easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

heliced

provostess

cuppett

comparaverim

schumsacher

intrastate

oviposited

refires

maryedith

trepidavisse

dimming

lanois

semostomae

husbandress

clingfish

threapers

motleyest

southwestwardly


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: convelliebatque
cipher variations:
dpowfmmjfcburvf eqpxgnnkgdcvswg frqyhoolhedwtxh gsrzippmifexuyi htsajqqnjgfyvzj
iutbkrrokhgzwak jvuclssplihaxbl kwvdmttqmjibycm lxwenuurnkjczdn myxfovvsolkdaeo
nzygpwwtpmlebfp oazhqxxuqnmfcgq pbairyyvrongdhr qcbjszzwspoheis rdcktaaxtqpifjt
sedlubbyurqjgku tfemvcczvsrkhlv ugfnwddawtslimw vhgoxeebxutmjnx wihpyffcyvunkoy
xjiqzggdzwvolpz ykjrahheaxwpmqa zlksbiifbyxqnrb amltcjjgczyrosc bnmudkkhdazsptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: convelliebatque
Cipher: xlmevoorvyzgjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: convelliebatque
Cipher: AAABA ABBAB ABBAA BBBAB AABAA ABABA ABABA ABAAA AABAA AAAAB AAAAA BAABA ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: convelliebatque
cipher variations:
dpowfmmjfcburvfhromniiznebgxjnltocveepvgbsdxvpvosdaafdibejldtxoilwwvlkbqpzlxzoytssltmbcvntfdoejkkrjqbahpjjfourgghrsbmndr
nhokzccxzubytrzrjoahyynhwbkzfhvloqpuudpybwftpznogxqqtxabilhxeqpxgnnkgdcvswgispnojjaofchykomupdwffqwhcteywqwptebbgejcfkme
uypjmxxwmlcrqamyapzuttmuncdwougepfkllskrcbiqkkgpvshhistcnoesoipladdyavczusaskpbizzoixclagiwmprqvveqzcxguqaophyrruybcjmiy
frqyhoolhedwtxhjtqopkkbpgdizlpnvqexggrxidufzxrxqufcchfkdglnfvzqknyyxnmdsrbnzbqavuunvodexpvhfqglmmtlsdcjrllhqwtiijtudopft
pjqmbeezbwdavtbtlqcjaapjydmbhjxnqsrwwfradyhvrbpqizssvzcdknjzgsrzippmifexuyikurpqllcqhejamqowrfyhhsyjevgaysyrvgddiglehmog
warlozzyonetscoacrbwvvowpefyqwigrhmnnumtedksmmirxujjkuvepqguqkrncffacxebwucumrdkbbqkzencikyortsxxgsbeziwscqrjattwadeloka
htsajqqnjgfyvzjlvsqrmmdrifkbnrpxsgziitzkfwhbztzswheejhmfinphxbsmpaazpofutdpbdscxwwpxqfgzrxjhsinoovnufeltnnjsyvkklvwfqrhv
rlsodggbdyfcxvdvnselccrlafodjlzpsutyyhtcfajxtdrskbuuxbefmplbiutbkrrokhgzwakmwtrsnnesjglcosqythajjualgxicauatxiffkingjoqi
yctnqbbaqpgvueqcetdyxxqyrghasykitjoppwovgfmuooktzwllmwxgrsiwsmtpehhcezgdywewotfmddsmbgpekmaqtvuzziudgbkyuestlcvvycfgnqmc
jvuclssplihaxblnxustooftkhmdptrzuibkkvbmhyjdbvbuyjggljohkprjzduorccbrqhwvfrdfuezyyrzshibtzljukpqqxpwhgnvppluaxmmnxyhstjx
tnuqfiidfahezxfxpugneetnchqflnbruwvaajvehclzvftumdwwzdghorndkwvdmttqmjibycmoyvtuppgulinequsavjcllwcnizkecwcvzkhhmkpilqsk
aevpsddcsrixwgsegvfazzsatijcuamkvlqrryqxihowqqmvbynnoyzitukyuovrgjjegbifaygyqvhoffuodirgmocsvxwbbkwfidmawguvnexxaehipsoe
lxwenuurnkjczdnpzwuvqqhvmjofrvtbwkdmmxdojalfdxdwaliinlqjmrtlbfwqteedtsjyxhtfhwgbaatbujkdvbnlwmrsszryjipxrrnwczoopzajuvlz
vpwshkkfhcjgbzhzrwipggvpejshnpdtwyxcclxgjenbxhvwofyybfijqtpfmyxfovvsolkdaeoqaxvwrriwnkpgswucxlennyepkbmgeyexbmjjomrknsum
cgxruffeutkzyiugixhcbbucvklewcomxnsttaszkjqyssoxdappqabkvwmawqxtillgidkhcaiasxjqhhwqfktioqeuxzyddmyhkfocyiwxpgzzcgjkruqg
nzygpwwtpmlebfprbywxssjxolqhtxvdymfoozfqlcnhfzfycnkkpnslotvndhysvggfvulazjvhjyidccvdwlmfxdpnyotuubtalkrzttpyebqqrbclwxnb
xryujmmhjelidbjbtykriixrglujprfvyazeenzilgpdzjxyqhaadhklsvrhoazhqxxuqnmfcgqsczxyttkypmriuywezngppagrmdoigagzdollqotmpuwo
eiztwhhgwvmbakwikzjeddwexmngyeqozpuvvcubmlsauuqzfcrrscdmxyocyszvknnikfmjeckcuzlsjjyshmvkqsgwzbaffoajmhqeakyzribbeilmtwsi
pbairyyvrongdhrtdayzuulzqnsjvzxfaohqqbhsnepjhbhaepmmrpunqvxpfjauxiihxwncblxjlakfeexfynohzfrpaqvwwdvcnmtbvvragdsstdenyzpd
ztawloojlgnkfdldvamtkkztinwlrthxacbggpbknirfblzasjccfjmnuxtjqcbjszzwspoheisuebzavvmarotkwaygbpirrcitofqkicibfqnnsqvorwyq
gkbvyjjiyxodcmykmblgffygzopiagsqbrwxxewdonucwwsbhettuefozaqeaubxmppkmholgemewbnullaujoxmsuiybdchhqclojsgcmabtkddgknovyuk
rdcktaaxtqpifjtvfcabwwnbspulxbzhcqjssdjupgrljdjcgrootrwpsxzrhlcwzkkjzypednzlncmhggzhapqjbhtrcsxyyfxepovdxxtcifuuvfgpabrf
bvcynqqlnipmhfnfxcovmmbvkpyntvjzcediirdmpkthdnbculeehlopwzvlsedlubbyurqjgkuwgdbcxxoctqvmycaidrkttekvqhsmkekdhsppusxqtyas
imdxallkazqfeoamodnihhaibqrkciusdtyzzgyfqpweyyudjgvvwghqbcsgcwdzorrmojqnigogydpwnncwlqzouwkadfejjsenqluieocdvmffimpqxawm
tfemvcczvsrkhlvxhecdyypdurwnzdbjesluuflwritnlfleitqqvtyruzbtjneybmmlbargfpbnpeojiibjcrsldjvteuzaahzgrqxfzzvekhwwxhircdth
dxeapssnpkrojhphzeqxoodxmrapvxlbegfkktformvjfpdewnggjnqrybxnugfnwddawtslimwyifdezzqevsxoaeckftmvvgmxsjuomgmfjurrwuzsvacu
kofzcnnmcbshgqcoqfpkjjckdstmekwufvabbiahsrygaawflixxyijsdeuieyfbqttoqlspkiqiafryppeynsbqwymcfhgllugpsnwkgqefxohhkorszcyo
vhgoxeebxutmjnxzjgefaarfwtypbfdlgunwwhnytkvpnhngkvssxvatwbdvlpgadoondctihrdprgqlkkdletunflxvgwbccjbitszhbbxgmjyyzjktefvj
fzgcruuprmtqljrjbgszqqfzotcrxzndgihmmvhqtoxlhrfgypiilpstadzpwihpyffcyvunkoyakhfgbbsgxuzqcgemhvoxxiozulwqoiohlwttywbuxcew
mqhbeppoedujiseqshrmllemfuvogmywhxcddkcjutaiccyhnkzzaklufgwkgahdsvvqsnurmkskchtarrgapudsyaoehjinnwirupymisghzqjjmqtubeaq
xjiqzggdzwvolpzblighccthyvardhfniwpyyjpavmxrpjpimxuuzxcvydfxnricfqqpfevkjtfrtisnmmfngvwphnzxiydeeldkvubjddziolaablmvghxl
hbietwwrtovsnltldiubsshbqvetzbpfikjooxjsvqznjthiarkknruvcfbrykjrahheaxwpmqacmjhidduizwbseigojxqzzkqbwnysqkqjnyvvaydwzegy
osjdgrrqgfwlkugsujtonngohwxqioayjzeffmelwvckeeajpmbbcmnwhiymicjfuxxsupwtomumejvctticrwfuacqgjlkppyktwraokuijbsllosvwdgcs
zlksbiifbyxqnrbdnkijeevjaxctfjhpkyraalrcxoztrlrkozwwbzexafhzptkehssrhgxmlvhtvkupoohpixyrjpbzkafggnfmxwdlffbkqnccdnoxijzn
jdkgvyytvqxupnvnfkwduujdsxgvbdrhkmlqqzluxsbplvjkctmmptwxehdtamltcjjgczyrosceoljkffwkbydugkiqlzsbbmsdypausmslpaxxcafybgia
qulfittsihynmwiuwlvqppiqjyzskqcalbghhognyxemggclroddeopyjkaokelhwzzuwryvqowoglxevvketyhwcesilnmrramvytcqmwkldunnquxyfieu
bnmudkkhdazsptdfpmklggxlczevhljrmatccntezqbvtntmqbyydbgzchjbrvmgjuutjizonxjvxmwrqqjrkzatlrdbmchiiphozyfnhhdmspeefpqzklbp
lfmixaavxszwrpxphmyfwwlfuzixdftjmonssbnwzudrnxlmevoorvyzgjfvconvelliebatquegqnlmhhymdafwimksnbuddoufarcwuounrczzechadikc
swnhkvvukjapoykwynxsrrkslabumsecndijjqipazgoiientqffgqralmcqmgnjybbwytaxsqyqinzgxxmgvajyeguknpottcoxavesoymnfwppswzahkgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: convelliebatque
Cipher: pbairyyvrongdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: convelliebatque
Cipher: 314333155113134251211144145451

Extended Methods:
Method #1

Plaintext: convelliebatque
method variations:
htsakqqokgfyvzknyxfpvvtpmldaepsdcluaayurqifkuxihqzffdzwvolpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
c o n v e l l i e b a t q u e 
3 4 3 1 5 1 1 4 5 2 1 4 1 5 5 
1 3 3 5 1 3 3 2 1 1 1 4 4 4 1 
They are then read out in rows:
343151145214155133513321114441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: convelliebatque
Cipher: sceqkqvenenbatd

Read more ...
Method #3

Plaintext: convelliebatque
method variations:
qnczacswfaqdyyl nczacswfaqdyylq czacswfaqdyylqn
zacswfaqdyylqnc acswfaqdyylqncz cswfaqdyylqncza
swfaqdyylqnczac wfaqdyylqnczacs faqdyylqnczacsw
aqdyylqnczacswf qdyylqnczacswfa dyylqnczacswfaq
yylqnczacswfaqd ylqnczacswfaqdy lqnczacswfaqdyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: convelliebatque

