easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

gorer

vitavissimus

ormiston

obouvki

catheterize

caruso

sedebatis

balow

arabes

quasit

mashelton

meditererranei

outgarment

damon

peccant

locknut

unsnatch

circulable


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: contendoque
cipher variations:
dpoufoeprvf eqpvgpfqswg frqwhqgrtxh gsrxirhsuyi htsyjsitvzj
iutzktjuwak jvualukvxbl kwvbmvlwycm lxwcnwmxzdn myxdoxnyaeo
nzyepyozbfp oazfqzpacgq pbagraqbdhr qcbhsbrceis rdcitcsdfjt
sedjudtegku tfekveufhlv ugflwfvgimw vhgmxgwhjnx wihnyhxikoy
xjioziyjlpz ykjpajzkmqa zlkqbkalnrb amlrclbmosc bnmsdmcnptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: contendoque
Cipher: xlmgvmwljfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: contendoque
Cipher: AAABA ABBAB ABBAA BAABA AABAA ABBAA AAABB ABBAB ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: contendoque
cipher variations:
dpoufoeprvfhrognokrxjnltosvoqtdxvpvoedowvjldtxoqlocxpzlxzoctoizvntfdoajoudhpjjfomroafndr
nhoyzoghtrzrjokhomjzfhvlowposlftpznoixoynlhxeqpvgpfqswgisphoplsykomuptwprueywqwpfepxwkme
uyprmpdyqamyapdupjawougepbkpveiqkkgpnspbgoesoipzaphiusaskplipnkagiwmpxqptmguqaopjypzomiy
frqwhqgrtxhjtqipqmtzlpnvquxqsvfzxrxqgfqyxlnfvzqsnqezrbnzbqevqkbxpvhfqclqwfjrllhqotqchpft
pjqabqijvtbtlqmjqolbhjxnqyrqunhvrbpqkzqapnjzgsrxirhsuyikurjqrnuamqowrvyrtwgaysyrhgrzymog
wartorfascoacrfwrlcyqwigrdmrxgksmmirpurdiqguqkrbcrjkwucumrnkrpmcikyorzsrvoiwscqrlarbqoka
htsyjsitvzjlvskrsovbnrpxswzsuxhbztzsihsaznphxbsupsgbtdpbdsgxsmdzrxjhsensyhltnnjsqvsejrhv
rlscdsklxvdvnsolsqndjlzpsatswpjxtdrsmbscrplbiutzktjuwakmwtlstpwcosqytxatvyicauatjitbaoqi
yctvqthcueqcethytneasykitfotzimuooktrwtfksiwsmtdetlmywewotpmtroekmaqtbutxqkyuestnctdsqmc
jvualukvxblnxumtuqxdptrzuybuwzjdbvbukjucbprjzduwruidvfrdfuizuofbtzljugpuajnvpplusxugltjx
tnuefumnzxfxpuqnuspflnbrucvuyrlzvftuoduetrndkwvbmvlwycmoyvnuvryequsavzcvxakecwcvlkvdcqsk
aevxsvjewgsegvjavpgcuamkvhqvbkowqqmvtyvhmukyuovfgvnoaygyqvrovtqgmocsvdwvzsmawguvpevfusoe
lxwcnwmxzdnpzwovwszfrvtbwadwyblfdxdwmlwedrtlbfwytwkfxhtfhwkbwqhdvbnlwirwclpxrrnwuzwinvlz
vpwghwopbzhzrwspwurhnpdtwexwatnbxhvwqfwgvtpfmyxdoxnyaeoqaxpwxtagswucxbexzcmgeyexnmxfesum
cgxzuxlgyiugixlcxriewcomxjsxdmqyssoxvaxjowmawqxhixpqcaiasxtqxvsioqeuxfyxbuocyiwxrgxhwuqg
