersr counterpesuresr
counterpesurers counterpesurser counterpesursre counterpesurrse counterpesurres counterpesurers counterpesuresr
counterpesurres counterpesurrse counterpesursre counterpesurser counterpesrsuer counterpesrsure counterpesrseur
counterpesrseru counterpesrsreu counterpesrsrue counterpesruser counterpesrusre counterpesruesr counterpesruers
counterpesrures counterpesrurse counterpesreusr counterpesreurs counterpesresur counterpesresru counterpesrersu
counterpesrerus counterpesrrues counterpesrruse counterpesrreus counterpesrresu counterpesrrseu counterpesrrsue
counterpesrsure counterpesrsuer counterpesrsrue counterpesrsreu counterpesrseru counterpesrseur counterpesrusre
counterpesruser counterpesrurse counterpesrures counterpesruers counterpesruesr counterpesrruse counterpesrrues
counterpesrrsue counterpesrrseu counterpesrresu counterpesrreus counterpesreurs counterpesreusr counterpesrerus
counterpesrersu counterpesresru counterpesresur counterpesseurr counterpesseurr counterpesserur counterpesserru
counterpesserru counterpesserur counterpessuerr counterpessuerr counterpessurer counterpessurre counterpessurre
counterpessurer counterpessruer counterpessrure counterpessreur counterpessreru counterpessrreu counterpessrrue
counterpessrure counterpessruer counterpessrrue counterpessrreu counterpessreru counterpessreur counterpesesurr
counterpesesurr counterpesesrur counterpesesrru counterpesesrru counterpesesrur counterpeseusrr counterpeseusrr
counterpeseursr counterpeseurrs counterpeseurrs counterpeseursr counterpeserusr counterpeserurs counterpesersur
counterpesersru counterpeserrsu counterpeserrus counterpeserurs counterpeserusr counterpeserrus counterpeserrsu
counterpesersru counterpesersur counterpesuesrr counterpesuesrr counterpesuersr counterpesuerrs counterpesuerrs
counterpesuersr counterpesuserr counterpesuserr counterpesusrer counterpesusrre counterpesusrre counterpesusrer
counterpesurser counterpesursre counterpesuresr counterpesurers counterpesurres counterpesurrse counterpesursre
counterpesurser counterpesurrse counterpesurres counterpesurers counterpesuresr counterpesreusr counterpesreurs
counterpesresur counterpesresru counterpesrersu counterpesrerus counterpesruesr counterpesruers counterpesruser
counterpesrusre counterpesrurse counterpesrures counterpesrsuer counterpesrsure counterpesrseur counterpesrseru
counterpesrsreu counterpesrsrue counterpesrruse counterpesrrues counterpesrrsue counterpesrrseu counterpesrresu
counterpesrreus counterpesreurs counterpesreusr counterpesrerus counterpesrersu counterpesresru counterpesresur
counterpesruers counterpesruesr counterpesrures counterpesrurse counterpesrusre counterpesruser counterpesrrues
counterpesrruse counterpesrreus counterpesrresu counterpesrrseu counterpesrrsue counterpesrsure counterpesrsuer
counterpesrsrue counterpesrsreu counterpesrseru counterpesrseur counterpeusserr counterpeusserr counterpeussrer
counterpeussrre counterpeussrre counterpeussrer counterpeusesrr counterpeusesrr counterpeusersr counterpeuserrs
counterpeuserrs counterpeusersr counterpeusresr counterpeusrers counterpeusrser counterpeusrsre counterpeusrrse
counterpeusrres counterpeusrers counterpeusresr counterpeusrres counterpeusrrse counterpeusrsre counterpeusrser
counterpeusserr counterpeusserr counterpeussrer counterpeussrre counterpeussrre counterpeussrer counterpeusesrr
counterpeusesrr counterpeusersr counterpeuserrs counterpeuserrs counterpeusersr counterpeusresr counterpeusrers
counterpeusrser counterpeusrsre counterpeusrrse counterpeusrres counterpeusrers counterpeusresr counterpeusrres
counterpeusrrse counterpeusrsre counterpeusrser counterpeuessrr counterpeuessrr counterpeuesrsr counterpeuesrrs
counterpeuesrrs counterpeuesrsr counterpeuessrr counterpeuessrr counterpeuesrsr counterpeuesrrs counterpeuesrrs
counterpeuesrsr counterpeuerssr counterpeuersrs counterpeuerssr counterpeuersrs counterpeuerrss counterpeuerrss
counterpeuersrs counterpeuerssr counterpeuerrss counterpeuerrss counterpeuersrs counterpeuerssr counterpeursesr
counterpeursers counterpeursser counterpeurssre counterpeursrse counterpeursres counterpeuressr counterpeuresrs
counterpeuressr counterpeuresrs counterpeurerss counterpeurerss counterpeursesr counterpeursers counterpeursser
counterpeurssre counterpeursrse counterpeursres counterpeurress counterpeurress counterpeurrses counterpeurrsse