first 5040 cipher variations(1300430725494 total)
convelliebatque convelliebatqeu convelliebatuqe convelliebatueq convelliebateuq convelliebatequ convelliebaqtue
convelliebaqteu convelliebaqute convelliebaquet convelliebaqeut convelliebaqetu convelliebauqte convelliebauqet
convelliebautqe convelliebauteq convelliebauetq convelliebaueqt convelliebaequt convelliebaeqtu convelliebaeuqt
convelliebaeutq convelliebaetuq convelliebaetqu convelliebtaque convelliebtaqeu convelliebtauqe convelliebtaueq
convelliebtaeuq convelliebtaequ convelliebtqaue convelliebtqaeu convelliebtquae convelliebtquea convelliebtqeua
convelliebtqeau convelliebtuqae convelliebtuqea convelliebtuaqe convelliebtuaeq convelliebtueaq convelliebtueqa
convelliebtequa convelliebteqau convelliebteuqa convelliebteuaq convelliebteauq convelliebteaqu convelliebqtaue
convelliebqtaeu convelliebqtuae convelliebqtuea convelliebqteua convelliebqteau convelliebqatue convelliebqateu
convelliebqaute convelliebqauet convelliebqaeut convelliebqaetu convelliebquate convelliebquaet convelliebqutae
convelliebqutea convelliebqueta convelliebqueat convelliebqeaut convelliebqeatu convelliebqeuat convelliebqeuta
convelliebqetua convelliebqetau convelliebutqae convelliebutqea convelliebutaqe convelliebutaeq convelliebuteaq
convelliebuteqa convelliebuqtae convelliebuqtea convelliebuqate convelliebuqaet convelliebuqeat convelliebuqeta
convelliebuaqte convelliebuaqet convelliebuatqe convelliebuateq convelliebuaetq convelliebuaeqt convelliebueqat
convelliebueqta convelliebueaqt convelliebueatq convelliebuetaq convelliebuetqa convelliebetqua convelliebetqau
convelliebetuqa convelliebetuaq convelliebetauq convelliebetaqu convelliebeqtua convelliebeqtau convelliebequta
convelliebequat convelliebeqaut convelliebeqatu convelliebeuqta convelliebeuqat convelliebeutqa convelliebeutaq
convelliebeuatq convelliebeuaqt convelliebeaqut convelliebeaqtu convelliebeauqt convelliebeautq convelliebeatuq
convelliebeatqu convellieabtque convellieabtqeu convellieabtuqe convellieabtueq convellieabteuq convellieabtequ
convellieabqtue convellieabqteu convellieabqute convellieabquet convellieabqeut convellieabqetu convellieabuqte
convellieabuqet convellieabutqe convellieabuteq convellieabuetq convellieabueqt convellieabequt convellieabeqtu
convellieabeuqt convellieabeutq convellieabetuq convellieabetqu convellieatbque convellieatbqeu convellieatbuqe
convellieatbueq convellieatbeuq convellieatbequ convellieatqbue convellieatqbeu convellieatqube convellieatqueb
convellieatqeub convellieatqebu convellieatuqbe convellieatuqeb convellieatubqe convellieatubeq convellieatuebq
convellieatueqb convellieatequb convellieateqbu convellieateuqb convellieateubq convellieatebuq convellieatebqu
convellieaqtbue convellieaqtbeu convellieaqtube convellieaqtueb convellieaqteub convellieaqtebu convellieaqbtue
convellieaqbteu convellieaqbute convellieaqbuet convellieaqbeut convellieaqbetu convellieaqubte convellieaqubet
convellieaqutbe convellieaquteb convellieaquetb convellieaquebt convellieaqebut convellieaqebtu convellieaqeubt
convellieaqeutb convellieaqetub convellieaqetbu convellieautqbe convellieautqeb convellieautbqe convellieautbeq
convellieautebq convellieauteqb convellieauqtbe convellieauqteb convellieauqbte convellieauqbet convellieauqebt
convellieauqetb convellieaubqte convellieaubqet convellieaubtqe convellieaubteq convellieaubetq convellieaubeqt
convellieaueqbt convellieaueqtb convellieauebqt convellieauebtq convellieauetbq convellieauetqb convellieaetqub
convellieaetqbu convellieaetuqb convellieaetubq convellieaetbuq convellieaetbqu convellieaeqtub convellieaeqtbu
convellieaequtb convellieaequbt convellieaeqbut convellieaeqbtu convellieaeuqtb convellieaeuqbt convellieaeutqb
convellieaeutbq convellieaeubtq convellieaeubqt convellieaebqut convellieaebqtu convellieaebuqt convellieaebutq
convellieaebtuq convellieaebtqu convellietabque convellietabqeu convellietabuqe convellietabueq convellietabeuq
convellietabequ convellietaqbue convellietaqbeu convellietaqube convellietaqueb convellietaqeub convellietaqebu
convellietauqbe convellietauqeb convellietaubqe convellietaubeq convellietauebq convellietaueqb convellietaequb
convellietaeqbu convellietaeuqb convellietaeubq convellietaebuq convellietaebqu convellietbaque convellietbaqeu
convellietbauqe convellietbaueq convellietbaeuq convellietbaequ convellietbqaue convellietbqaeu convellietbquae
convellietbquea convellietbqeua convellietbqeau convellietbuqae convellietbuqea convellietbuaqe convellietbuaeq
convellietbueaq convellietbueqa convellietbequa convellietbeqau convellietbeuqa convellietbeuaq convellietbeauq
convellietbeaqu convellietqbaue convellietqbaeu convellietqbuae convellietqbuea convellietqbeua convellietqbeau
convellietqabue convellietqabeu convellietqaube convellietqaueb convellietqaeub convellietqaebu convellietquabe
convellietquaeb convellietqubae convellietqubea convellietqueba convellietqueab convellietqeaub convellietqeabu
convellietqeuab convellietqeuba convellietqebua convellietqebau convellietubqae convellietubqea convellietubaqe
convellietubaeq convellietubeaq convellietubeqa convellietuqbae convellietuqbea convellietuqabe convellietuqaeb
convellietuqeab convellietuqeba convellietuaqbe convellietuaqeb convellietuabqe convellietuabeq convellietuaebq
convellietuaeqb convellietueqab convellietueqba convellietueaqb convellietueabq convellietuebaq convellietuebqa
convellietebqua convellietebqau convellietebuqa convellietebuaq convellietebauq convellietebaqu convellieteqbua
convellieteqbau convellietequba convellietequab convellieteqaub convellieteqabu convellieteuqba convellieteuqab
convellieteubqa convellieteubaq convellieteuabq convellieteuaqb convellieteaqub convellieteaqbu convellieteauqb
convellieteaubq convellieteabuq convellieteabqu convellieqatbue convellieqatbeu convellieqatube convellieqatueb
convellieqateub convellieqatebu convellieqabtue convellieqabteu convellieqabute convellieqabuet convellieqabeut
convellieqabetu convellieqaubte convellieqaubet convellieqautbe convellieqauteb convellieqauetb convellieqauebt
convellieqaebut convellieqaebtu convellieqaeubt convellieqaeutb convellieqaetub convellieqaetbu convellieqtabue
convellieqtabeu convellieqtaube convellieqtaueb convellieqtaeub convellieqtaebu convellieqtbaue convellieqtbaeu
convellieqtbuae convellieqtbuea convellieqtbeua convellieqtbeau convellieqtubae convellieqtubea convellieqtuabe
convellieqtuaeb convellieqtueab convellieqtueba convellieqtebua convellieqtebau convellieqteuba convellieqteuab
convellieqteaub convellieqteabu convellieqbtaue convellieqbtaeu convellieqbtuae convellieqbtuea convellieqbteua
convellieqbteau convellieqbatue convellieqbateu convellieqbaute convellieqbauet convellieqbaeut convellieqbaetu
convellieqbuate convellieqbuaet convellieqbutae convellieqbutea convellieqbueta convellieqbueat convellieqbeaut
convellieqbeatu convellieqbeuat convellieqbeuta convellieqbetua convellieqbetau convelliequtbae convelliequtbea
convelliequtabe convelliequtaeb convelliequteab convelliequteba convelliequbtae convelliequbtea convelliequbate
convelliequbaet convelliequbeat convelliequbeta convelliequabte convelliequabet convelliequatbe convelliequateb
convelliequaetb convelliequaebt convelliequebat convelliequebta convelliequeabt convelliequeatb convelliequetab
convelliequetba convellieqetbua convellieqetbau convellieqetuba convellieqetuab convellieqetaub convellieqetabu
convellieqebtua convellieqebtau convellieqebuta convellieqebuat convellieqebaut convellieqebatu convellieqeubta
convellieqeubat convellieqeutba convellieqeutab convellieqeuatb convellieqeuabt convellieqeabut convellieqeabtu
convellieqeaubt convellieqeautb convellieqeatub convellieqeatbu convellieuatqbe convellieuatqeb convellieuatbqe
convellieuatbeq convellieuatebq convellieuateqb convellieuaqtbe convellieuaqteb convellieuaqbte convellieuaqbet
convellieuaqebt convellieuaqetb convellieuabqte convellieuabqet convellieuabtqe convellieuabteq convellieuabetq
convellieuabeqt convellieuaeqbt convellieuaeqtb convellieuaebqt convellieuaebtq convellieuaetbq convellieuaetqb
convellieutaqbe convellieutaqeb convellieutabqe convellieutabeq convellieutaebq convellieutaeqb convellieutqabe
convellieutqaeb convellieutqbae convellieutqbea convellieutqeba convellieutqeab convellieutbqae convellieutbqea
convellieutbaqe convellieutbaeq convellieutbeaq convellieutbeqa convellieuteqba convellieuteqab convellieutebqa
convellieutebaq convellieuteabq convellieuteaqb convellieuqtabe convellieuqtaeb convellieuqtbae convellieuqtbea
convellieuqteba convellieuqteab convellieuqatbe convellieuqateb convellieuqabte convellieuqabet convellieuqaebt
convellieuqaetb convellieuqbate convellieuqbaet convellieuqbtae convellieuqbtea convellieuqbeta convellieuqbeat
convellieuqeabt convellieuqeatb convellieuqebat convellieuqebta convellieuqetba convellieuqetab convellieubtqae
convellieubtqea convellieubtaqe convellieubtaeq convellieubteaq convellieubteqa convellieubqtae convellieubqtea
convellieubqate convellieubqaet convellieubqeat convellieubqeta convellieubaqte convellieubaqet convellieubatqe
convellieubateq convellieubaetq convellieubaeqt convellieubeqat convellieubeqta convellieubeaqt convellieubeatq
convellieubetaq convellieubetqa convellieuetqba convellieuetqab convellieuetbqa convellieuetbaq convellieuetabq
convellieuetaqb convellieueqtba convellieueqtab convellieueqbta convellieueqbat convellieueqabt convellieueqatb
convellieuebqta convellieuebqat convellieuebtqa convellieuebtaq convellieuebatq convellieuebaqt convellieueaqbt
convellieueaqtb convellieueabqt convellieueabtq convellieueatbq convellieueatqb convellieeatqub convellieeatqbu
convellieeatuqb convellieeatubq convellieeatbuq convellieeatbqu convellieeaqtub convellieeaqtbu convellieeaqutb
convellieeaqubt convellieeaqbut convellieeaqbtu convellieeauqtb convellieeauqbt convellieeautqb convellieeautbq
convellieeaubtq convellieeaubqt convellieeabqut convellieeabqtu convellieeabuqt convellieeabutq convellieeabtuq
convellieeabtqu convellieetaqub convellieetaqbu convellieetauqb convellieetaubq convellieetabuq convellieetabqu
convellieetqaub convellieetqabu convellieetquab convellieetquba convellieetqbua convellieetqbau convellieetuqab
convellieetuqba convellieetuaqb convellieetuabq convellieetubaq convellieetubqa convellieetbqua convellieetbqau
convellieetbuqa convellieetbuaq convellieetbauq convellieetbaqu convellieeqtaub convellieeqtabu convellieeqtuab
convellieeqtuba convellieeqtbua convellieeqtbau convellieeqatub convellieeqatbu convellieeqautb convellieeqaubt
convellieeqabut convellieeqabtu convellieequatb convellieequabt convellieequtab convellieequtba convellieequbta
convellieequbat convellieeqbaut convellieeqbatu convellieeqbuat convellieeqbuta convellieeqbtua convellieeqbtau
convellieeutqab convellieeutqba convellieeutaqb convellieeutabq convellieeutbaq convellieeutbqa convellieeuqtab
convellieeuqtba convellieeuqatb convellieeuqabt convellieeuqbat convellieeuqbta convellieeuaqtb convellieeuaqbt
convellieeuatqb convellieeuatbq convellieeuabtq convellieeuabqt convellieeubqat convellieeubqta convellieeubaqt
convellieeubatq convellieeubtaq convellieeubtqa convellieebtqua convellieebtqau convellieebtuqa convellieebtuaq
convellieebtauq convellieebtaqu convellieebqtua convellieebqtau convellieebquta convellieebquat convellieebqaut
convellieebqatu convellieebuqta convellieebuqat convellieebutqa convellieebutaq convellieebuatq convellieebuaqt
convellieebaqut convellieebaqtu convellieebauqt convellieebautq convellieebatuq convellieebatqu convellibeatque
