easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

fourrier

refluent

beligan

jupati

xylinid

outtower

tossups

flagitate

giorni

sleepiness

vocalis

uastaberis

rhizoidal

cyatholith

dehiscenta

habituate

visionless

totemic


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: cotten
cipher variations:
dpuufo eqvvgp frwwhq gsxxir htyyjs
iuzzkt jvaalu kwbbmv lxccnw myddox
nzeepy oaffqz pbggra qchhsb rdiitc
sejjud tfkkve ugllwf vhmmxg winnyh
xjoozi ykppaj zlqqbk amrrcl bnssdm

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: cotten
Cipher: xlggvm

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: cotten
Cipher: AAABA ABBAB BAABA BAABA AABAA ABBAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: cotten
cipher variations:
dpuufohrggnoltssvopveedotxqqloxzcctofdaajojfmmro
nhyyzorjkkhovlwwpozniixoeqvvgpishhopmuttwpqwffep
uyrrmpyaddupgebbkpkgnnspoizzapskllipwmxxqpaojjyp
frwwhqjtiipqnvuuxqrxggfqvzssnqzbeevqhfcclqlhootq
pjaabqtlmmjqxnyyrqbpkkzqgsxxirkujjqrowvvyrsyhhgr
wattoracffwrigddmrmippurqkbbcrumnnkryozzsrcqllar
htyyjslvkkrspxwwzstziihsxbuupsbdggxsjheensnjqqvs
rlccdsvnoolszpaatsdrmmbsiuzzktmwllstqyxxatuajjit
ycvvqtcehhytkiffotokrrwtsmddetwoppmtaqbbutesnnct
jvaalunxmmturzyybuvbkkjuzdwwrudfiizuljggpuplssxu
tneefuxpqqnubrccvuftoodukwbbmvoynnuvsazzcvwcllkv
aexxsvegjjavmkhhqvqmttyvuoffgvyqrrovcsddwvguppev
lxccnwpzoovwtbaadwxdmmlwbfyytwfhkkbwnliirwrnuuzw
vpgghwzrsspwdteexwhvqqfwmyddoxqappwxucbbexyennmx
cgzzuxgillcxomjjsxsovvaxwqhhixasttqxeuffyxiwrrgx
nzeepyrbqqxyvdccfyzfoonydhaavyhjmmdypnkktytpwwby
xriijybtuuryfvggzyjxsshyoaffqzscrryzweddgzagppoz
eibbwziknnezqolluzuqxxczysjjkzcuvvszgwhhazkyttiz
pbggratdsszaxfeehabhqqpafjccxajloofarpmmvavryyda
ztkkladvwwtahxiibalzuujaqchhsbuettabygffibcirrqb
gkddybkmppgbsqnnwbwszzebaullmbewxxubiyjjcbmavvkb
rdiitcvfuubczhggjcdjssrchleezclnqqhctrooxcxtaafc
bvmmncfxyyvcjzkkdcnbwwlcsejjudwgvvcdaihhkdekttsd
imffadmorridusppydyubbgdcwnnodgyzzwdkalledocxxmd
tfkkvexhwwdebjiilefluutejnggbenpssjevtqqzezvcche
dxoopehzaaxelbmmfepdyyneugllwfyixxefckjjmfgmvvuf
kohhcfoqttkfwurrafawddifeyppqfiabbyfmcnngfqezzof
vhmmxgzjyyfgdlkknghnwwvglpiidgpruulgxvssbgbxeejg
fzqqrgjbcczgndoohgrfaapgwinnyhakzzghemllohioxxwh
mqjjehqsvvmhywttchcyffkhgarrshkcddahoeppihsgbbqh
xjooziblaahifnmmpijpyyxinrkkfirtwwnizxuudidzggli
hbsstildeebipfqqjithccriykppajcmbbijgonnqjkqzzyj
osllgjsuxxojayvvejeahhmjicttujmeffcjqgrrkjuiddsj
zlqqbkdnccjkhpoorklraazkptmmhktvyypkbzwwfkfbiink
jduuvknfggdkrhsslkvjeetkamrrcleoddkliqppslmsbbal
qunniluwzzqlcaxxglgcjjolkevvwloghhelsittmlwkfful
bnssdmfpeelmjrqqtmntccbmrvoojmvxaarmdbyyhmhdkkpm
lfwwxmphiifmtjuunmxlggvmcottengqffmnksrrunouddcn
swppknwybbsneczziniellqnmgxxynqijjgnukvvonymhhwn