counterpeurrsse counterpeurrses counterpeursers counterpeursesr counterpeursres counterpeursrse counterpeurssre
counterpeursser counterpeuresrs counterpeuressr counterpeurerss counterpeurerss counterpeuresrs counterpeuressr
counterpeurress counterpeurress counterpeurrses counterpeurrsse counterpeurrsse counterpeurrses counterpeursers
counterpeursesr counterpeursres counterpeursrse counterpeurssre counterpeursser counterperssuer counterperssure
counterpersseur counterpersseru counterperssreu counterperssrue counterpersuser counterpersusre counterpersuesr
counterpersuers counterpersures counterpersurse counterperseusr counterperseurs counterpersesur counterpersesru
counterpersersu counterperserus counterpersrues counterpersruse counterpersreus counterpersresu counterpersrseu
counterpersrsue counterperssuer counterperssure counterpersseur counterpersseru counterperssreu counterperssrue
counterpersuser counterpersusre counterpersuesr counterpersuers counterpersures counterpersurse counterperseusr
counterperseurs counterpersesur counterpersesru counterpersersu counterperserus counterpersrues counterpersruse
counterpersreus counterpersresu counterpersrseu counterpersrsue counterperusser counterperussre counterperusesr
counterperusers counterperusres counterperusrse counterperusser counterperussre counterperusesr counterperusers
counterperusres counterperusrse counterperuessr counterperuesrs counterperuessr counterperuesrs counterperuerss
counterperuerss counterperurses counterperursse counterperuress counterperuress counterperurses counterperursse
counterperesusr counterperesurs counterperessur counterperessru counterperesrsu counterperesrus counterpereussr
counterpereusrs counterpereussr counterpereusrs counterpereurss counterpereurss counterperesusr counterperesurs
counterperessur counterperessru counterperesrsu counterperesrus counterpereruss counterpereruss counterperersus
counterpererssu counterpererssu counterperersus counterperrsues counterperrsuse counterperrseus counterperrsesu
counterperrsseu counterperrssue counterperruses counterperrusse counterperruess counterperruess counterperruses
counterperrusse counterperreuss counterperreuss counterperresus counterperressu counterperressu counterperresus
counterperrsues counterperrsuse counterperrseus counterperrsesu counterperrsseu counterperrssue counterperssure
counterperssuer counterperssrue counterperssreu counterpersseru counterpersseur counterpersusre counterpersuser
counterpersurse counterpersures counterpersuers counterpersuesr counterpersruse counterpersrues counterpersrsue
counterpersrseu counterpersresu counterpersreus counterperseurs counterperseusr counterperserus counterpersersu
counterpersesru counterpersesur counterperssure counterperssuer counterperssrue counterperssreu counterpersseru
counterpersseur counterpersusre counterpersuser counterpersurse counterpersures counterpersuers counterpersuesr
counterpersruse counterpersrues counterpersrsue counterpersrseu counterpersresu counterpersreus counterperseurs
counterperseusr counterperserus counterpersersu counterpersesru counterpersesur counterperussre counterperusser
counterperusrse counterperusres counterperusers counterperusesr counterperussre counterperusser counterperusrse
counterperusres counterperusers counterperusesr counterperursse counterperurses counterperursse counterperurses
counterperuress counterperuress counterperuesrs counterperuessr counterperuerss counterperuerss counterperuesrs
counterperuessr counterperrsuse counterperrsues counterperrssue counterperrsseu counterperrsesu counterperrseus
counterperrusse counterperruses counterperrusse counterperruses counterperruess counterperruess counterperrsuse
counterperrsues counterperrssue counterperrsseu counterperrsesu counterperrseus counterperreuss counterperreuss
counterperresus counterperressu counterperressu counterperresus counterperesurs counterperesusr counterperesrus
counterperesrsu counterperessru counterperessur counterpereusrs counterpereussr counterpereurss counterpereurss
counterpereusrs counterpereussr counterpereruss counterpereruss counterperersus counterpererssu counterpererssu
counterperersus counterperesurs counterperesusr counterperesrus counterperesrsu counterperessru counterperessur

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us