convellibeatqeu convellibeatuqe convellibeatueq convellibeateuq convellibeatequ convellibeaqtue convellibeaqteu
convellibeaqute convellibeaquet convellibeaqeut convellibeaqetu convellibeauqte convellibeauqet convellibeautqe
convellibeauteq convellibeauetq convellibeaueqt convellibeaequt convellibeaeqtu convellibeaeuqt convellibeaeutq
convellibeaetuq convellibeaetqu convellibetaque convellibetaqeu convellibetauqe convellibetaueq convellibetaeuq
convellibetaequ convellibetqaue convellibetqaeu convellibetquae convellibetquea convellibetqeua convellibetqeau
convellibetuqae convellibetuqea convellibetuaqe convellibetuaeq convellibetueaq convellibetueqa convellibetequa
convellibeteqau convellibeteuqa convellibeteuaq convellibeteauq convellibeteaqu convellibeqtaue convellibeqtaeu
convellibeqtuae convellibeqtuea convellibeqteua convellibeqteau convellibeqatue convellibeqateu convellibeqaute
convellibeqauet convellibeqaeut convellibeqaetu convellibequate convellibequaet convellibequtae convellibequtea
convellibequeta convellibequeat convellibeqeaut convellibeqeatu convellibeqeuat convellibeqeuta convellibeqetua
convellibeqetau convellibeutqae convellibeutqea convellibeutaqe convellibeutaeq convellibeuteaq convellibeuteqa
convellibeuqtae convellibeuqtea convellibeuqate convellibeuqaet convellibeuqeat convellibeuqeta convellibeuaqte
convellibeuaqet convellibeuatqe convellibeuateq convellibeuaetq convellibeuaeqt convellibeueqat convellibeueqta
convellibeueaqt convellibeueatq convellibeuetaq convellibeuetqa convellibeetqua convellibeetqau convellibeetuqa
convellibeetuaq convellibeetauq convellibeetaqu convellibeeqtua convellibeeqtau convellibeequta convellibeequat
convellibeeqaut convellibeeqatu convellibeeuqta convellibeeuqat convellibeeutqa convellibeeutaq convellibeeuatq
convellibeeuaqt convellibeeaqut convellibeeaqtu convellibeeauqt convellibeeautq convellibeeatuq convellibeeatqu
convellibaetque convellibaetqeu convellibaetuqe convellibaetueq convellibaeteuq convellibaetequ convellibaeqtue
convellibaeqteu convellibaequte convellibaequet convellibaeqeut convellibaeqetu convellibaeuqte convellibaeuqet
convellibaeutqe convellibaeuteq convellibaeuetq convellibaeueqt convellibaeequt convellibaeeqtu convellibaeeuqt
convellibaeeutq convellibaeetuq convellibaeetqu convellibateque convellibateqeu convellibateuqe convellibateueq
convellibateeuq convellibateequ convellibatqeue convellibatqeeu convellibatquee convellibatquee convellibatqeue
convellibatqeeu convellibatuqee convellibatuqee convellibatueqe convellibatueeq convellibatueeq convellibatueqe
convellibateque convellibateqeu convellibateuqe convellibateueq convellibateeuq convellibateequ convellibaqteue
convellibaqteeu convellibaqtuee convellibaqtuee convellibaqteue convellibaqteeu convellibaqetue convellibaqeteu
convellibaqeute convellibaqeuet convellibaqeeut convellibaqeetu convellibaquete convellibaqueet convellibaqutee
convellibaqutee convellibaquete convellibaqueet convellibaqeeut convellibaqeetu convellibaqeuet convellibaqeute
convellibaqetue convellibaqeteu convellibautqee convellibautqee convellibauteqe convellibauteeq convellibauteeq
convellibauteqe convellibauqtee convellibauqtee convellibauqete convellibauqeet convellibauqeet convellibauqete
convellibaueqte convellibaueqet convellibauetqe convellibaueteq convellibaueetq convellibaueeqt convellibaueqet
convellibaueqte convellibaueeqt convellibaueetq convellibaueteq convellibauetqe convellibaetque convellibaetqeu
convellibaetuqe convellibaetueq convellibaeteuq convellibaetequ convellibaeqtue convellibaeqteu convellibaequte
convellibaequet convellibaeqeut convellibaeqetu convellibaeuqte convellibaeuqet convellibaeutqe convellibaeuteq
convellibaeuetq convellibaeueqt convellibaeequt convellibaeeqtu convellibaeeuqt convellibaeeutq convellibaeetuq
convellibaeetqu convellibtaeque convellibtaeqeu convellibtaeuqe convellibtaeueq convellibtaeeuq convellibtaeequ
convellibtaqeue convellibtaqeeu convellibtaquee convellibtaquee convellibtaqeue convellibtaqeeu convellibtauqee
convellibtauqee convellibtaueqe convellibtaueeq convellibtaueeq convellibtaueqe convellibtaeque convellibtaeqeu
convellibtaeuqe convellibtaeueq convellibtaeeuq convellibtaeequ convellibteaque convellibteaqeu convellibteauqe
convellibteaueq convellibteaeuq convellibteaequ convellibteqaue convellibteqaeu convellibtequae convellibtequea
convellibteqeua convellibteqeau convellibteuqae convellibteuqea convellibteuaqe convellibteuaeq convellibteueaq
convellibteueqa convellibteequa convellibteeqau convellibteeuqa convellibteeuaq convellibteeauq convellibteeaqu
convellibtqeaue convellibtqeaeu convellibtqeuae convellibtqeuea convellibtqeeua convellibtqeeau convellibtqaeue
convellibtqaeeu convellibtqauee convellibtqauee convellibtqaeue convellibtqaeeu convellibtquaee convellibtquaee
convellibtqueae convellibtqueea convellibtqueea convellibtqueae convellibtqeaue convellibtqeaeu convellibtqeuae
convellibtqeuea convellibtqeeua convellibtqeeau convellibtueqae convellibtueqea convellibtueaqe convellibtueaeq
convellibtueeaq convellibtueeqa convellibtuqeae convellibtuqeea convellibtuqaee convellibtuqaee convellibtuqeae
convellibtuqeea convellibtuaqee convellibtuaqee convellibtuaeqe convellibtuaeeq convellibtuaeeq convellibtuaeqe
convellibtueqae convellibtueqea convellibtueaqe convellibtueaeq convellibtueeaq convellibtueeqa convellibteequa
convellibteeqau convellibteeuqa convellibteeuaq convellibteeauq convellibteeaqu convellibteqeua convellibteqeau
convellibtequea convellibtequae convellibteqaue convellibteqaeu convellibteuqea convellibteuqae convellibteueqa
convellibteueaq convellibteuaeq convellibteuaqe convellibteaque convellibteaqeu convellibteauqe convellibteaueq
convellibteaeuq convellibteaequ convellibqateue convellibqateeu convellibqatuee convellibqatuee convellibqateue
convellibqateeu convellibqaetue convellibqaeteu convellibqaeute convellibqaeuet convellibqaeeut convellibqaeetu
convellibqauete convellibqaueet convellibqautee convellibqautee convellibqauete convellibqaueet convellibqaeeut
convellibqaeetu convellibqaeuet convellibqaeute convellibqaetue convellibqaeteu convellibqtaeue convellibqtaeeu
convellibqtauee convellibqtauee convellibqtaeue convellibqtaeeu convellibqteaue convellibqteaeu convellibqteuae
convellibqteuea convellibqteeua convellibqteeau convellibqtueae convellibqtueea convellibqtuaee convellibqtuaee
convellibqtueae convellibqtueea convellibqteeua convellibqteeau convellibqteuea convellibqteuae convellibqteaue
convellibqteaeu convellibqetaue convellibqetaeu convellibqetuae convellibqetuea convellibqeteua convellibqeteau
convellibqeatue convellibqeateu convellibqeaute convellibqeauet convellibqeaeut convellibqeaetu convellibqeuate
convellibqeuaet convellibqeutae convellibqeutea convellibqeueta convellibqeueat convellibqeeaut convellibqeeatu
convellibqeeuat convellibqeeuta convellibqeetua convellibqeetau convellibquteae convellibquteea convellibqutaee
convellibqutaee convellibquteae convellibquteea convellibquetae convellibquetea convellibqueate convellibqueaet
convellibqueeat convellibqueeta convellibquaete convellibquaeet convellibquatee convellibquatee convellibquaete
convellibquaeet convellibqueeat convellibqueeta convellibqueaet convellibqueate convellibquetae convellibquetea
convellibqeteua convellibqeteau convellibqetuea convellibqetuae convellibqetaue convellibqetaeu convellibqeetua
convellibqeetau convellibqeeuta convellibqeeuat convellibqeeaut convellibqeeatu convellibqeueta convellibqeueat
convellibqeutea convellibqeutae convellibqeuate convellibqeuaet convellibqeaeut convellibqeaetu convellibqeauet
convellibqeaute convellibqeatue convellibqeateu convellibuatqee convellibuatqee convellibuateqe convellibuateeq
convellibuateeq convellibuateqe convellibuaqtee convellibuaqtee convellibuaqete convellibuaqeet convellibuaqeet
convellibuaqete convellibuaeqte convellibuaeqet convellibuaetqe convellibuaeteq convellibuaeetq convellibuaeeqt
convellibuaeqet convellibuaeqte convellibuaeeqt convellibuaeetq convellibuaeteq convellibuaetqe convellibutaqee
convellibutaqee convellibutaeqe convellibutaeeq convellibutaeeq convellibutaeqe convellibutqaee convellibutqaee
convellibutqeae convellibutqeea convellibutqeea convellibutqeae convellibuteqae convellibuteqea convellibuteaqe
convellibuteaeq convellibuteeaq convellibuteeqa convellibuteqea convellibuteqae convellibuteeqa convellibuteeaq
convellibuteaeq convellibuteaqe convellibuqtaee convellibuqtaee convellibuqteae convellibuqteea convellibuqteea
convellibuqteae convellibuqatee convellibuqatee convellibuqaete convellibuqaeet convellibuqaeet convellibuqaete
convellibuqeate convellibuqeaet convellibuqetae convellibuqetea convellibuqeeta convellibuqeeat convellibuqeaet
convellibuqeate convellibuqeeat convellibuqeeta convellibuqetea convellibuqetae convellibuetqae convellibuetqea
convellibuetaqe convellibuetaeq convellibueteaq convellibueteqa convellibueqtae convellibueqtea convellibueqate
convellibueqaet convellibueqeat convellibueqeta convellibueaqte convellibueaqet convellibueatqe convellibueateq
convellibueaetq convellibueaeqt convellibueeqat convellibueeqta convellibueeaqt convellibueeatq convellibueetaq
convellibueetqa convellibuetqea convellibuetqae convellibueteqa convellibueteaq convellibuetaeq convellibuetaqe
convellibueqtea convellibueqtae convellibueqeta convellibueqeat convellibueqaet convellibueqate convellibueeqta
convellibueeqat convellibueetqa convellibueetaq convellibueeatq convellibueeaqt convellibueaqet convellibueaqte
convellibueaeqt convellibueaetq convellibueateq convellibueatqe convellibeatque convellibeatqeu convellibeatuqe
convellibeatueq convellibeateuq convellibeatequ convellibeaqtue convellibeaqteu convellibeaqute convellibeaquet
convellibeaqeut convellibeaqetu convellibeauqte convellibeauqet convellibeautqe convellibeauteq convellibeauetq
convellibeaueqt convellibeaequt convellibeaeqtu convellibeaeuqt convellibeaeutq convellibeaetuq convellibeaetqu
convellibetaque convellibetaqeu convellibetauqe convellibetaueq convellibetaeuq convellibetaequ convellibetqaue
convellibetqaeu convellibetquae convellibetquea convellibetqeua convellibetqeau convellibetuqae convellibetuqea
convellibetuaqe convellibetuaeq convellibetueaq convellibetueqa convellibetequa convellibeteqau convellibeteuqa
convellibeteuaq convellibeteauq convellibeteaqu convellibeqtaue convellibeqtaeu convellibeqtuae convellibeqtuea
convellibeqteua convellibeqteau convellibeqatue convellibeqateu convellibeqaute convellibeqauet convellibeqaeut
convellibeqaetu convellibequate convellibequaet convellibequtae convellibequtea convellibequeta convellibequeat
convellibeqeaut convellibeqeatu convellibeqeuat convellibeqeuta convellibeqetua convellibeqetau convellibeutqae
convellibeutqea convellibeutaqe convellibeutaeq convellibeuteaq convellibeuteqa convellibeuqtae convellibeuqtea
convellibeuqate convellibeuqaet convellibeuqeat convellibeuqeta convellibeuaqte convellibeuaqet convellibeuatqe
convellibeuateq convellibeuaetq convellibeuaeqt convellibeueqat convellibeueqta convellibeueaqt convellibeueatq
convellibeuetaq convellibeuetqa convellibeetqua convellibeetqau convellibeetuqa convellibeetuaq convellibeetauq
convellibeetaqu convellibeeqtua convellibeeqtau convellibeequta convellibeequat convellibeeqaut convellibeeqatu
convellibeeuqta convellibeeuqat convellibeeutqa convellibeeutaq convellibeeuatq convellibeeuaqt convellibeeaqut
convellibeeaqtu convellibeeauqt convellibeeautq convellibeeatuq convellibeeatqu convelliabetque convelliabetqeu