nzyepyozbfprbyqxyubhtxvdycfyadnhfzfyonygftvndhyavymhzjvhjymdysjfxdpnyktyenrzttpywbykpxnb
xryijyqrdbjbtyurywtjprfvygzycvpdzjxyshyixvrhoazfqzpacgqsczryzvciuywezdgzbeoigagzpozhguwo
eizbwzniakwikzneztkgyeqozluzfosauuqzxczlqyocyszjkzrseckcuzvszxukqsgwzhazdwqeakyztizjywsi
pbagraqbdhrtdaszawdjvzxfaehacfpjhbhaqpaihvxpfjacxaojblxjlaofaulhzfrpamvagptbvvraydamrzpd
ztaklastfdldvawtayvlrthxaibaexrfblzaujakzxtjqcbhsbrceisuebtabxekwaygbfibdgqkicibrqbjiwyq
gkbdybpkcmykmbpgbvmiagsqbnwbhqucwwsbzebnsaqeaublmbtugemewbxubzwmsuiybjcbfysgcmabvkblayuk
rdcitcsdfjtvfcubcyflxbzhcgjcehrljdjcsrckjxzrhlcezcqldnzlncqhcwnjbhtrcoxcirvdxxtcafcotbrf
bvcmncuvhfnfxcyvcaxntvjzckdcgzthdnbcwlcmbzvlsedjudtegkuwgdvcdzgmycaidhkdfismkekdtsdlkyas
imdfadrmeoamodridxokciusdpydjsweyyudbgdpucsgcwdnodvwigogydzwdbyouwkadledhauieocdxmdncawm
tfekveufhlvxhewdeahnzdbjeilegjtnlfleutemlzbtjnegbesnfpbnpesjeypldjvteqzektxfzzvecheqvdth
dxeopewxjhphzeaxeczpvxlbemfeibvjfpdeyneodbxnugflwfvgimwyifxefbioaeckfjmfhkuomgmfvufnmacu
kofhcftogqcoqftkfzqmekwufrafluygaawfdifrweuieyfpqfxykiqiafbyfdaqwymcfngfjcwkgqefzofpecyo
vhgmxgwhjnxzjgyfgcjpbfdlgkngilvpnhngwvgonbdvlpgidguphrdprgulgarnflxvgsbgmvzhbbxgejgsxfvj
fzgqrgyzljrjbgczgebrxzndgohgkdxlhrfgapgqfdzpwihnyhxikoyakhzghdkqcgemhlohjmwqoiohxwhpocew
mqhjehvqiseqshvmhbsogmywhtchnwaiccyhfkhtygwkgahrshzamkskchdahfcsyaoehpihleymisghbqhrgeaq
xjioziyjlpzbliahielrdhfnimpiknxrpjpiyxiqpdfxnrikfiwrjtfrtiwnictphnzxiudioxbjddzigliuzhxl
hbistiabnltldiebigdtzbpfiqjimfznjthicrishfbrykjpajzkmqacmjbijfmseigojnqjloysqkqjzyjrqegy
osjlgjxskugsujxojduqioayjvejpyckeeajhmjvaiymicjtujbcomumejfcjheuacqgjrkjngaokuijdsjtigcs
zlkqbkalnrbdnkcjkgntfjhpkorkmpztrlrkazksrfhzptkmhkytlvhtvkypkevrjpbzkwfkqzdlffbkinkwbjzn
jdkuvkcdpnvnfkgdkifvbdrhkslkohbplvjketkujhdtamlrclbmosceoldklhougkiqlpslnqausmslbaltsgia
qulnilzumwiuwlzqlfwskqcalxglraemggcljolxckaokelvwldeqowoglheljgwcesiltmlpicqmwklfulvkieu
bnmsdmcnptdfpmelmipvhljrmqtmorbvtntmcbmuthjbrvmojmavnxjvxmarmgxtlrdbmyhmsbfnhhdmkpmydlbp
lfmwxmefrpxphmifmkhxdftjmunmqjdrnxlmgvmwljfvcontendoquegqnfmnjqwimksnrunpscwuoundcnvuikc
swnpknbwoykwynbsnhyumsecnzintcgoiienlqnzemcqmgnxynfgsqyqinjgnliyeguknvonrkesoymnhwnxmkgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: contendoque
Cipher: pbagraqbdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: contendoque
Cipher: 3143334451334143145451

