easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

pseudococtate

fightwite

actuating

disproportionableness

smithd

rieux

ronane

teucrin

aptaverat

disloyally

phuong

mirabar

bribegiving

bushton

apmontreal

pomerene

decurias

seasicknesses


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: correo
cipher variations:
dpssfp eqttgq fruuhr gsvvis htwwjt
iuxxku jvyylv kwzzmw lxaanx mybboy
nzccpz oaddqa pbeerb qcffsc rdggtd
sehhue tfiivf ugjjwg vhkkxh willyi
xjmmzj yknnak zloobl amppcm bnqqdn

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: correo
Cipher: xliivl

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: correo
Cipher: AAABA ABBAB BAAAA BAAAA AABAA ABBAB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: correo
cipher variations:
dpssfphraanrltiivtpvqqdvtxyylxxzggtzfdwwjdjfeerf
nhmmzhrjuuhjvlccplznkkxneqttgqisbbosmujjwuqwrrew
uyzzmyyahhuagexxkekgffsgoinnaiskvvikwmddqmaollyo
fruuhrjtccptnvkkxvrxssfxvzaanzzbiivbhfyylflhggth
pjoobjtlwwjlxneernbpmmzpgsvviskuddquowllywsyttgy
wabboaacjjwcigzzmgmihhuiqkppckumxxkmyoffsocqnnaq
htwwjtlveervpxmmzxtzuuhzxbccpbbdkkxdjhaanhnjiivj
rlqqdlvnyylnzpggtpdroobriuxxkumwffswqynnayuavvia
ycddqccellyekibboiokjjwksmrremwozzmoaqhhuqesppcs
jvyylvnxggtxrzoobzvbwwjbzdeerddfmmzfljccpjplkkxl
tnssfnxpaanpbriivrftqqdtkwzzmwoyhhuysappcawcxxkc
aeffseegnnagmkddqkqmllymuottgoyqbboqcsjjwsgurreu
lxaanxpziivztbqqdbxdyyldbfggtffhoobhnleerlrnmmzn
vpuuhpzrccprdtkkxthvssfvmybboyqajjwaucrrecyezzme
cghhuggippciomffsmsonnaowqvviqasddqseullyuiwttgw
nzccpzrbkkxbvdssfdzfaanfdhiivhhjqqdjpnggtntpoobp
xrwwjrbteertfvmmzvjxuuhxoaddqascllycwettgeagbbog
eijjwiikrrekqohhuouqppcqysxxkscuffsugwnnawkyvviy
pbeerbtdmmzdxfuuhfbhccphfjkkxjjlssflrpiivpvrqqdr
ztyyltdvggtvhxoobxlzwwjzqcffscuennaeygvvigciddqi
gkllykkmttgmsqjjwqwsrresauzzmuewhhuwiyppcymaxxka
rdggtdvfoobfzhwwjhdjeerjhlmmzllnuuhntrkkxrxtssft
bvaanvfxiivxjzqqdznbyylbsehhuewgppcgaixxkiekffsk
imnnammovviousllysyuttgucwbbowgyjjwykarreaoczzmc
tfiivfxhqqdhbjyyljflggtljnoobnnpwwjpvtmmztzvuuhv
dxccpxhzkkxzlbssfbpdaandugjjwgyirreickzzmkgmhhum
koppcooqxxkqwunnauawvviweyddqyiallyamcttgcqebboe
vhkkxhzjssfjdlaanlhniivnlpqqdppryylrxvoobvbxwwjx
fzeerzjbmmzbnduuhdrfccpfwillyiakttgkembbomiojjwo
mqrreqqszzmsywppcwcyxxkygaffsakcnnacoevviesgddqg
xjmmzjbluuhlfnccpnjpkkxpnrssfrrtaantzxqqdxdzyylz
hbggtbldoobdpfwwjftheerhyknnakcmvvimgoddqokqllyq
osttgssubbouayrreyeazzmaichhucmeppceqgxxkguiffsi
zloobldnwwjnhpeerplrmmzrptuuhttvccpvbzssfzfbaanb
jdiivdnfqqdfrhyylhvjggtjamppcmeoxxkoiqffsqmsnnas
quvviuuwddqwcattgagcbbockejjweogrregsizzmiwkhhuk
bnqqdnfpyylpjrggtrntoobtrvwwjvvxeerxdbuuhbhdccpd
lfkkxfphssfhtjaanjxliivlcorreogqzzmqkshhusouppcu
swxxkwwyffsyecvvicieddqemgllygqittgiukbbokymjjwm