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: cotten
Cipher: pbggra

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: cotten
Cipher: 314344445133

Extended Methods:
Method #1

Plaintext: cotten
method variations:
htyyksnyddpxsdiiucxioozh

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
c o t t e n 
3 4 4 4 5 3 
1 3 4 4 1 3 
They are then read out in rows:
344453134413
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: cotten
Cipher: stpltl

Read more ...
Method #3

Plaintext: cotten
method variations:
qstyln stylnq tylnqs
ylnqst lnqsty nqstyl

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: cotten

all 720 cipher variations:
cotten cottne cotetn cotent cotnet cotnte cotten cottne cotetn cotent cotnet
cotnte coettn coetnt coettn coetnt coentt coentt contet contte conett conett
contet contte ctoten ctotne ctoetn ctoent ctonet ctonte cttoen cttone ctteon
ctteno cttneo cttnoe cteton ctetno cteotn cteont ctenot ctento ctnteo ctntoe
ctneto ctneot ctnoet ctnote cttoen cttone ctteon ctteno cttneo cttnoe ctoten
ctotne ctoetn ctoent ctonet ctonte cteotn cteont cteton ctetno ctento ctenot
ctnoet ctnote ctneot ctneto ctnteo ctntoe cetton cettno cetotn cetont cetnot
cetnto cetton cettno cetotn cetont cetnot cetnto ceottn ceotnt ceottn ceotnt
ceontt ceontt centot centto cenott cenott centot centto cntteo cnttoe cnteto
cnteot cntoet cntote cntteo cnttoe cnteto cnteot cntoet cntote cnetto cnetot
cnetto cnetot cneott cneott cnotet cnotte cnoett cnoett cnotet cnotte octten
octtne octetn octent octnet octnte octten octtne octetn octent octnet octnte
ocettn ocetnt ocettn ocetnt ocentt ocentt ocntet ocntte ocnett ocnett ocntet
ocntte otcten otctne otcetn otcent otcnet otcnte ottcen ottcne ottecn ottenc
ottnec ottnce otetcn otetnc otectn otecnt otenct otentc otntec otntce otnetc
otnect otncet otncte ottcen ottcne ottecn ottenc ottnec ottnce otcten otctne
otcetn otcent otcnet otcnte otectn otecnt otetcn otetnc otentc otenct otncet
otncte otnect otnetc otntec otntce oettcn oettnc oetctn oetcnt oetnct oetntc
oettcn oettnc oetctn oetcnt oetnct oetntc oecttn oectnt oecttn oectnt oecntt
oecntt oentct oenttc oenctt oenctt oentct oenttc onttec onttce ontetc ontect
ontcet ontcte onttec onttce ontetc ontect ontcet ontcte onettc onetct onettc
onetct onectt onectt onctet onctte oncett oncett onctet onctte tocten toctne
tocetn tocent tocnet tocnte totcen totcne totecn totenc totnec totnce toetcn
toetnc toectn toecnt toenct toentc tontec tontce tonetc tonect toncet toncte
tcoten tcotne tcoetn tcoent tconet tconte tctoen tctone tcteon tcteno tctneo
tctnoe tceton tcetno tceotn tceont tcenot tcento tcnteo tcntoe tcneto tcneot
tcnoet tcnote ttcoen ttcone ttceon ttceno ttcneo ttcnoe ttocen ttocne ttoecn
ttoenc ttonec ttonce tteocn tteonc ttecon ttecno ttenco ttenoc ttnoec ttnoce
ttneoc ttneco ttnceo ttncoe tecton tectno tecotn tecont tecnot tecnto tetcon