convelliabetuqe convelliabetueq convelliabeteuq convelliabetequ convelliabeqtue convelliabeqteu convelliabequte
convelliabequet convelliabeqeut convelliabeqetu convelliabeuqte convelliabeuqet convelliabeutqe convelliabeuteq
convelliabeuetq convelliabeueqt convelliabeequt convelliabeeqtu convelliabeeuqt convelliabeeutq convelliabeetuq
convelliabeetqu convelliabteque convelliabteqeu convelliabteuqe convelliabteueq convelliabteeuq convelliabteequ
convelliabtqeue convelliabtqeeu convelliabtquee convelliabtquee convelliabtqeue convelliabtqeeu convelliabtuqee
convelliabtuqee convelliabtueqe convelliabtueeq convelliabtueeq convelliabtueqe convelliabteque convelliabteqeu
convelliabteuqe convelliabteueq convelliabteeuq convelliabteequ convelliabqteue convelliabqteeu convelliabqtuee
convelliabqtuee convelliabqteue convelliabqteeu convelliabqetue convelliabqeteu convelliabqeute convelliabqeuet
convelliabqeeut convelliabqeetu convelliabquete convelliabqueet convelliabqutee convelliabqutee convelliabquete
convelliabqueet convelliabqeeut convelliabqeetu convelliabqeuet convelliabqeute convelliabqetue convelliabqeteu
convelliabutqee convelliabutqee convelliabuteqe convelliabuteeq convelliabuteeq convelliabuteqe convelliabuqtee
convelliabuqtee convelliabuqete convelliabuqeet convelliabuqeet convelliabuqete convelliabueqte convelliabueqet
convelliabuetqe convelliabueteq convelliabueetq convelliabueeqt convelliabueqet convelliabueqte convelliabueeqt
convelliabueetq convelliabueteq convelliabuetqe convelliabetque convelliabetqeu convelliabetuqe convelliabetueq
convelliabeteuq convelliabetequ convelliabeqtue convelliabeqteu convelliabequte convelliabequet convelliabeqeut
convelliabeqetu convelliabeuqte convelliabeuqet convelliabeutqe convelliabeuteq convelliabeuetq convelliabeueqt
convelliabeequt convelliabeeqtu convelliabeeuqt convelliabeeutq convelliabeetuq convelliabeetqu convelliaebtque
convelliaebtqeu convelliaebtuqe convelliaebtueq convelliaebteuq convelliaebtequ convelliaebqtue convelliaebqteu
convelliaebqute convelliaebquet convelliaebqeut convelliaebqetu convelliaebuqte convelliaebuqet convelliaebutqe
convelliaebuteq convelliaebuetq convelliaebueqt convelliaebequt convelliaebeqtu convelliaebeuqt convelliaebeutq
convelliaebetuq convelliaebetqu convelliaetbque convelliaetbqeu convelliaetbuqe convelliaetbueq convelliaetbeuq
convelliaetbequ convelliaetqbue convelliaetqbeu convelliaetqube convelliaetqueb convelliaetqeub convelliaetqebu
convelliaetuqbe convelliaetuqeb convelliaetubqe convelliaetubeq convelliaetuebq convelliaetueqb convelliaetequb
convelliaeteqbu convelliaeteuqb convelliaeteubq convelliaetebuq convelliaetebqu convelliaeqtbue convelliaeqtbeu
convelliaeqtube convelliaeqtueb convelliaeqteub convelliaeqtebu convelliaeqbtue convelliaeqbteu convelliaeqbute
convelliaeqbuet convelliaeqbeut convelliaeqbetu convelliaequbte convelliaequbet convelliaequtbe convelliaequteb
convelliaequetb convelliaequebt convelliaeqebut convelliaeqebtu convelliaeqeubt convelliaeqeutb convelliaeqetub
convelliaeqetbu convelliaeutqbe convelliaeutqeb convelliaeutbqe convelliaeutbeq convelliaeutebq convelliaeuteqb
convelliaeuqtbe convelliaeuqteb convelliaeuqbte convelliaeuqbet convelliaeuqebt convelliaeuqetb convelliaeubqte
convelliaeubqet convelliaeubtqe convelliaeubteq convelliaeubetq convelliaeubeqt convelliaeueqbt convelliaeueqtb
convelliaeuebqt convelliaeuebtq convelliaeuetbq convelliaeuetqb convelliaeetqub convelliaeetqbu convelliaeetuqb
convelliaeetubq convelliaeetbuq convelliaeetbqu convelliaeeqtub convelliaeeqtbu convelliaeequtb convelliaeequbt
convelliaeeqbut convelliaeeqbtu convelliaeeuqtb convelliaeeuqbt convelliaeeutqb convelliaeeutbq convelliaeeubtq
convelliaeeubqt convelliaeebqut convelliaeebqtu convelliaeebuqt convelliaeebutq convelliaeebtuq convelliaeebtqu
convelliatebque convelliatebqeu convelliatebuqe convelliatebueq convelliatebeuq convelliatebequ convelliateqbue
convelliateqbeu convelliateqube convelliatequeb convelliateqeub convelliateqebu convelliateuqbe convelliateuqeb
convelliateubqe convelliateubeq convelliateuebq convelliateueqb convelliateequb convelliateeqbu convelliateeuqb
convelliateeubq convelliateebuq convelliateebqu convelliatbeque convelliatbeqeu convelliatbeuqe convelliatbeueq
convelliatbeeuq convelliatbeequ convelliatbqeue convelliatbqeeu convelliatbquee convelliatbquee convelliatbqeue
convelliatbqeeu convelliatbuqee convelliatbuqee convelliatbueqe convelliatbueeq convelliatbueeq convelliatbueqe
convelliatbeque convelliatbeqeu convelliatbeuqe convelliatbeueq convelliatbeeuq convelliatbeequ convelliatqbeue
convelliatqbeeu convelliatqbuee convelliatqbuee convelliatqbeue convelliatqbeeu convelliatqebue convelliatqebeu
convelliatqeube convelliatqeueb convelliatqeeub convelliatqeebu convelliatquebe convelliatqueeb convelliatqubee
convelliatqubee convelliatquebe convelliatqueeb convelliatqeeub convelliatqeebu convelliatqeueb convelliatqeube
convelliatqebue convelliatqebeu convelliatubqee convelliatubqee convelliatubeqe convelliatubeeq convelliatubeeq
convelliatubeqe convelliatuqbee convelliatuqbee convelliatuqebe convelliatuqeeb convelliatuqeeb convelliatuqebe
convelliatueqbe convelliatueqeb convelliatuebqe convelliatuebeq convelliatueebq convelliatueeqb convelliatueqeb
convelliatueqbe convelliatueeqb convelliatueebq convelliatuebeq convelliatuebqe convelliatebque convelliatebqeu
convelliatebuqe convelliatebueq convelliatebeuq convelliatebequ convelliateqbue convelliateqbeu convelliateqube
convelliatequeb convelliateqeub convelliateqebu convelliateuqbe convelliateuqeb convelliateubqe convelliateubeq
convelliateuebq convelliateueqb convelliateequb convelliateeqbu convelliateeuqb convelliateeubq convelliateebuq
convelliateebqu convelliaqetbue convelliaqetbeu convelliaqetube convelliaqetueb convelliaqeteub convelliaqetebu
convelliaqebtue convelliaqebteu convelliaqebute convelliaqebuet convelliaqebeut convelliaqebetu convelliaqeubte
convelliaqeubet convelliaqeutbe convelliaqeuteb convelliaqeuetb convelliaqeuebt convelliaqeebut convelliaqeebtu
convelliaqeeubt convelliaqeeutb convelliaqeetub convelliaqeetbu convelliaqtebue convelliaqtebeu convelliaqteube
convelliaqteueb convelliaqteeub convelliaqteebu convelliaqtbeue convelliaqtbeeu convelliaqtbuee convelliaqtbuee
convelliaqtbeue convelliaqtbeeu convelliaqtubee convelliaqtubee convelliaqtuebe convelliaqtueeb convelliaqtueeb
convelliaqtuebe convelliaqtebue convelliaqtebeu convelliaqteube convelliaqteueb convelliaqteeub convelliaqteebu
convelliaqbteue convelliaqbteeu convelliaqbtuee convelliaqbtuee convelliaqbteue convelliaqbteeu convelliaqbetue
convelliaqbeteu convelliaqbeute convelliaqbeuet convelliaqbeeut convelliaqbeetu convelliaqbuete convelliaqbueet
convelliaqbutee convelliaqbutee convelliaqbuete convelliaqbueet convelliaqbeeut convelliaqbeetu convelliaqbeuet
convelliaqbeute convelliaqbetue convelliaqbeteu convelliaqutbee convelliaqutbee convelliaqutebe convelliaquteeb
convelliaquteeb convelliaqutebe convelliaqubtee convelliaqubtee convelliaqubete convelliaqubeet convelliaqubeet
convelliaqubete convelliaquebte convelliaquebet convelliaquetbe convelliaqueteb convelliaqueetb convelliaqueebt
convelliaquebet convelliaquebte convelliaqueebt convelliaqueetb convelliaqueteb convelliaquetbe convelliaqetbue
convelliaqetbeu convelliaqetube convelliaqetueb convelliaqeteub convelliaqetebu convelliaqebtue convelliaqebteu
convelliaqebute convelliaqebuet convelliaqebeut convelliaqebetu convelliaqeubte convelliaqeubet convelliaqeutbe
convelliaqeuteb convelliaqeuetb convelliaqeuebt convelliaqeebut convelliaqeebtu convelliaqeeubt convelliaqeeutb
convelliaqeetub convelliaqeetbu convelliauetqbe convelliauetqeb convelliauetbqe convelliauetbeq convelliauetebq
convelliaueteqb convelliaueqtbe convelliaueqteb convelliaueqbte convelliaueqbet convelliaueqebt convelliaueqetb
convelliauebqte convelliauebqet convelliauebtqe convelliauebteq convelliauebetq convelliauebeqt convelliaueeqbt
convelliaueeqtb convelliaueebqt convelliaueebtq convelliaueetbq convelliaueetqb convelliauteqbe convelliauteqeb
convelliautebqe convelliautebeq convelliauteebq convelliauteeqb convelliautqebe convelliautqeeb convelliautqbee
convelliautqbee convelliautqebe convelliautqeeb convelliautbqee convelliautbqee convelliautbeqe convelliautbeeq
convelliautbeeq convelliautbeqe convelliauteqbe convelliauteqeb convelliautebqe convelliautebeq convelliauteebq
convelliauteeqb convelliauqtebe convelliauqteeb convelliauqtbee convelliauqtbee convelliauqtebe convelliauqteeb
convelliauqetbe convelliauqeteb convelliauqebte convelliauqebet convelliauqeebt convelliauqeetb convelliauqbete
convelliauqbeet convelliauqbtee convelliauqbtee convelliauqbete convelliauqbeet convelliauqeebt convelliauqeetb
convelliauqebet convelliauqebte convelliauqetbe convelliauqeteb convelliaubtqee convelliaubtqee convelliaubteqe
convelliaubteeq convelliaubteeq convelliaubteqe convelliaubqtee convelliaubqtee convelliaubqete convelliaubqeet
convelliaubqeet convelliaubqete convelliaubeqte convelliaubeqet convelliaubetqe convelliaubeteq convelliaubeetq
convelliaubeeqt convelliaubeqet convelliaubeqte convelliaubeeqt convelliaubeetq convelliaubeteq convelliaubetqe
convelliauetqbe convelliauetqeb convelliauetbqe convelliauetbeq convelliauetebq convelliaueteqb convelliaueqtbe
convelliaueqteb convelliaueqbte convelliaueqbet convelliaueqebt convelliaueqetb convelliauebqte convelliauebqet
convelliauebtqe convelliauebteq convelliauebetq convelliauebeqt convelliaueeqbt convelliaueeqtb convelliaueebqt
convelliaueebtq convelliaueetbq convelliaueetqb convelliaeetqub convelliaeetqbu convelliaeetuqb convelliaeetubq
convelliaeetbuq convelliaeetbqu convelliaeeqtub convelliaeeqtbu convelliaeequtb convelliaeequbt convelliaeeqbut
convelliaeeqbtu convelliaeeuqtb convelliaeeuqbt convelliaeeutqb convelliaeeutbq convelliaeeubtq convelliaeeubqt
convelliaeebqut convelliaeebqtu convelliaeebuqt convelliaeebutq convelliaeebtuq convelliaeebtqu convelliaetequb
convelliaeteqbu convelliaeteuqb convelliaeteubq convelliaetebuq convelliaetebqu convelliaetqeub convelliaetqebu
convelliaetqueb convelliaetqube convelliaetqbue convelliaetqbeu convelliaetuqeb convelliaetuqbe convelliaetueqb
convelliaetuebq convelliaetubeq convelliaetubqe convelliaetbque convelliaetbqeu convelliaetbuqe convelliaetbueq
convelliaetbeuq convelliaetbequ convelliaeqteub convelliaeqtebu convelliaeqtueb convelliaeqtube convelliaeqtbue
convelliaeqtbeu convelliaeqetub convelliaeqetbu convelliaeqeutb convelliaeqeubt convelliaeqebut convelliaeqebtu
convelliaequetb convelliaequebt convelliaequteb convelliaequtbe convelliaequbte convelliaequbet convelliaeqbeut
convelliaeqbetu convelliaeqbuet convelliaeqbute convelliaeqbtue convelliaeqbteu convelliaeutqeb convelliaeutqbe
convelliaeuteqb convelliaeutebq convelliaeutbeq convelliaeutbqe convelliaeuqteb convelliaeuqtbe convelliaeuqetb
convelliaeuqebt convelliaeuqbet convelliaeuqbte convelliaeueqtb convelliaeueqbt convelliaeuetqb convelliaeuetbq
convelliaeuebtq convelliaeuebqt convelliaeubqet convelliaeubqte convelliaeubeqt convelliaeubetq convelliaeubteq
convelliaeubtqe convelliaebtque convelliaebtqeu convelliaebtuqe convelliaebtueq convelliaebteuq convelliaebtequ
convelliaebqtue convelliaebqteu convelliaebqute convelliaebquet convelliaebqeut convelliaebqetu convelliaebuqte
convelliaebuqet convelliaebutqe convelliaebuteq convelliaebuetq convelliaebueqt convelliaebequt convelliaebeqtu
convelliaebeuqt convelliaebeutq convelliaebetuq convelliaebetqu convellitbaeque convellitbaeqeu convellitbaeuqe