Extended Methods:
Method #1

Plaintext: contendoque
method variations:
htsyksitvzknyxdpxoyaepsdciuctdfkuxihozhyilpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
c o n t e n d o q u e 
3 4 3 4 5 3 4 4 1 5 5 
1 3 3 4 1 3 1 3 4 4 1 
They are then read out in rows:
3434534415513341313441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: contendoque
Cipher: ssptvendcsd

Read more ...
Method #3

Plaintext: contendoque
method variations:
qnsylsqcyyl nsylsqcyylq sylsqcyylqn
ylsqcyylqns lsqcyylqnsy sqcyylqnsyl
qcyylqnsyls cyylqnsylsq yylqnsylsqc
ylqnsylsqcy lqnsylsqcyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: contendoque

first 5040 cipher variations(39615626 total)
contendoque contendoqeu contendouqe contendoueq contendoeuq contendoequ contendqoue contendqoeu contendquoe contendqueo
contendqeuo contendqeou contenduqoe contenduqeo contenduoqe contenduoeq contendueoq contendueqo contendequo contendeqou
contendeuqo contendeuoq contendeouq contendeoqu contenodque contenodqeu contenoduqe contenodueq contenodeuq contenodequ
contenoqdue contenoqdeu contenoqude contenoqued contenoqeud contenoqedu contenouqde contenouqed contenoudqe contenoudeq
contenouedq contenoueqd contenoequd contenoeqdu contenoeuqd contenoeudq contenoeduq contenoedqu contenqodue contenqodeu
contenqoude contenqoued contenqoeud contenqoedu contenqdoue contenqdoeu contenqduoe contenqdueo contenqdeuo contenqdeou
contenqudoe contenqudeo contenquode contenquoed contenqueod contenquedo contenqeduo contenqedou contenqeudo contenqeuod
contenqeoud contenqeodu contenuoqde contenuoqed contenuodqe contenuodeq contenuoedq contenuoeqd contenuqode contenuqoed
contenuqdoe contenuqdeo contenuqedo contenuqeod contenudqoe contenudqeo contenudoqe contenudoeq contenudeoq contenudeqo
contenueqdo contenueqod contenuedqo contenuedoq contenueodq contenueoqd conteneoqud conteneoqdu conteneouqd conteneoudq
conteneoduq conteneodqu conteneqoud conteneqodu contenequod contenequdo conteneqduo conteneqdou conteneuqod conteneuqdo
conteneuoqd conteneuodq conteneudoq conteneudqo contenedquo contenedqou conteneduqo conteneduoq contenedouq contenedoqu
contednoque contednoqeu contednouqe contednoueq contednoeuq contednoequ contednqoue contednqoeu contednquoe contednqueo
contednqeuo contednqeou contednuqoe contednuqeo contednuoqe contednuoeq contednueoq contednueqo contednequo contedneqou
contedneuqo contedneuoq contedneouq contedneoqu contedonque contedonqeu contedonuqe contedonueq contedoneuq contedonequ
contedoqnue contedoqneu contedoqune contedoquen contedoqeun contedoqenu contedouqne contedouqen contedounqe contedouneq
contedouenq contedoueqn contedoequn contedoeqnu contedoeuqn contedoeunq contedoenuq contedoenqu contedqonue contedqoneu
contedqoune contedqouen contedqoeun contedqoenu contedqnoue contedqnoeu contedqnuoe contedqnueo contedqneuo contedqneou
contedqunoe contedquneo contedquone contedquoen contedqueon contedqueno contedqenuo contedqenou contedqeuno contedqeuon
contedqeoun contedqeonu conteduoqne conteduoqen conteduonqe conteduoneq conteduoenq conteduoeqn conteduqone conteduqoen
conteduqnoe conteduqneo conteduqeno conteduqeon contedunqoe contedunqeo contedunoqe contedunoeq conteduneoq conteduneqo