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: correo
Cipher: pbeerb

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: correo
Cipher: 314324245143

Extended Methods:
Method #1

Plaintext: correo
method variations:
htwwktnybbpysdggudximmzi

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
c o r r e o 
3 4 2 2 5 4 
1 3 4 4 1 3 
They are then read out in rows:
342254134413
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: correo
Cipher: sgultl

Read more ...
Method #3

Plaintext: correo
method variations:
qhiyqn hiyqnq iyqnqh
yqnqhi qnqhiy nqhiyq

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: correo

all 720 cipher variations:
correo corroe corero coreor coroer corore correo corroe corero coreor coroer
corore coerro coeror coerro coeror coeorr coeorr coorer coorre cooerr cooerr
coorer coorre croreo croroe croero croeor crooer croore crroeo crrooe crreoo
crreoo crroeo crrooe creroo creroo creoro creoor creoor creoro croreo croroe
croero croeor crooer croore crroeo crrooe crreoo crreoo crroeo crrooe croreo
croroe croero croeor crooer croore creoro creoor creroo creroo creoro creoor
crooer croore croeor croero croreo croroe cerroo cerroo ceroro ceroor ceroor
ceroro cerroo cerroo ceroro ceroor ceroor ceroro ceorro ceoror ceorro ceoror
ceoorr ceoorr ceoror ceorro ceoorr ceoorr ceoror ceorro correo corroe corero
coreor coroer corore correo corroe corero coreor coroer corore coerro coeror
coerro coeror coeorr coeorr coorer coorre cooerr cooerr coorer coorre ocrreo
ocrroe ocrero ocreor ocroer ocrore ocrreo ocrroe ocrero ocreor ocroer ocrore
ocerro oceror ocerro oceror oceorr oceorr ocorer ocorre ocoerr ocoerr ocorer
ocorre orcreo orcroe orcero orceor orcoer orcore orrceo orrcoe orreco orreoc
orroec orroce orerco oreroc orecro orecor oreocr oreorc ororec ororce oroerc
oroecr orocer orocre orrceo orrcoe orreco orreoc orroec orroce orcreo orcroe
orcero orceor orcoer orcore orecro orecor orerco oreroc oreorc oreocr orocer
orocre oroecr oroerc ororec ororce oerrco oerroc oercro oercor oerocr oerorc
oerrco oerroc oercro oercor oerocr oerorc oecrro oecror oecrro oecror oecorr
oecorr oeorcr oeorrc oeocrr oeocrr oeorcr oeorrc oorrec oorrce oorerc oorecr
oorcer oorcre oorrec oorrce oorerc oorecr oorcer oorcre ooerrc ooercr ooerrc
ooercr ooecrr ooecrr oocrer oocrre oocerr oocerr oocrer oocrre rocreo rocroe
rocero roceor rocoer rocore rorceo rorcoe roreco roreoc roroec roroce roerco
roeroc roecro roecor roeocr roeorc roorec roorce rooerc rooecr roocer roocre
rcoreo rcoroe rcoero rcoeor rcooer rcoore rcroeo rcrooe rcreoo rcreoo rcroeo
rcrooe rceroo rceroo rceoro rceoor rceoor rceoro rcoreo rcoroe rcoero rcoeor
rcooer rcoore rrcoeo rrcooe rrceoo rrceoo rrcoeo rrcooe rroceo rrocoe rroeco
rroeoc rrooec rrooce rreoco rreooc rrecoo rrecoo rreoco rreooc rrooec rrooce
rroeoc rroeco rroceo rrocoe recroo recroo recoro recoor recoor recoro rercoo