convellitbaeueq convellitbaeeuq convellitbaeequ convellitbaqeue convellitbaqeeu convellitbaquee convellitbaquee
convellitbaqeue convellitbaqeeu convellitbauqee convellitbauqee convellitbaueqe convellitbaueeq convellitbaueeq
convellitbaueqe convellitbaeque convellitbaeqeu convellitbaeuqe convellitbaeueq convellitbaeeuq convellitbaeequ
convellitbeaque convellitbeaqeu convellitbeauqe convellitbeaueq convellitbeaeuq convellitbeaequ convellitbeqaue
convellitbeqaeu convellitbequae convellitbequea convellitbeqeua convellitbeqeau convellitbeuqae convellitbeuqea
convellitbeuaqe convellitbeuaeq convellitbeueaq convellitbeueqa convellitbeequa convellitbeeqau convellitbeeuqa
convellitbeeuaq convellitbeeauq convellitbeeaqu convellitbqeaue convellitbqeaeu convellitbqeuae convellitbqeuea
convellitbqeeua convellitbqeeau convellitbqaeue convellitbqaeeu convellitbqauee convellitbqauee convellitbqaeue
convellitbqaeeu convellitbquaee convellitbquaee convellitbqueae convellitbqueea convellitbqueea convellitbqueae
convellitbqeaue convellitbqeaeu convellitbqeuae convellitbqeuea convellitbqeeua convellitbqeeau convellitbueqae
convellitbueqea convellitbueaqe convellitbueaeq convellitbueeaq convellitbueeqa convellitbuqeae convellitbuqeea
convellitbuqaee convellitbuqaee convellitbuqeae convellitbuqeea convellitbuaqee convellitbuaqee convellitbuaeqe
convellitbuaeeq convellitbuaeeq convellitbuaeqe convellitbueqae convellitbueqea convellitbueaqe convellitbueaeq
convellitbueeaq convellitbueeqa convellitbeequa convellitbeeqau convellitbeeuqa convellitbeeuaq convellitbeeauq
convellitbeeaqu convellitbeqeua convellitbeqeau convellitbequea convellitbequae convellitbeqaue convellitbeqaeu
convellitbeuqea convellitbeuqae convellitbeueqa convellitbeueaq convellitbeuaeq convellitbeuaqe convellitbeaque
convellitbeaqeu convellitbeauqe convellitbeaueq convellitbeaeuq convellitbeaequ convellitabeque convellitabeqeu
convellitabeuqe convellitabeueq convellitabeeuq convellitabeequ convellitabqeue convellitabqeeu convellitabquee
convellitabquee convellitabqeue convellitabqeeu convellitabuqee convellitabuqee convellitabueqe convellitabueeq
convellitabueeq convellitabueqe convellitabeque convellitabeqeu convellitabeuqe convellitabeueq convellitabeeuq
convellitabeequ convellitaebque convellitaebqeu convellitaebuqe convellitaebueq convellitaebeuq convellitaebequ
convellitaeqbue convellitaeqbeu convellitaeqube convellitaequeb convellitaeqeub convellitaeqebu convellitaeuqbe
convellitaeuqeb convellitaeubqe convellitaeubeq convellitaeuebq convellitaeueqb convellitaeequb convellitaeeqbu
convellitaeeuqb convellitaeeubq convellitaeebuq convellitaeebqu convellitaqebue convellitaqebeu convellitaqeube
convellitaqeueb convellitaqeeub convellitaqeebu convellitaqbeue convellitaqbeeu convellitaqbuee convellitaqbuee
convellitaqbeue convellitaqbeeu convellitaqubee convellitaqubee convellitaquebe convellitaqueeb convellitaqueeb
convellitaquebe convellitaqebue convellitaqebeu convellitaqeube convellitaqeueb convellitaqeeub convellitaqeebu
convellitaueqbe convellitaueqeb convellitauebqe convellitauebeq convellitaueebq convellitaueeqb convellitauqebe
convellitauqeeb convellitauqbee convellitauqbee convellitauqebe convellitauqeeb convellitaubqee convellitaubqee
convellitaubeqe convellitaubeeq convellitaubeeq convellitaubeqe convellitaueqbe convellitaueqeb convellitauebqe
convellitauebeq convellitaueebq convellitaueeqb convellitaeequb convellitaeeqbu convellitaeeuqb convellitaeeubq
convellitaeebuq convellitaeebqu convellitaeqeub convellitaeqebu convellitaequeb convellitaeqube convellitaeqbue
convellitaeqbeu convellitaeuqeb convellitaeuqbe convellitaeueqb convellitaeuebq convellitaeubeq convellitaeubqe
convellitaebque convellitaebqeu convellitaebuqe convellitaebueq convellitaebeuq convellitaebequ convelliteabque
convelliteabqeu convelliteabuqe convelliteabueq convelliteabeuq convelliteabequ convelliteaqbue convelliteaqbeu
convelliteaqube convelliteaqueb convelliteaqeub convelliteaqebu convelliteauqbe convelliteauqeb convelliteaubqe
convelliteaubeq convelliteauebq convelliteaueqb convelliteaequb convelliteaeqbu convelliteaeuqb convelliteaeubq
convelliteaebuq convelliteaebqu convellitebaque convellitebaqeu convellitebauqe convellitebaueq convellitebaeuq
convellitebaequ convellitebqaue convellitebqaeu convellitebquae convellitebquea convellitebqeua convellitebqeau
convellitebuqae convellitebuqea convellitebuaqe convellitebuaeq convellitebueaq convellitebueqa convellitebequa
convellitebeqau convellitebeuqa convellitebeuaq convellitebeauq convellitebeaqu convelliteqbaue convelliteqbaeu
convelliteqbuae convelliteqbuea convelliteqbeua convelliteqbeau convelliteqabue convelliteqabeu convelliteqaube
convelliteqaueb convelliteqaeub convelliteqaebu convellitequabe convellitequaeb convellitequbae convellitequbea
convellitequeba convellitequeab convelliteqeaub convelliteqeabu convelliteqeuab convelliteqeuba convelliteqebua
convelliteqebau convelliteubqae convelliteubqea convelliteubaqe convelliteubaeq convelliteubeaq convelliteubeqa
convelliteuqbae convelliteuqbea convelliteuqabe convelliteuqaeb convelliteuqeab convelliteuqeba convelliteuaqbe
convelliteuaqeb convelliteuabqe convelliteuabeq convelliteuaebq convelliteuaeqb convelliteueqab convelliteueqba
convelliteueaqb convelliteueabq convelliteuebaq convelliteuebqa convelliteebqua convelliteebqau convelliteebuqa
convelliteebuaq convelliteebauq convelliteebaqu convelliteeqbua convelliteeqbau convelliteequba convelliteequab
convelliteeqaub convelliteeqabu convelliteeuqba convelliteeuqab convelliteeubqa convelliteeubaq convelliteeuabq
convelliteeuaqb convelliteeaqub convelliteeaqbu convelliteeauqb convelliteeaubq convelliteeabuq convelliteeabqu
convellitqaebue convellitqaebeu convellitqaeube convellitqaeueb convellitqaeeub convellitqaeebu convellitqabeue
convellitqabeeu convellitqabuee convellitqabuee convellitqabeue convellitqabeeu convellitqaubee convellitqaubee
convellitqauebe convellitqaueeb convellitqaueeb convellitqauebe convellitqaebue convellitqaebeu convellitqaeube
convellitqaeueb convellitqaeeub convellitqaeebu convellitqeabue convellitqeabeu convellitqeaube convellitqeaueb
convellitqeaeub convellitqeaebu convellitqebaue convellitqebaeu convellitqebuae convellitqebuea convellitqebeua
convellitqebeau convellitqeubae convellitqeubea convellitqeuabe convellitqeuaeb convellitqeueab convellitqeueba
convellitqeebua convellitqeebau convellitqeeuba convellitqeeuab convellitqeeaub convellitqeeabu convellitqbeaue
convellitqbeaeu convellitqbeuae convellitqbeuea convellitqbeeua convellitqbeeau convellitqbaeue convellitqbaeeu
convellitqbauee convellitqbauee convellitqbaeue convellitqbaeeu convellitqbuaee convellitqbuaee convellitqbueae
convellitqbueea convellitqbueea convellitqbueae convellitqbeaue convellitqbeaeu convellitqbeuae convellitqbeuea
convellitqbeeua convellitqbeeau convellitquebae convellitquebea convellitqueabe convellitqueaeb convellitqueeab
convellitqueeba convellitqubeae convellitqubeea convellitqubaee convellitqubaee convellitqubeae convellitqubeea
convellitquabee convellitquabee convellitquaebe convellitquaeeb convellitquaeeb convellitquaebe convellitquebae
convellitquebea convellitqueabe convellitqueaeb convellitqueeab convellitqueeba convellitqeebua convellitqeebau
convellitqeeuba convellitqeeuab convellitqeeaub convellitqeeabu convellitqebeua convellitqebeau convellitqebuea
convellitqebuae convellitqebaue convellitqebaeu convellitqeubea convellitqeubae convellitqeueba convellitqeueab
convellitqeuaeb convellitqeuabe convellitqeabue convellitqeabeu convellitqeaube convellitqeaueb convellitqeaeub
convellitqeaebu convellituaeqbe convellituaeqeb convellituaebqe convellituaebeq convellituaeebq convellituaeeqb
convellituaqebe convellituaqeeb convellituaqbee convellituaqbee convellituaqebe convellituaqeeb convellituabqee
convellituabqee convellituabeqe convellituabeeq convellituabeeq convellituabeqe convellituaeqbe convellituaeqeb
convellituaebqe convellituaebeq convellituaeebq convellituaeeqb convellitueaqbe convellitueaqeb convellitueabqe
convellitueabeq convellitueaebq convellitueaeqb convellitueqabe convellitueqaeb convellitueqbae convellitueqbea
convellitueqeba convellitueqeab convellituebqae convellituebqea convellituebaqe convellituebaeq convellituebeaq
convellituebeqa convellitueeqba convellitueeqab convellitueebqa convellitueebaq convellitueeabq convellitueeaqb
convellituqeabe convellituqeaeb convellituqebae convellituqebea convellituqeeba convellituqeeab convellituqaebe
convellituqaeeb convellituqabee convellituqabee convellituqaebe convellituqaeeb convellituqbaee convellituqbaee
convellituqbeae convellituqbeea convellituqbeea convellituqbeae convellituqeabe convellituqeaeb convellituqebae
convellituqebea convellituqeeba convellituqeeab convellitubeqae convellitubeqea convellitubeaqe convellitubeaeq
convellitubeeaq convellitubeeqa convellitubqeae convellitubqeea convellitubqaee convellitubqaee convellitubqeae
convellitubqeea convellitubaqee convellitubaqee convellitubaeqe convellitubaeeq convellitubaeeq convellitubaeqe
convellitubeqae convellitubeqea convellitubeaqe convellitubeaeq convellitubeeaq convellitubeeqa convellitueeqba
convellitueeqab convellitueebqa convellitueebaq convellitueeabq convellitueeaqb convellitueqeba convellitueqeab
convellitueqbea convellitueqbae convellitueqabe convellitueqaeb convellituebqea convellituebqae convellituebeqa
convellituebeaq convellituebaeq convellituebaqe convellitueaqbe convellitueaqeb convellitueabqe convellitueabeq
convellitueaebq convellitueaeqb convelliteaequb convelliteaeqbu convelliteaeuqb convelliteaeubq convelliteaebuq
convelliteaebqu convelliteaqeub convelliteaqebu convelliteaqueb convelliteaqube convelliteaqbue convelliteaqbeu
convelliteauqeb convelliteauqbe convelliteaueqb convelliteauebq convelliteaubeq convelliteaubqe convelliteabque
convelliteabqeu convelliteabuqe convelliteabueq convelliteabeuq convelliteabequ convelliteeaqub convelliteeaqbu
convelliteeauqb convelliteeaubq convelliteeabuq convelliteeabqu convelliteeqaub convelliteeqabu convelliteequab
convelliteequba convelliteeqbua convelliteeqbau convelliteeuqab convelliteeuqba convelliteeuaqb convelliteeuabq
convelliteeubaq convelliteeubqa convelliteebqua convelliteebqau convelliteebuqa convelliteebuaq convelliteebauq
convelliteebaqu convelliteqeaub convelliteqeabu convelliteqeuab convelliteqeuba convelliteqebua convelliteqebau
convelliteqaeub convelliteqaebu convelliteqaueb convelliteqaube convelliteqabue convelliteqabeu convellitequaeb
convellitequabe convellitequeab convellitequeba convellitequbea convellitequbae convelliteqbaue convelliteqbaeu
convelliteqbuae convelliteqbuea convelliteqbeua convelliteqbeau convelliteueqab convelliteueqba convelliteueaqb
convelliteueabq convelliteuebaq convelliteuebqa convelliteuqeab convelliteuqeba convelliteuqaeb convelliteuqabe
convelliteuqbae convelliteuqbea convelliteuaqeb convelliteuaqbe convelliteuaeqb convelliteuaebq convelliteuabeq
convelliteuabqe convelliteubqae convelliteubqea convelliteubaqe convelliteubaeq convelliteubeaq convelliteubeqa
convellitebequa convellitebeqau convellitebeuqa convellitebeuaq convellitebeauq convellitebeaqu convellitebqeua
convellitebqeau convellitebquea convellitebquae convellitebqaue convellitebqaeu convellitebuqea convellitebuqae
convellitebueqa convellitebueaq convellitebuaeq convellitebuaqe convellitebaque convellitebaqeu convellitebauqe
convellitebaueq convellitebaeuq convellitebaequ convelliqbateue convelliqbateeu convelliqbatuee convelliqbatuee