contedueqno contedueqon conteduenqo conteduenoq contedueonq contedueoqn contedeoqun contedeoqnu contedeouqn contedeounq
contedeonuq contedeonqu contedeqoun contedeqonu contedequon contedequno contedeqnuo contedeqnou contedeuqon contedeuqno
contedeuoqn contedeuonq contedeunoq contedeunqo contedenquo contedenqou contedenuqo contedenuoq contedenouq contedenoqu
conteodnque conteodnqeu conteodnuqe conteodnueq conteodneuq conteodnequ conteodqnue conteodqneu conteodqune conteodquen
conteodqeun conteodqenu conteoduqne conteoduqen conteodunqe conteoduneq conteoduenq conteodueqn conteodequn conteodeqnu
conteodeuqn conteodeunq conteodenuq conteodenqu conteondque conteondqeu conteonduqe conteondueq conteondeuq conteondequ
conteonqdue conteonqdeu conteonqude conteonqued conteonqeud conteonqedu conteonuqde conteonuqed conteonudqe conteonudeq
conteonuedq conteonueqd conteonequd conteoneqdu conteoneuqd conteoneudq conteoneduq conteonedqu conteoqndue conteoqndeu
conteoqnude conteoqnued conteoqneud conteoqnedu conteoqdnue conteoqdneu conteoqdune conteoqduen conteoqdeun conteoqdenu
conteoqudne conteoquden conteoqunde conteoquned conteoquend conteoquedn conteoqedun conteoqednu conteoqeudn conteoqeund
conteoqenud conteoqendu conteounqde conteounqed conteoundqe conteoundeq conteounedq conteouneqd conteouqnde conteouqned
conteouqdne conteouqden conteouqedn conteouqend conteoudqne conteoudqen conteoudnqe conteoudneq conteoudenq conteoudeqn
conteoueqdn conteoueqnd conteouedqn conteouednq conteouendq conteouenqd conteoenqud conteoenqdu conteoenuqd conteoenudq
conteoenduq conteoendqu conteoeqnud conteoeqndu conteoeqund conteoequdn conteoeqdun conteoeqdnu conteoeuqnd conteoeuqdn
conteoeunqd conteoeundq conteoeudnq conteoeudqn conteoedqun conteoedqnu conteoeduqn conteoedunq conteoednuq conteoednqu
conteqdonue conteqdoneu conteqdoune conteqdouen conteqdoeun conteqdoenu conteqdnoue conteqdnoeu conteqdnuoe conteqdnueo
conteqdneuo conteqdneou conteqdunoe conteqduneo conteqduone conteqduoen conteqdueon conteqdueno conteqdenuo conteqdenou
conteqdeuno conteqdeuon conteqdeoun conteqdeonu conteqodnue conteqodneu conteqodune conteqoduen conteqodeun conteqodenu
conteqondue conteqondeu conteqonude conteqonued conteqoneud conteqonedu conteqounde conteqouned conteqoudne conteqouden
conteqouedn conteqouend conteqoenud conteqoendu conteqoeund conteqoeudn conteqoedun conteqoednu conteqnodue conteqnodeu
conteqnoude conteqnoued conteqnoeud conteqnoedu conteqndoue conteqndoeu conteqnduoe conteqndueo conteqndeuo conteqndeou
conteqnudoe conteqnudeo conteqnuode conteqnuoed conteqnueod conteqnuedo conteqneduo conteqnedou conteqneudo conteqneuod
conteqneoud conteqneodu contequonde contequoned contequodne contequoden contequoedn contequoend contequnode contequnoed
contequndoe contequndeo contequnedo contequneod contequdnoe contequdneo contequdone contequdoen contequdeon contequdeno
contequendo contequenod contequedno contequedon contequeodn contequeond conteqeonud conteqeondu conteqeound conteqeoudn
conteqeodun conteqeodnu conteqenoud conteqenodu conteqenuod conteqenudo conteqenduo conteqendou conteqeunod conteqeundo
conteqeuond conteqeuodn conteqeudon conteqeudno conteqednuo conteqednou conteqeduno conteqeduon conteqedoun conteqedonu