rercoo reroco rerooc rerooc reroco reorco reoroc reocro reocor reoocr reoorc
reoroc reorco reoorc reoocr reocor reocro rocreo rocroe rocero roceor rocoer
rocore rorceo rorcoe roreco roreoc roroec roroce roerco roeroc roecro roecor
roeocr roeorc roorec roorce rooerc rooecr roocer roocre rorceo rorcoe roreco
roreoc roroec roroce rocreo rocroe rocero roceor rocoer rocore roecro roecor
roerco roeroc roeorc roeocr roocer roocre rooecr rooerc roorec roorce rroceo
rrocoe rroeco rroeoc rrooec rrooce rrcoeo rrcooe rrceoo rrceoo rrcoeo rrcooe
rrecoo rrecoo rreoco rreooc rreooc rreoco rroceo rrocoe rroeco rroeoc rrooec
rrooce rcroeo rcrooe rcreoo rcreoo rcroeo rcrooe rcoreo rcoroe rcoero rcoeor
rcooer rcoore rceoro rceoor rceroo rceroo rceoro rceoor rcooer rcoore rcoeor
rcoero rcoreo rcoroe rercoo rercoo reroco rerooc rerooc reroco recroo recroo
recoro recoor recoor recoro reocro reocor reorco reoroc reoorc reoocr reocor
reocro reoocr reoorc reoroc reorco rorceo rorcoe roreco roreoc roroec roroce
rocreo rocroe rocero roceor rocoer rocore roecro roecor roerco roeroc roeorc
roeocr roocer roocre rooecr rooerc roorec roorce eorrco eorroc eorcro eorcor
eorocr eororc eorrco eorroc eorcro eorcor eorocr eororc eocrro eocror eocrro
eocror eocorr eocorr eoorcr eoorrc eoocrr eoocrr eoorcr eoorrc erorco eroroc
erocro erocor eroocr eroorc erroco errooc errcoo errcoo erroco errooc ercroo
ercroo ercoro ercoor ercoor ercoro erorco eroroc erocro erocor eroocr eroorc
erroco errooc errcoo errcoo erroco errooc erorco eroroc erocro erocor eroocr
eroorc ercoro ercoor ercroo ercroo ercoro ercoor eroocr eroorc erocor erocro
erorco eroroc ecrroo ecrroo ecroro ecroor ecroor ecroro ecrroo ecrroo ecroro
ecroor ecroor ecroro ecorro ecoror ecorro ecoror ecoorr ecoorr ecoror ecorro
ecoorr ecoorr ecoror ecorro eorrco eorroc eorcro eorcor eorocr eororc eorrco
eorroc eorcro eorcor eorocr eororc eocrro eocror eocrro eocror eocorr eocorr
eoorcr eoorrc eoocrr eoocrr eoorcr eoorrc oorrec oorrce oorerc oorecr oorcer
oorcre oorrec oorrce oorerc oorecr oorcer oorcre ooerrc ooercr ooerrc ooercr
ooecrr ooecrr oocrer oocrre oocerr oocerr oocrer oocrre ororec ororce oroerc
oroecr orocer orocre orroec orroce orreoc orreco orrceo orrcoe oreroc orerco
oreorc oreocr orecor orecro orcreo orcroe orcero orceor orcoer orcore orroec
orroce orreoc orreco orrceo orrcoe ororec ororce oroerc oroecr orocer orocre
oreorc oreocr oreroc orerco orecro orecor orcoer orcore orceor orcero orcreo
orcroe oerroc oerrco oerorc oerocr oercor oercro oerroc oerrco oerorc oerocr
oercor oercro oeorrc oeorcr oeorrc oeorcr oeocrr oeocrr oecror oecrro oecorr
oecorr oecror oecrro ocrreo ocrroe ocrero ocreor ocroer ocrore ocrreo ocrroe
ocrero ocreor ocroer ocrore ocerro oceror ocerro oceror oceorr oceorr ocorer
ocorre ocoerr ocoerr ocorer ocorre

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us