tetcno tetocn tetonc tetnoc tetnco teotcn teotnc teoctn teocnt teonct teontc
tentoc tentco tenotc tenoct tencot tencto tncteo tnctoe tnceto tnceot tncoet
tncote tntceo tntcoe tnteco tnteoc tntoec tntoce tnetco tnetoc tnecto tnecot
tneoct tneotc tnotec tnotce tnoetc tnoect tnocet tnocte totcen totcne totecn
totenc totnec totnce tocten toctne tocetn tocent tocnet tocnte toectn toecnt
toetcn toetnc toentc toenct toncet toncte tonect tonetc tontec tontce ttocen
ttocne ttoecn ttoenc ttonec ttonce ttcoen ttcone ttceon ttceno ttcneo ttcnoe
ttecon ttecno tteocn tteonc ttenoc ttenco ttnceo ttncoe ttneco ttneoc ttnoec
ttnoce tctoen tctone tcteon tcteno tctneo tctnoe tcoten tcotne tcoetn tcoent
tconet tconte tceotn tceont tceton tcetno tcento tcenot tcnoet tcnote tcneot
tcneto tcnteo tcntoe tetcon tetcno tetocn tetonc tetnoc tetnco tecton tectno
tecotn tecont tecnot tecnto teoctn teocnt teotcn teotnc teontc teonct tencot
tencto tenoct tenotc tentoc tentco tntceo tntcoe tnteco tnteoc tntoec tntoce
tncteo tnctoe tnceto tnceot tncoet tncote tnecto tnecot tnetco tnetoc tneotc
tneoct tnocet tnocte tnoect tnoetc tnotec tnotce eottcn eottnc eotctn eotcnt
eotnct eotntc eottcn eottnc eotctn eotcnt eotnct eotntc eocttn eoctnt eocttn
eoctnt eocntt eocntt eontct eonttc eonctt eonctt eontct eonttc etotcn etotnc
etoctn etocnt etonct etontc ettocn ettonc ettcon ettcno ettnco ettnoc etcton
etctno etcotn etcont etcnot etcnto etntco etntoc etncto etncot etnoct etnotc
ettocn ettonc ettcon ettcno ettnco ettnoc etotcn etotnc etoctn etocnt etonct
etontc etcotn etcont etcton etctno etcnto etcnot etnoct etnotc etncot etncto
etntco etntoc ectton ecttno ectotn ectont ectnot ectnto ectton ecttno ectotn
ectont ectnot ectnto ecottn ecotnt ecottn ecotnt econtt econtt ecntot ecntto
ecnott ecnott ecntot ecntto enttco enttoc entcto entcot entoct entotc enttco
enttoc entcto entcot entoct entotc enctto enctot enctto enctot encott encott
enotct enottc enoctt enoctt enotct enottc nottec nottce notetc notect notcet
notcte nottec nottce notetc notect notcet notcte noettc noetct noettc noetct
noectt noectt noctet noctte nocett nocett noctet noctte ntotec ntotce ntoetc
ntoect ntocet ntocte nttoec nttoce ntteoc ntteco nttceo nttcoe ntetoc ntetco
nteotc nteoct ntecot ntecto ntcteo ntctoe ntceto ntceot ntcoet ntcote nttoec
nttoce ntteoc ntteco nttceo nttcoe ntotec ntotce ntoetc ntoect ntocet ntocte
nteotc nteoct ntetoc ntetco ntecto ntecot ntcoet ntcote ntceot ntceto ntcteo
ntctoe nettoc nettco netotc netoct netcot netcto nettoc nettco netotc netoct
netcot netcto neottc neotct neottc neotct neoctt neoctt nectot nectto necott
necott nectot nectto nctteo ncttoe ncteto ncteot nctoet nctote nctteo ncttoe
ncteto ncteot nctoet nctote ncetto ncetot ncetto ncetot nceott nceott ncotet
ncotte ncoett ncoett ncotet ncotte

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us