conteudoqne conteudoqen conteudonqe conteudoneq conteudoenq conteudoeqn conteudqone conteudqoen conteudqnoe conteudqneo
conteudqeno conteudqeon conteudnqoe conteudnqeo conteudnoqe conteudnoeq conteudneoq conteudneqo conteudeqno conteudeqon
conteudenqo conteudenoq conteudeonq conteudeoqn conteuodqne conteuodqen conteuodnqe conteuodneq conteuodenq conteuodeqn
conteuoqdne conteuoqden conteuoqnde conteuoqned conteuoqend conteuoqedn conteuonqde conteuonqed conteuondqe conteuondeq
conteuonedq conteuoneqd conteuoeqnd conteuoeqdn conteuoenqd conteuoendq conteuoednq conteuoedqn conteuqodne conteuqoden
conteuqonde conteuqoned conteuqoend conteuqoedn conteuqdone conteuqdoen conteuqdnoe conteuqdneo conteuqdeno conteuqdeon
conteuqndoe conteuqndeo conteuqnode conteuqnoed conteuqneod conteuqnedo conteuqedno conteuqedon conteuqendo conteuqenod
conteuqeond conteuqeodn conteunoqde conteunoqed conteunodqe conteunodeq conteunoedq conteunoeqd conteunqode conteunqoed
conteunqdoe conteunqdeo conteunqedo conteunqeod conteundqoe conteundqeo conteundoqe conteundoeq conteundeoq conteundeqo
conteuneqdo conteuneqod conteunedqo conteunedoq conteuneodq conteuneoqd conteueoqnd conteueoqdn conteueonqd conteueondq
conteueodnq conteueodqn conteueqond conteueqodn conteueqnod conteueqndo conteueqdno conteueqdon conteuenqod conteuenqdo
conteuenoqd conteuenodq conteuendoq conteuendqo conteuedqno conteuedqon conteuednqo conteuednoq conteuedonq conteuedoqn
conteedoqun conteedoqnu conteedouqn conteedounq conteedonuq conteedonqu conteedqoun conteedqonu conteedquon conteedquno
conteedqnuo conteedqnou conteeduqon conteeduqno conteeduoqn conteeduonq conteedunoq conteedunqo conteednquo conteednqou
conteednuqo conteednuoq conteednouq conteednoqu conteeodqun conteeodqnu conteeoduqn conteeodunq conteeodnuq conteeodnqu
conteeoqdun conteeoqdnu conteeoqudn conteeoqund conteeoqnud conteeoqndu conteeouqdn conteeouqnd conteeoudqn conteeoudnq
conteeoundq conteeounqd conteeonqud conteeonqdu conteeonuqd conteeonudq conteeonduq conteeondqu conteeqodun conteeqodnu
conteeqoudn conteeqound conteeqonud conteeqondu conteeqdoun conteeqdonu conteeqduon conteeqduno conteeqdnuo conteeqdnou
conteequdon conteequdno conteequodn conteequond conteequnod conteequndo conteeqnduo conteeqndou conteeqnudo conteeqnuod
conteeqnoud conteeqnodu conteeuoqdn conteeuoqnd conteeuodqn conteeuodnq conteeuondq conteeuonqd conteeuqodn conteeuqond
conteeuqdon conteeuqdno conteeuqndo conteeuqnod conteeudqon conteeudqno conteeudoqn conteeudonq conteeudnoq conteeudnqo
conteeunqdo conteeunqod conteeundqo conteeundoq conteeunodq conteeunoqd conteenoqud conteenoqdu conteenouqd conteenoudq
conteenoduq conteenodqu conteenqoud conteenqodu conteenquod conteenqudo conteenqduo conteenqdou conteenuqod conteenuqdo
conteenuoqd conteenuodq conteenudoq conteenudqo conteendquo conteendqou conteenduqo conteenduoq conteendouq conteendoqu
contnedoque contnedoqeu contnedouqe contnedoueq contnedoeuq contnedoequ contnedqoue contnedqoeu contnedquoe contnedqueo
contnedqeuo contnedqeou contneduqoe contneduqeo contneduoqe contneduoeq contnedueoq contnedueqo contnedequo contnedeqou
contnedeuqo contnedeuoq contnedeouq contnedeoqu contneodque contneodqeu contneoduqe contneodueq contneodeuq contneodequ