convelliqbateue convelliqbateeu convelliqbaetue convelliqbaeteu convelliqbaeute convelliqbaeuet convelliqbaeeut
convelliqbaeetu convelliqbauete convelliqbaueet convelliqbautee convelliqbautee convelliqbauete convelliqbaueet
convelliqbaeeut convelliqbaeetu convelliqbaeuet convelliqbaeute convelliqbaetue convelliqbaeteu convelliqbtaeue
convelliqbtaeeu convelliqbtauee convelliqbtauee convelliqbtaeue convelliqbtaeeu convelliqbteaue convelliqbteaeu
convelliqbteuae convelliqbteuea convelliqbteeua convelliqbteeau convelliqbtueae convelliqbtueea convelliqbtuaee
convelliqbtuaee convelliqbtueae convelliqbtueea convelliqbteeua convelliqbteeau convelliqbteuea convelliqbteuae
convelliqbteaue convelliqbteaeu convelliqbetaue convelliqbetaeu convelliqbetuae convelliqbetuea convelliqbeteua
convelliqbeteau convelliqbeatue convelliqbeateu convelliqbeaute convelliqbeauet convelliqbeaeut convelliqbeaetu
convelliqbeuate convelliqbeuaet convelliqbeutae convelliqbeutea convelliqbeueta convelliqbeueat convelliqbeeaut
convelliqbeeatu convelliqbeeuat convelliqbeeuta convelliqbeetua convelliqbeetau convelliqbuteae convelliqbuteea
convelliqbutaee convelliqbutaee convelliqbuteae convelliqbuteea convelliqbuetae convelliqbuetea convelliqbueate
convelliqbueaet convelliqbueeat convelliqbueeta convelliqbuaete convelliqbuaeet convelliqbuatee convelliqbuatee
convelliqbuaete convelliqbuaeet convelliqbueeat convelliqbueeta convelliqbueaet convelliqbueate convelliqbuetae
convelliqbuetea convelliqbeteua convelliqbeteau convelliqbetuea convelliqbetuae convelliqbetaue convelliqbetaeu
convelliqbeetua convelliqbeetau convelliqbeeuta convelliqbeeuat convelliqbeeaut convelliqbeeatu convelliqbeueta
convelliqbeueat convelliqbeutea convelliqbeutae convelliqbeuate convelliqbeuaet convelliqbeaeut convelliqbeaetu
convelliqbeauet convelliqbeaute convelliqbeatue convelliqbeateu convelliqabteue convelliqabteeu convelliqabtuee
convelliqabtuee convelliqabteue convelliqabteeu convelliqabetue convelliqabeteu convelliqabeute convelliqabeuet
convelliqabeeut convelliqabeetu convelliqabuete convelliqabueet convelliqabutee convelliqabutee convelliqabuete
convelliqabueet convelliqabeeut convelliqabeetu convelliqabeuet convelliqabeute convelliqabetue convelliqabeteu
convelliqatbeue convelliqatbeeu convelliqatbuee convelliqatbuee convelliqatbeue convelliqatbeeu convelliqatebue
convelliqatebeu convelliqateube convelliqateueb convelliqateeub convelliqateebu convelliqatuebe convelliqatueeb
convelliqatubee convelliqatubee convelliqatuebe convelliqatueeb convelliqateeub convelliqateebu convelliqateueb
convelliqateube convelliqatebue convelliqatebeu convelliqaetbue convelliqaetbeu convelliqaetube convelliqaetueb
convelliqaeteub convelliqaetebu convelliqaebtue convelliqaebteu convelliqaebute convelliqaebuet convelliqaebeut
convelliqaebetu convelliqaeubte convelliqaeubet convelliqaeutbe convelliqaeuteb convelliqaeuetb convelliqaeuebt
convelliqaeebut convelliqaeebtu convelliqaeeubt convelliqaeeutb convelliqaeetub convelliqaeetbu convelliqautebe
convelliqauteeb convelliqautbee convelliqautbee convelliqautebe convelliqauteeb convelliqauetbe convelliqaueteb
convelliqauebte convelliqauebet convelliqaueebt convelliqaueetb convelliqaubete convelliqaubeet convelliqaubtee
convelliqaubtee convelliqaubete convelliqaubeet convelliqaueebt convelliqaueetb convelliqauebet convelliqauebte
convelliqauetbe convelliqaueteb convelliqaeteub convelliqaetebu convelliqaetueb convelliqaetube convelliqaetbue
convelliqaetbeu convelliqaeetub convelliqaeetbu convelliqaeeutb convelliqaeeubt convelliqaeebut convelliqaeebtu
convelliqaeuetb convelliqaeuebt convelliqaeuteb convelliqaeutbe convelliqaeubte convelliqaeubet convelliqaebeut
convelliqaebetu convelliqaebuet convelliqaebute convelliqaebtue convelliqaebteu convelliqtabeue convelliqtabeeu
convelliqtabuee convelliqtabuee convelliqtabeue convelliqtabeeu convelliqtaebue convelliqtaebeu convelliqtaeube
convelliqtaeueb convelliqtaeeub convelliqtaeebu convelliqtauebe convelliqtaueeb convelliqtaubee convelliqtaubee
convelliqtauebe convelliqtaueeb convelliqtaeeub convelliqtaeebu convelliqtaeueb convelliqtaeube convelliqtaebue
convelliqtaebeu convelliqtbaeue convelliqtbaeeu convelliqtbauee convelliqtbauee convelliqtbaeue convelliqtbaeeu
convelliqtbeaue convelliqtbeaeu convelliqtbeuae convelliqtbeuea convelliqtbeeua convelliqtbeeau convelliqtbueae
convelliqtbueea convelliqtbuaee convelliqtbuaee convelliqtbueae convelliqtbueea convelliqtbeeua convelliqtbeeau
convelliqtbeuea convelliqtbeuae convelliqtbeaue convelliqtbeaeu convelliqtebaue convelliqtebaeu convelliqtebuae
convelliqtebuea convelliqtebeua convelliqtebeau convelliqteabue convelliqteabeu convelliqteaube convelliqteaueb
convelliqteaeub convelliqteaebu convelliqteuabe convelliqteuaeb convelliqteubae convelliqteubea convelliqteueba
convelliqteueab convelliqteeaub convelliqteeabu convelliqteeuab convelliqteeuba convelliqteebua convelliqteebau
convelliqtubeae convelliqtubeea convelliqtubaee convelliqtubaee convelliqtubeae convelliqtubeea convelliqtuebae
convelliqtuebea convelliqtueabe convelliqtueaeb convelliqtueeab convelliqtueeba convelliqtuaebe convelliqtuaeeb
convelliqtuabee convelliqtuabee convelliqtuaebe convelliqtuaeeb convelliqtueeab convelliqtueeba convelliqtueaeb
convelliqtueabe convelliqtuebae convelliqtuebea convelliqtebeua convelliqtebeau convelliqtebuea convelliqtebuae
convelliqtebaue convelliqtebaeu convelliqteebua convelliqteebau convelliqteeuba convelliqteeuab convelliqteeaub
convelliqteeabu convelliqteueba convelliqteueab convelliqteubea convelliqteubae convelliqteuabe convelliqteuaeb
convelliqteaeub convelliqteaebu convelliqteaueb convelliqteaube convelliqteabue convelliqteabeu convelliqeatbue
convelliqeatbeu convelliqeatube convelliqeatueb convelliqeateub convelliqeatebu convelliqeabtue convelliqeabteu
convelliqeabute convelliqeabuet convelliqeabeut convelliqeabetu convelliqeaubte convelliqeaubet convelliqeautbe
convelliqeauteb convelliqeauetb convelliqeauebt convelliqeaebut convelliqeaebtu convelliqeaeubt convelliqeaeutb
convelliqeaetub convelliqeaetbu convelliqetabue convelliqetabeu convelliqetaube convelliqetaueb convelliqetaeub
convelliqetaebu convelliqetbaue convelliqetbaeu convelliqetbuae convelliqetbuea convelliqetbeua convelliqetbeau
convelliqetubae convelliqetubea convelliqetuabe convelliqetuaeb convelliqetueab convelliqetueba convelliqetebua
convelliqetebau convelliqeteuba convelliqeteuab convelliqeteaub convelliqeteabu convelliqebtaue convelliqebtaeu
convelliqebtuae convelliqebtuea convelliqebteua convelliqebteau convelliqebatue convelliqebateu convelliqebaute
convelliqebauet convelliqebaeut convelliqebaetu convelliqebuate convelliqebuaet convelliqebutae convelliqebutea
convelliqebueta convelliqebueat convelliqebeaut convelliqebeatu convelliqebeuat convelliqebeuta convelliqebetua
convelliqebetau convelliqeutbae convelliqeutbea convelliqeutabe convelliqeutaeb convelliqeuteab convelliqeuteba
convelliqeubtae convelliqeubtea convelliqeubate convelliqeubaet convelliqeubeat convelliqeubeta convelliqeuabte
convelliqeuabet convelliqeuatbe convelliqeuateb convelliqeuaetb convelliqeuaebt convelliqeuebat convelliqeuebta
convelliqeueabt convelliqeueatb convelliqeuetab convelliqeuetba convelliqeetbua convelliqeetbau convelliqeetuba
convelliqeetuab convelliqeetaub convelliqeetabu convelliqeebtua convelliqeebtau convelliqeebuta convelliqeebuat
convelliqeebaut convelliqeebatu convelliqeeubta convelliqeeubat convelliqeeutba convelliqeeutab convelliqeeuatb
convelliqeeuabt convelliqeeabut convelliqeeabtu convelliqeeaubt convelliqeeautb convelliqeeatub convelliqeeatbu
convelliquatebe convelliquateeb convelliquatbee convelliquatbee convelliquatebe convelliquateeb convelliquaetbe
convelliquaeteb convelliquaebte convelliquaebet convelliquaeebt convelliquaeetb convelliquabete convelliquabeet
convelliquabtee convelliquabtee convelliquabete convelliquabeet convelliquaeebt convelliquaeetb convelliquaebet
convelliquaebte convelliquaetbe convelliquaeteb convelliqutaebe convelliqutaeeb convelliqutabee convelliqutabee
convelliqutaebe convelliqutaeeb convelliquteabe convelliquteaeb convelliqutebae convelliqutebea convelliquteeba
convelliquteeab convelliqutbeae convelliqutbeea convelliqutbaee convelliqutbaee convelliqutbeae convelliqutbeea
convelliquteeba convelliquteeab convelliqutebea convelliqutebae convelliquteabe convelliquteaeb convelliquetabe
convelliquetaeb convelliquetbae convelliquetbea convelliqueteba convelliqueteab convelliqueatbe convelliqueateb
convelliqueabte convelliqueabet convelliqueaebt convelliqueaetb convelliquebate convelliquebaet convelliquebtae
convelliquebtea convelliquebeta convelliquebeat convelliqueeabt convelliqueeatb convelliqueebat convelliqueebta
convelliqueetba convelliqueetab convelliqubteae convelliqubteea convelliqubtaee convelliqubtaee convelliqubteae
convelliqubteea convelliqubetae convelliqubetea convelliqubeate convelliqubeaet convelliqubeeat convelliqubeeta
convelliqubaete convelliqubaeet convelliqubatee convelliqubatee convelliqubaete convelliqubaeet convelliqubeeat
convelliqubeeta convelliqubeaet convelliqubeate convelliqubetae convelliqubetea convelliqueteba convelliqueteab
convelliquetbea convelliquetbae convelliquetabe convelliquetaeb convelliqueetba convelliqueetab convelliqueebta
convelliqueebat convelliqueeabt convelliqueeatb convelliquebeta convelliquebeat convelliquebtea convelliquebtae
convelliquebate convelliquebaet convelliqueaebt convelliqueaetb convelliqueabet convelliqueabte convelliqueatbe
convelliqueateb convelliqeateub convelliqeatebu convelliqeatueb convelliqeatube convelliqeatbue convelliqeatbeu
convelliqeaetub convelliqeaetbu convelliqeaeutb convelliqeaeubt convelliqeaebut convelliqeaebtu convelliqeauetb
convelliqeauebt convelliqeauteb convelliqeautbe convelliqeaubte convelliqeaubet convelliqeabeut convelliqeabetu
convelliqeabuet convelliqeabute convelliqeabtue convelliqeabteu convelliqetaeub convelliqetaebu convelliqetaueb
convelliqetaube convelliqetabue convelliqetabeu convelliqeteaub convelliqeteabu convelliqeteuab convelliqeteuba
convelliqetebua convelliqetebau convelliqetueab convelliqetueba convelliqetuaeb convelliqetuabe convelliqetubae
convelliqetubea convelliqetbeua convelliqetbeau convelliqetbuea convelliqetbuae convelliqetbaue convelliqetbaeu
convelliqeetaub convelliqeetabu convelliqeetuab convelliqeetuba convelliqeetbua convelliqeetbau convelliqeeatub
convelliqeeatbu convelliqeeautb convelliqeeaubt convelliqeeabut convelliqeeabtu convelliqeeuatb convelliqeeuabt
convelliqeeutab convelliqeeutba convelliqeeubta convelliqeeubat convelliqeebaut convelliqeebatu convelliqeebuat
convelliqeebuta convelliqeebtua convelliqeebtau convelliqeuteab convelliqeuteba convelliqeutaeb convelliqeutabe
convelliqeutbae convelliqeutbea convelliqeuetab convelliqeuetba convelliqeueatb convelliqeueabt convelliqeuebat
convelliqeuebta convelliqeuaetb convelliqeuaebt convelliqeuateb convelliqeuatbe convelliqeuabte convelliqeuabet
convelliqeubeat convelliqeubeta convelliqeubaet convelliqeubate convelliqeubtae convelliqeubtea convelliqebteua
convelliqebteau convelliqebtuea convelliqebtuae convelliqebtaue convelliqebtaeu convelliqebetua convelliqebetau
convelliqebeuta convelliqebeuat convelliqebeaut convelliqebeatu convelliqebueta convelliqebueat convelliqebutea
convelliqebutae convelliqebuate convelliqebuaet convelliqebaeut convelliqebaetu convelliqebauet convelliqebaute