contneoqdue contneoqdeu contneoqude contneoqued contneoqeud contneoqedu contneouqde contneouqed contneoudqe contneoudeq
contneouedq contneoueqd contneoequd contneoeqdu contneoeuqd contneoeudq contneoeduq contneoedqu contneqodue contneqodeu
contneqoude contneqoued contneqoeud contneqoedu contneqdoue contneqdoeu contneqduoe contneqdueo contneqdeuo contneqdeou
contnequdoe contnequdeo contnequode contnequoed contnequeod contnequedo contneqeduo contneqedou contneqeudo contneqeuod
contneqeoud contneqeodu contneuoqde contneuoqed contneuodqe contneuodeq contneuoedq contneuoeqd contneuqode contneuqoed
contneuqdoe contneuqdeo contneuqedo contneuqeod contneudqoe contneudqeo contneudoqe contneudoeq contneudeoq contneudeqo
contneueqdo contneueqod contneuedqo contneuedoq contneueodq contneueoqd contneeoqud contneeoqdu contneeouqd contneeoudq
contneeoduq contneeodqu contneeqoud contneeqodu contneequod contneequdo contneeqduo contneeqdou contneeuqod contneeuqdo
contneeuoqd contneeuodq contneeudoq contneeudqo contneedquo contneedqou contneeduqo contneeduoq contneedouq contneedoqu
contndeoque contndeoqeu contndeouqe contndeoueq contndeoeuq contndeoequ contndeqoue contndeqoeu contndequoe contndequeo
contndeqeuo contndeqeou contndeuqoe contndeuqeo contndeuoqe contndeuoeq contndeueoq contndeueqo contndeequo contndeeqou
contndeeuqo contndeeuoq contndeeouq contndeeoqu contndoeque contndoeqeu contndoeuqe contndoeueq contndoeeuq contndoeequ
contndoqeue contndoqeeu contndoquee contndoquee contndoqeue contndoqeeu contndouqee contndouqee contndoueqe contndoueeq
contndoueeq contndoueqe contndoeque contndoeqeu contndoeuqe contndoeueq contndoeeuq contndoeequ contndqoeue contndqoeeu
contndqouee contndqouee contndqoeue contndqoeeu contndqeoue contndqeoeu contndqeuoe contndqeueo contndqeeuo contndqeeou
contndqueoe contndqueeo contndquoee contndquoee contndqueoe contndqueeo contndqeeuo contndqeeou contndqeueo contndqeuoe
contndqeoue contndqeoeu contnduoqee contnduoqee contnduoeqe contnduoeeq contnduoeeq contnduoeqe contnduqoee contnduqoee
contnduqeoe contnduqeeo contnduqeeo contnduqeoe contndueqoe contndueqeo contndueoqe contndueoeq contndueeoq contndueeqo
contndueqeo contndueqoe contndueeqo contndueeoq contndueoeq contndueoqe contndeoque contndeoqeu contndeouqe contndeoueq
contndeoeuq contndeoequ contndeqoue contndeqoeu contndequoe contndequeo contndeqeuo contndeqeou contndeuqoe contndeuqeo
contndeuoqe contndeuoeq contndeueoq contndeueqo contndeequo contndeeqou contndeeuqo contndeeuoq contndeeouq contndeeoqu
contnodeque contnodeqeu contnodeuqe contnodeueq contnodeeuq contnodeequ contnodqeue contnodqeeu contnodquee contnodquee
contnodqeue contnodqeeu contnoduqee contnoduqee contnodueqe contnodueeq contnodueeq contnodueqe contnodeque contnodeqeu
contnodeuqe contnodeueq contnodeeuq contnodeequ contnoedque contnoedqeu contnoeduqe contnoedueq contnoedeuq contnoedequ
contnoeqdue contnoeqdeu contnoequde contnoequed contnoeqeud contnoeqedu contnoeuqde contnoeuqed contnoeudqe contnoeudeq
contnoeuedq contnoeueqd contnoeequd contnoeeqdu contnoeeuqd contnoeeudq contnoeeduq contnoeedqu contnoqedue contnoqedeu
contnoqeude contnoqeued contnoqeeud contnoqeedu contnoqdeue contnoqdeeu contnoqduee contnoqduee contnoqdeue contnoqdeeu