convelliqebatue convelliqebateu convelliubatqee convelliubatqee convelliubateqe convelliubateeq convelliubateeq
convelliubateqe convelliubaqtee convelliubaqtee convelliubaqete convelliubaqeet convelliubaqeet convelliubaqete
convelliubaeqte convelliubaeqet convelliubaetqe convelliubaeteq convelliubaeetq convelliubaeeqt convelliubaeqet
convelliubaeqte convelliubaeeqt convelliubaeetq convelliubaeteq convelliubaetqe convelliubtaqee convelliubtaqee
convelliubtaeqe convelliubtaeeq convelliubtaeeq convelliubtaeqe convelliubtqaee convelliubtqaee convelliubtqeae
convelliubtqeea convelliubtqeea convelliubtqeae convelliubteqae convelliubteqea convelliubteaqe convelliubteaeq
convelliubteeaq convelliubteeqa convelliubteqea convelliubteqae convelliubteeqa convelliubteeaq convelliubteaeq
convelliubteaqe convelliubqtaee convelliubqtaee convelliubqteae convelliubqteea convelliubqteea convelliubqteae
convelliubqatee convelliubqatee convelliubqaete convelliubqaeet convelliubqaeet convelliubqaete convelliubqeate
convelliubqeaet convelliubqetae convelliubqetea convelliubqeeta convelliubqeeat convelliubqeaet convelliubqeate
convelliubqeeat convelliubqeeta convelliubqetea convelliubqetae convelliubetqae convelliubetqea convelliubetaqe
convelliubetaeq convelliubeteaq convelliubeteqa convelliubeqtae convelliubeqtea convelliubeqate convelliubeqaet
convelliubeqeat convelliubeqeta convelliubeaqte convelliubeaqet convelliubeatqe convelliubeateq convelliubeaetq
convelliubeaeqt convelliubeeqat convelliubeeqta convelliubeeaqt convelliubeeatq convelliubeetaq convelliubeetqa
convelliubetqea convelliubetqae convelliubeteqa convelliubeteaq convelliubetaeq convelliubetaqe convelliubeqtea
convelliubeqtae convelliubeqeta convelliubeqeat convelliubeqaet convelliubeqate convelliubeeqta convelliubeeqat
convelliubeetqa convelliubeetaq convelliubeeatq convelliubeeaqt convelliubeaqet convelliubeaqte convelliubeaeqt
convelliubeaetq convelliubeateq convelliubeatqe convelliuabtqee convelliuabtqee convelliuabteqe convelliuabteeq
convelliuabteeq convelliuabteqe convelliuabqtee convelliuabqtee convelliuabqete convelliuabqeet convelliuabqeet
convelliuabqete convelliuabeqte convelliuabeqet convelliuabetqe convelliuabeteq convelliuabeetq convelliuabeeqt
convelliuabeqet convelliuabeqte convelliuabeeqt convelliuabeetq convelliuabeteq convelliuabetqe convelliuatbqee
convelliuatbqee convelliuatbeqe convelliuatbeeq convelliuatbeeq convelliuatbeqe convelliuatqbee convelliuatqbee
convelliuatqebe convelliuatqeeb convelliuatqeeb convelliuatqebe convelliuateqbe convelliuateqeb convelliuatebqe
convelliuatebeq convelliuateebq convelliuateeqb convelliuateqeb convelliuateqbe convelliuateeqb convelliuateebq
convelliuatebeq convelliuatebqe convelliuaqtbee convelliuaqtbee convelliuaqtebe convelliuaqteeb convelliuaqteeb
convelliuaqtebe convelliuaqbtee convelliuaqbtee convelliuaqbete convelliuaqbeet convelliuaqbeet convelliuaqbete
convelliuaqebte convelliuaqebet convelliuaqetbe convelliuaqeteb convelliuaqeetb convelliuaqeebt convelliuaqebet
convelliuaqebte convelliuaqeebt convelliuaqeetb convelliuaqeteb convelliuaqetbe convelliuaetqbe convelliuaetqeb
convelliuaetbqe convelliuaetbeq convelliuaetebq convelliuaeteqb convelliuaeqtbe convelliuaeqteb convelliuaeqbte
convelliuaeqbet convelliuaeqebt convelliuaeqetb convelliuaebqte convelliuaebqet convelliuaebtqe convelliuaebteq
convelliuaebetq convelliuaebeqt convelliuaeeqbt convelliuaeeqtb convelliuaeebqt convelliuaeebtq convelliuaeetbq
convelliuaeetqb convelliuaetqeb convelliuaetqbe convelliuaeteqb convelliuaetebq convelliuaetbeq convelliuaetbqe
convelliuaeqteb convelliuaeqtbe convelliuaeqetb convelliuaeqebt convelliuaeqbet convelliuaeqbte convelliuaeeqtb
convelliuaeeqbt convelliuaeetqb convelliuaeetbq convelliuaeebtq convelliuaeebqt convelliuaebqet convelliuaebqte
convelliuaebeqt convelliuaebetq convelliuaebteq convelliuaebtqe convelliutabqee convelliutabqee convelliutabeqe
convelliutabeeq convelliutabeeq convelliutabeqe convelliutaqbee convelliutaqbee convelliutaqebe convelliutaqeeb
convelliutaqeeb convelliutaqebe convelliutaeqbe convelliutaeqeb convelliutaebqe convelliutaebeq convelliutaeebq
convelliutaeeqb convelliutaeqeb convelliutaeqbe convelliutaeeqb convelliutaeebq convelliutaebeq convelliutaebqe
convelliutbaqee convelliutbaqee convelliutbaeqe convelliutbaeeq convelliutbaeeq convelliutbaeqe convelliutbqaee
convelliutbqaee convelliutbqeae convelliutbqeea convelliutbqeea convelliutbqeae convelliutbeqae convelliutbeqea
convelliutbeaqe convelliutbeaeq convelliutbeeaq convelliutbeeqa convelliutbeqea convelliutbeqae convelliutbeeqa
convelliutbeeaq convelliutbeaeq convelliutbeaqe convelliutqbaee convelliutqbaee convelliutqbeae convelliutqbeea
convelliutqbeea convelliutqbeae convelliutqabee convelliutqabee convelliutqaebe convelliutqaeeb convelliutqaeeb
convelliutqaebe convelliutqeabe convelliutqeaeb convelliutqebae convelliutqebea convelliutqeeba convelliutqeeab
convelliutqeaeb convelliutqeabe convelliutqeeab convelliutqeeba convelliutqebea convelliutqebae convelliutebqae
convelliutebqea convelliutebaqe convelliutebaeq convelliutebeaq convelliutebeqa convelliuteqbae convelliuteqbea
convelliuteqabe convelliuteqaeb convelliuteqeab convelliuteqeba convelliuteaqbe convelliuteaqeb convelliuteabqe
convelliuteabeq convelliuteaebq convelliuteaeqb convelliuteeqab convelliuteeqba convelliuteeaqb convelliuteeabq
convelliuteebaq convelliuteebqa convelliutebqea convelliutebqae convelliutebeqa convelliutebeaq convelliutebaeq
convelliutebaqe convelliuteqbea convelliuteqbae convelliuteqeba convelliuteqeab convelliuteqaeb convelliuteqabe
convelliuteeqba convelliuteeqab convelliuteebqa convelliuteebaq convelliuteeabq convelliuteeaqb convelliuteaqeb
convelliuteaqbe convelliuteaeqb convelliuteaebq convelliuteabeq convelliuteabqe convelliuqatbee convelliuqatbee
convelliuqatebe convelliuqateeb convelliuqateeb convelliuqatebe convelliuqabtee convelliuqabtee convelliuqabete
convelliuqabeet convelliuqabeet convelliuqabete convelliuqaebte convelliuqaebet convelliuqaetbe convelliuqaeteb
convelliuqaeetb convelliuqaeebt convelliuqaebet convelliuqaebte convelliuqaeebt convelliuqaeetb convelliuqaeteb
convelliuqaetbe convelliuqtabee convelliuqtabee convelliuqtaebe convelliuqtaeeb convelliuqtaeeb convelliuqtaebe
convelliuqtbaee convelliuqtbaee convelliuqtbeae convelliuqtbeea convelliuqtbeea convelliuqtbeae convelliuqtebae
convelliuqtebea convelliuqteabe convelliuqteaeb convelliuqteeab convelliuqteeba convelliuqtebea convelliuqtebae
convelliuqteeba convelliuqteeab convelliuqteaeb convelliuqteabe convelliuqbtaee convelliuqbtaee convelliuqbteae
convelliuqbteea convelliuqbteea convelliuqbteae convelliuqbatee convelliuqbatee convelliuqbaete convelliuqbaeet
convelliuqbaeet convelliuqbaete convelliuqbeate convelliuqbeaet convelliuqbetae convelliuqbetea convelliuqbeeta
convelliuqbeeat convelliuqbeaet convelliuqbeate convelliuqbeeat convelliuqbeeta convelliuqbetea convelliuqbetae
convelliuqetbae convelliuqetbea convelliuqetabe convelliuqetaeb convelliuqeteab convelliuqeteba convelliuqebtae
convelliuqebtea convelliuqebate convelliuqebaet convelliuqebeat convelliuqebeta convelliuqeabte convelliuqeabet
convelliuqeatbe convelliuqeateb convelliuqeaetb convelliuqeaebt convelliuqeebat convelliuqeebta convelliuqeeabt
convelliuqeeatb convelliuqeetab convelliuqeetba convelliuqetbea convelliuqetbae convelliuqeteba convelliuqeteab
convelliuqetaeb convelliuqetabe convelliuqebtea convelliuqebtae convelliuqebeta convelliuqebeat convelliuqebaet
convelliuqebate convelliuqeebta convelliuqeebat convelliuqeetba convelliuqeetab convelliuqeeatb convelliuqeeabt
convelliuqeabet convelliuqeabte convelliuqeaebt convelliuqeaetb convelliuqeateb convelliuqeatbe convelliueatqbe
convelliueatqeb convelliueatbqe convelliueatbeq convelliueatebq convelliueateqb convelliueaqtbe convelliueaqteb
convelliueaqbte convelliueaqbet convelliueaqebt convelliueaqetb convelliueabqte convelliueabqet convelliueabtqe
convelliueabteq convelliueabetq convelliueabeqt convelliueaeqbt convelliueaeqtb convelliueaebqt convelliueaebtq
convelliueaetbq convelliueaetqb convelliuetaqbe convelliuetaqeb convelliuetabqe convelliuetabeq convelliuetaebq
convelliuetaeqb convelliuetqabe convelliuetqaeb convelliuetqbae convelliuetqbea convelliuetqeba convelliuetqeab
convelliuetbqae convelliuetbqea convelliuetbaqe convelliuetbaeq convelliuetbeaq convelliuetbeqa convelliueteqba
convelliueteqab convelliuetebqa convelliuetebaq convelliueteabq convelliueteaqb convelliueqtabe convelliueqtaeb
convelliueqtbae convelliueqtbea convelliueqteba convelliueqteab convelliueqatbe convelliueqateb convelliueqabte
convelliueqabet convelliueqaebt convelliueqaetb convelliueqbate convelliueqbaet convelliueqbtae convelliueqbtea
convelliueqbeta convelliueqbeat convelliueqeabt convelliueqeatb convelliueqebat convelliueqebta convelliueqetba
convelliueqetab convelliuebtqae convelliuebtqea convelliuebtaqe convelliuebtaeq convelliuebteaq convelliuebteqa
convelliuebqtae convelliuebqtea convelliuebqate convelliuebqaet convelliuebqeat convelliuebqeta convelliuebaqte
convelliuebaqet convelliuebatqe convelliuebateq convelliuebaetq convelliuebaeqt convelliuebeqat convelliuebeqta
convelliuebeaqt convelliuebeatq convelliuebetaq convelliuebetqa convelliueetqba convelliueetqab convelliueetbqa
convelliueetbaq convelliueetabq convelliueetaqb convelliueeqtba convelliueeqtab convelliueeqbta convelliueeqbat
convelliueeqabt convelliueeqatb convelliueebqta convelliueebqat convelliueebtqa convelliueebtaq convelliueebatq
convelliueebaqt convelliueeaqbt convelliueeaqtb convelliueeabqt convelliueeabtq convelliueeatbq convelliueeatqb
convelliueatqeb convelliueatqbe convelliueateqb convelliueatebq convelliueatbeq convelliueatbqe convelliueaqteb
convelliueaqtbe convelliueaqetb convelliueaqebt convelliueaqbet convelliueaqbte convelliueaeqtb convelliueaeqbt
convelliueaetqb convelliueaetbq convelliueaebtq convelliueaebqt convelliueabqet convelliueabqte convelliueabeqt
convelliueabetq convelliueabteq convelliueabtqe convelliuetaqeb convelliuetaqbe convelliuetaeqb convelliuetaebq
convelliuetabeq convelliuetabqe convelliuetqaeb convelliuetqabe convelliuetqeab convelliuetqeba convelliuetqbea
convelliuetqbae convelliueteqab convelliueteqba convelliueteaqb convelliueteabq convelliuetebaq convelliuetebqa
convelliuetbqea convelliuetbqae convelliuetbeqa convelliuetbeaq convelliuetbaeq convelliuetbaqe convelliueqtaeb
convelliueqtabe convelliueqteab convelliueqteba convelliueqtbea convelliueqtbae convelliueqateb convelliueqatbe
convelliueqaetb convelliueqaebt convelliueqabet convelliueqabte convelliueqeatb convelliueqeabt convelliueqetab
convelliueqetba convelliueqebta convelliueqebat convelliueqbaet convelliueqbate convelliueqbeat convelliueqbeta
convelliueqbtea convelliueqbtae convelliueetqab convelliueetqba convelliueetaqb convelliueetabq convelliueetbaq
convelliueetbqa convelliueeqtab convelliueeqtba convelliueeqatb convelliueeqabt convelliueeqbat convelliueeqbta
convelliueeaqtb convelliueeaqbt convelliueeatqb convelliueeatbq convelliueeabtq convelliueeabqt convelliueebqat
convelliueebqta convelliueebaqt convelliueebatq convelliueebtaq convelliueebtqa convelliuebtqea convelliuebtqae
convelliuebteqa convelliuebteaq convelliuebtaeq convelliuebtaqe convelliuebqtea convelliuebqtae convelliuebqeta
convelliuebqeat convelliuebqaet convelliuebqate convelliuebeqta convelliuebeqat convelliuebetqa convelliuebetaq
convelliuebeatq convelliuebeaqt convelliuebaqet convelliuebaqte convelliuebaeqt convelliuebaetq convelliuebateq
convelliuebatqe convelliebatque convelliebatqeu convelliebatuqe convelliebatueq convelliebateuq convelliebatequ
convelliebaqtue convelliebaqteu convelliebaqute convelliebaquet convelliebaqeut convelliebaqetu convelliebauqte
convelliebauqet convelliebautqe convelliebauteq convelliebauetq convelliebaueqt convelliebaequt convelliebaeqtu
convelliebaeuqt convelliebaeutq convelliebaetuq convelliebaetqu convelliebtaque convelliebtaqeu convelliebtauqe
convelliebtaueq convelliebtaeuq convelliebtaequ convelliebtqaue convelliebtqaeu convelliebtquae convelliebtquea
convelliebtqeua convelliebtqeau convelliebtuqae convelliebtuqea convelliebtuaqe convelliebtuaeq convelliebtueaq
convelliebtueqa convelliebtequa convelliebteqau convelliebteuqa convelliebteuaq convelliebteauq convelliebteaqu
convelliebqtaue convelliebqtaeu convelliebqtuae convelliebqtuea convelliebqteua convelliebqteau convelliebqatue
convelliebqateu convelliebqaute convelliebqauet convelliebqaeut convelliebqaetu convelliebquate convelliebquaet
convelliebqutae convelliebqutea convelliebqueta convelliebqueat convelliebqeaut convelliebqeatu convelliebqeuat
convelliebqeuta convelliebqetua convelliebqetau convelliebutqae convelliebutqea convelliebutaqe convelliebutaeq
convelliebuteaq convelliebuteqa convelliebuqtae convelliebuqtea convelliebuqate convelliebuqaet convelliebuqeat
convelliebuqeta convelliebuaqte convelliebuaqet convelliebuatqe convelliebuateq convelliebuaetq convelliebuaeqt
convelliebueqat convelliebueqta convelliebueaqt convelliebueatq convelliebuetaq convelliebuetqa convelliebetqua
convelliebetqau convelliebetuqa convelliebetuaq convelliebetauq convelliebetaqu convelliebeqtua convelliebeqtau
convelliebequta convelliebequat convelliebeqaut convelliebeqatu convelliebeuqta convelliebeuqat convelliebeutqa
convelliebeutaq convelliebeuatq convelliebeuaqt convelliebeaqut convelliebeaqtu convelliebeauqt convelliebeautq
convelliebeatuq convelliebeatqu convellieabtque convellieabtqeu convellieabtuqe convellieabtueq convellieabteuq
convellieabtequ convellieabqtue convellieabqteu convellieabqute convellieabquet convellieabqeut convellieabqetu
convellieabuqte convellieabuqet convellieabutqe convellieabuteq convellieabuetq convellieabueqt convellieabequt
convellieabeqtu convellieabeuqt convellieabeutq convellieabetuq convellieabetqu convellieatbque convellieatbqeu
convellieatbuqe convellieatbueq convellieatbeuq convellieatbequ convellieatqbue convellieatqbeu convellieatqube
convellieatqueb convellieatqeub convellieatqebu convellieatuqbe convellieatuqeb convellieatubqe convellieatubeq
convellieatuebq convellieatueqb convellieatequb convellieateqbu convellieateuqb convellieateubq convellieatebuq
convellieatebqu convellieaqtbue convellieaqtbeu convellieaqtube convellieaqtueb convellieaqteub convellieaqtebu
convellieaqbtue convellieaqbteu convellieaqbute convellieaqbuet convellieaqbeut convellieaqbetu convellieaqubte
convellieaqubet convellieaqutbe convellieaquteb convellieaquetb convellieaquebt convellieaqebut convellieaqebtu
convellieaqeubt convellieaqeutb convellieaqetub convellieaqetbu convellieautqbe convellieautqeb convellieautbqe
convellieautbeq convellieautebq convellieauteqb convellieauqtbe convellieauqteb convellieauqbte convellieauqbet
convellieauqebt convellieauqetb convellieaubqte convellieaubqet convellieaubtqe convellieaubteq convellieaubetq
convellieaubeqt convellieaueqbt convellieaueqtb convellieauebqt convellieauebtq convellieauetbq convellieauetqb
convellieaetqub convellieaetqbu convellieaetuqb convellieaetubq convellieaetbuq convellieaetbqu convellieaeqtub
convellieaeqtbu convellieaequtb convellieaequbt convellieaeqbut convellieaeqbtu convellieaeuqtb convellieaeuqbt
convellieaeutqb convellieaeutbq convellieaeubtq convellieaeubqt convellieaebqut convellieaebqtu convellieaebuqt
convellieaebutq convellieaebtuq convellieaebtqu convellietabque convellietabqeu convellietabuqe convellietabueq
convellietabeuq convellietabequ convellietaqbue convellietaqbeu convellietaqube convellietaqueb convellietaqeub
convellietaqebu convellietauqbe convellietauqeb convellietaubqe convellietaubeq convellietauebq convellietaueqb
convellietaequb convellietaeqbu convellietaeuqb convellietaeubq convellietaebuq convellietaebqu convellietbaque
convellietbaqeu convellietbauqe convellietbaueq convellietbaeuq convellietbaequ convellietbqaue convellietbqaeu
convellietbquae convellietbquea convellietbqeua convellietbqeau convellietbuqae convellietbuqea convellietbuaqe
convellietbuaeq convellietbueaq convellietbueqa convellietbequa convellietbeqau convellietbeuqa convellietbeuaq
convellietbeauq convellietbeaqu convellietqbaue convellietqbaeu convellietqbuae convellietqbuea convellietqbeua
convellietqbeau convellietqabue convellietqabeu convellietqaube convellietqaueb convellietqaeub convellietqaebu
convellietquabe convellietquaeb convellietqubae convellietqubea convellietqueba convellietqueab convellietqeaub
convellietqeabu convellietqeuab convellietqeuba convellietqebua convellietqebau convellietubqae convellietubqea
convellietubaqe convellietubaeq convellietubeaq convellietubeqa convellietuqbae convellietuqbea convellietuqabe
convellietuqaeb convellietuqeab convellietuqeba convellietuaqbe convellietuaqeb convellietuabqe convellietuabeq
convellietuaebq convellietuaeqb convellietueqab convellietueqba convellietueaqb convellietueabq convellietuebaq
convellietuebqa convellietebqua convellietebqau convellietebuqa convellietebuaq convellietebauq convellietebaqu
convellieteqbua convellieteqbau convellietequba convellietequab convellieteqaub convellieteqabu convellieteuqba
convellieteuqab convellieteubqa convellieteubaq convellieteuabq convellieteuaqb convellieteaqub convellieteaqbu
convellieteauqb convellieteaubq convellieteabuq convellieteabqu convellieqatbue convellieqatbeu convellieqatube
convellieqatueb convellieqateub convellieqatebu convellieqabtue convellieqabteu convellieqabute convellieqabuet
convellieqabeut convellieqabetu convellieqaubte convellieqaubet convellieqautbe convellieqauteb convellieqauetb
convellieqauebt convellieqaebut convellieqaebtu convellieqaeubt convellieqaeutb convellieqaetub convellieqaetbu
convellieqtabue convellieqtabeu convellieqtaube convellieqtaueb convellieqtaeub convellieqtaebu convellieqtbaue
convellieqtbaeu convellieqtbuae convellieqtbuea convellieqtbeua convellieqtbeau convellieqtubae convellieqtubea
convellieqtuabe convellieqtuaeb convellieqtueab convellieqtueba convellieqtebua convellieqtebau convellieqteuba
convellieqteuab convellieqteaub convellieqteabu convellieqbtaue convellieqbtaeu convellieqbtuae convellieqbtuea
convellieqbteua convellieqbteau convellieqbatue convellieqbateu convellieqbaute convellieqbauet convellieqbaeut
convellieqbaetu convellieqbuate convellieqbuaet convellieqbutae convellieqbutea convellieqbueta convellieqbueat
convellieqbeaut convellieqbeatu convellieqbeuat convellieqbeuta convellieqbetua convellieqbetau convelliequtbae
convelliequtbea convelliequtabe convelliequtaeb convelliequteab convelliequteba convelliequbtae convelliequbtea
convelliequbate convelliequbaet convelliequbeat convelliequbeta convelliequabte convelliequabet convelliequatbe
convelliequateb convelliequaetb convelliequaebt convelliequebat convelliequebta convelliequeabt convelliequeatb
convelliequetab convelliequetba convellieqetbua convellieqetbau convellieqetuba convellieqetuab convellieqetaub
convellieqetabu convellieqebtua convellieqebtau convellieqebuta convellieqebuat convellieqebaut convellieqebatu
convellieqeubta convellieqeubat convellieqeutba convellieqeutab convellieqeuatb convellieqeuabt convellieqeabut
convellieqeabtu convellieqeaubt convellieqeautb convellieqeatub convellieqeatbu convellieuatqbe convellieuatqeb
convellieuatbqe convellieuatbeq convellieuatebq convellieuateqb convellieuaqtbe convellieuaqteb convellieuaqbte
convellieuaqbet convellieuaqebt convellieuaqetb convellieuabqte convellieuabqet convellieuabtqe convellieuabteq
convellieuabetq convellieuabeqt convellieuaeqbt convellieuaeqtb convellieuaebqt convellieuaebtq convellieuaetbq
convellieuaetqb convellieutaqbe convellieutaqeb convellieutabqe convellieutabeq convellieutaebq convellieutaeqb
convellieutqabe convellieutqaeb convellieutqbae convellieutqbea convellieutqeba convellieutqeab convellieutbqae
convellieutbqea convellieutbaqe convellieutbaeq convellieutbeaq convellieutbeqa convellieuteqba convellieuteqab
convellieutebqa convellieutebaq convellieuteabq convellieuteaqb convellieuqtabe convellieuqtaeb convellieuqtbae
convellieuqtbea convellieuqteba convellieuqteab convellieuqatbe convellieuqateb convellieuqabte convellieuqabet
convellieuqaebt convellieuqaetb convellieuqbate convellieuqbaet convellieuqbtae convellieuqbtea convellieuqbeta
convellieuqbeat convellieuqeabt convellieuqeatb convellieuqebat convellieuqebta convellieuqetba convellieuqetab
convellieubtqae convellieubtqea convellieubtaqe convellieubtaeq convellieubteaq convellieubteqa convellieubqtae
convellieubqtea convellieubqate convellieubqaet convellieubqeat convellieubqeta convellieubaqte convellieubaqet
convellieubatqe convellieubateq convellieubaetq convellieubaeqt convellieubeqat convellieubeqta convellieubeaqt
convellieubeatq convellieubetaq convellieubetqa convellieuetqba convellieuetqab convellieuetbqa convellieuetbaq
convellieuetabq convellieuetaqb convellieueqtba convellieueqtab convellieueqbta convellieueqbat convellieueqabt
convellieueqatb convellieuebqta convellieuebqat convellieuebtqa convellieuebtaq convellieuebatq convellieuebaqt
convellieueaqbt convellieueaqtb convellieueabqt convellieueabtq convellieueatbq convellieueatqb convellieeatqub
convellieeatqbu convellieeatuqb convellieeatubq convellieeatbuq convellieeatbqu convellieeaqtub convellieeaqtbu
convellieeaqutb convellieeaqubt convellieeaqbut convellieeaqbtu convellieeauqtb convellieeauqbt convellieeautqb
convellieeautbq convellieeaubtq convellieeaubqt convellieeabqut convellieeabqtu convellieeabuqt convellieeabutq
convellieeabtuq convellieeabtqu convellieetaqub convellieetaqbu convellieetauqb convellieetaubq convellieetabuq
convellieetabqu convellieetqaub convellieetqabu convellieetquab convellieetquba convellieetqbua convellieetqbau
convellieetuqab convellieetuqba convellieetuaqb convellieetuabq convellieetubaq convellieetubqa convellieetbqua
convellieetbqau convellieetbuqa convellieetbuaq convellieetbauq convellieetbaqu convellieeqtaub convellieeqtabu
convellieeqtuab convellieeqtuba convellieeqtbua convellieeqtbau convellieeqatub convellieeqatbu convellieeqautb
convellieeqaubt convellieeqabut convellieeqabtu convellieequatb convellieequabt convellieequtab convellieequtba
convellieequbta convellieequbat convellieeqbaut convellieeqbatu convellieeqbuat convellieeqbuta convellieeqbtua
convellieeqbtau convellieeutqab convellieeutqba convellieeutaqb convellieeutabq convellieeutbaq convellieeutbqa
convellieeuqtab convellieeuqtba convellieeuqatb convellieeuqabt convellieeuqbat convellieeuqbta convellieeuaqtb
convellieeuaqbt convellieeuatqb convellieeuatbq convellieeuabtq convellieeuabqt convellieeubqat convellieeubqta
convellieeubaqt convellieeubatq convellieeubtaq convellieeubtqa convellieebtqua convellieebtqau convellieebtuqa
convellieebtuaq convellieebtauq convellieebtaqu convellieebqtua convellieebqtau convellieebquta convellieebquat
convellieebqaut convellieebqatu convellieebuqta convellieebuqat convellieebutqa convellieebutaq convellieebuatq
convellieebuaqt convellieebaqut convellieebaqtu convellieebauqt convellieebautq convellieebatuq convellieebatqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us