contnoqudee contnoqudee contnoquede contnoqueed contnoqueed contnoquede contnoqedue contnoqedeu contnoqeude contnoqeued
contnoqeeud contnoqeedu contnoueqde contnoueqed contnouedqe contnouedeq contnoueedq contnoueeqd contnouqede contnouqeed
contnouqdee contnouqdee contnouqede contnouqeed contnoudqee contnoudqee contnoudeqe contnoudeeq contnoudeeq contnoudeqe
contnoueqde contnoueqed contnouedqe contnouedeq contnoueedq contnoueeqd contnoeequd contnoeeqdu contnoeeuqd contnoeeudq
contnoeeduq contnoeedqu contnoeqeud contnoeqedu contnoequed contnoequde contnoeqdue contnoeqdeu contnoeuqed contnoeuqde
contnoeueqd contnoeuedq contnoeudeq contnoeudqe contnoedque contnoedqeu contnoeduqe contnoedueq contnoedeuq contnoedequ
contnqdoeue contnqdoeeu contnqdouee contnqdouee contnqdoeue contnqdoeeu contnqdeoue contnqdeoeu contnqdeuoe contnqdeueo
contnqdeeuo contnqdeeou contnqdueoe contnqdueeo contnqduoee contnqduoee contnqdueoe contnqdueeo contnqdeeuo contnqdeeou
contnqdeueo contnqdeuoe contnqdeoue contnqdeoeu contnqodeue contnqodeeu contnqoduee contnqoduee contnqodeue contnqodeeu
contnqoedue contnqoedeu contnqoeude contnqoeued contnqoeeud contnqoeedu contnqouede contnqoueed contnqoudee contnqoudee
contnqouede contnqoueed contnqoeeud contnqoeedu contnqoeued contnqoeude contnqoedue contnqoedeu contnqeodue contnqeodeu
contnqeoude contnqeoued contnqeoeud contnqeoedu contnqedoue contnqedoeu contnqeduoe contnqedueo contnqedeuo contnqedeou
contnqeudoe contnqeudeo contnqeuode contnqeuoed contnqeueod contnqeuedo contnqeeduo contnqeedou contnqeeudo contnqeeuod
contnqeeoud contnqeeodu contnquoede contnquoeed contnquodee contnquodee contnquoede contnquoeed contnqueode contnqueoed
contnquedoe contnquedeo contnqueedo contnqueeod contnqudeoe contnqudeeo contnqudoee contnqudoee contnqudeoe contnqudeeo
contnqueedo contnqueeod contnquedeo contnquedoe contnqueode contnqueoed contnqeoeud contnqeoedu contnqeoued contnqeoude
contnqeodue contnqeodeu contnqeeoud contnqeeodu contnqeeuod contnqeeudo contnqeeduo contnqeedou contnqeueod contnqeuedo
contnqeuoed contnqeuode contnqeudoe contnqeudeo contnqedeuo contnqedeou contnqedueo contnqeduoe contnqedoue contnqedoeu
contnudoqee contnudoqee contnudoeqe contnudoeeq contnudoeeq contnudoeqe contnudqoee contnudqoee contnudqeoe contnudqeeo
contnudqeeo contnudqeoe contnudeqoe contnudeqeo contnudeoqe contnudeoeq contnudeeoq contnudeeqo contnudeqeo contnudeqoe
contnudeeqo contnudeeoq contnudeoeq contnudeoqe contnuodqee contnuodqee contnuodeqe contnuodeeq contnuodeeq contnuodeqe
contnuoqdee contnuoqdee contnuoqede contnuoqeed contnuoqeed contnuoqede contnuoeqde contnuoeqed contnuoedqe contnuoedeq
contnuoeedq contnuoeeqd contnuoeqed contnuoeqde contnuoeeqd contnuoeedq contnuoedeq contnuoedqe contnuqodee contnuqodee
contnuqoede contnuqoeed contnuqoeed contnuqoede contnuqdoee contnuqdoee contnuqdeoe contnuqdeeo contnuqdeeo contnuqdeoe
contnuqedoe contnuqedeo contnuqeode contnuqeoed contnuqeeod contnuqeedo contnuqedeo contnuqedoe contnuqeedo contnuqeeod
contnuqeoed contnuqeode contnueoqde contnueoqed contnueodqe contnueodeq contnueoedq contnueoeqd contnueqode contnueqoed
contnueqdoe contnueqdeo contnueqedo contnueqeod contnuedqoe contnuedqeo contnuedoqe contnuedoeq contnuedeoq contnuedeqo
contnueeqdo contnueeqod contnueedqo contnueedoq contnueeodq contnueeoqd contnueoqed contnueoqde contnueoeqd contnueoedq
contnueodeq contnueodqe contnueqoed contnueqode contnueqeod contnueqedo contnueqdeo contnueqdoe contnueeqod contnueeqdo
contnueeoqd contnueeodq contnueedoq contnueedqo contnuedqeo contnuedqoe contnuedeqo contnuedeoq contnuedoeq contnuedoqe
contnedoque contnedoqeu contnedouqe contnedoueq contnedoeuq contnedoequ contnedqoue contnedqoeu contnedquoe contnedqueo
contnedqeuo contnedqeou contneduqoe contneduqeo contneduoqe contneduoeq contnedueoq contnedueqo contnedequo contnedeqou
contnedeuqo contnedeuoq contnedeouq contnedeoqu contneodque contneodqeu contneoduqe contneodueq contneodeuq contneodequ
contneoqdue contneoqdeu contneoqude contneoqued contneoqeud contneoqedu contneouqde contneouqed contneoudqe contneoudeq
contneouedq contneoueqd contneoequd contneoeqdu contneoeuqd contneoeudq contneoeduq contneoedqu contneqodue contneqodeu
contneqoude contneqoued contneqoeud contneqoedu contneqdoue contneqdoeu contneqduoe contneqdueo contneqdeuo contneqdeou
contnequdoe contnequdeo contnequode contnequoed contnequeod contnequedo contneqeduo contneqedou contneqeudo contneqeuod
contneqeoud contneqeodu contneuoqde contneuoqed contneuodqe contneuodeq contneuoedq contneuoeqd contneuqode contneuqoed
contneuqdoe contneuqdeo contneuqedo contneuqeod contneudqoe contneudqeo contneudoqe contneudoeq contneudeoq contneudeqo
contneueqdo contneueqod contneuedqo contneuedoq contneueodq contneueoqd contneeoqud contneeoqdu contneeouqd contneeoudq
contneeoduq contneeodqu contneeqoud contneeqodu contneequod contneequdo contneeqduo contneeqdou contneeuqod contneeuqdo
contneeuoqd contneeuodq contneeudoq contneeudqo contneedquo contneedqou contneeduqo contneeduoq contneedouq contneedoqu
contdneoque contdneoqeu contdneouqe contdneoueq contdneoeuq contdneoequ contdneqoue contdneqoeu contdnequoe contdnequeo
contdneqeuo contdneqeou contdneuqoe contdneuqeo contdneuoqe contdneuoeq contdneueoq contdneueqo contdneequo contdneeqou
contdneeuqo contdneeuoq contdneeouq contdneeoqu contdnoeque contdnoeqeu contdnoeuqe contdnoeueq contdnoeeuq contdnoeequ
contdnoqeue contdnoqeeu contdnoquee contdnoquee contdnoqeue contdnoqeeu contdnouqee contdnouqee contdnoueqe contdnoueeq
contdnoueeq contdnoueqe contdnoeque contdnoeqeu contdnoeuqe contdnoeueq contdnoeeuq contdnoeequ contdnqoeue contdnqoeeu
contdnqouee contdnqouee contdnqoeue contdnqoeeu contdnqeoue contdnqeoeu contdnqeuoe contdnqeueo contdnqeeuo contdnqeeou
contdnqueoe contdnqueeo contdnquoee contdnquoee contdnqueoe contdnqueeo contdnqeeuo contdnqeeou contdnqeueo contdnqeuoe
contdnqeoue contdnqeoeu contdnuoqee contdnuoqee contdnuoeqe contdnuoeeq contdnuoeeq contdnuoeqe contdnuqoee contdnuqoee
contdnuqeoe contdnuqeeo contdnuqeeo contdnuqeoe contdnueqoe contdnueqeo contdnueoqe contdnueoeq contdnueeoq contdnueeqo
contdnueqeo contdnueqoe contdnueeqo contdnueeoq contdnueoeq contdnueoqe contdneoque contdneoqeu contdneouqe contdneoueq
contdneoeuq contdneoequ contdneqoue contdneqoeu contdnequoe contdnequeo contdneqeuo contdneqeou contdneuqoe contdneuqeo
contdneuoqe contdneuoeq contdneueoq contdneueqo contdneequo contdneeqou contdneeuqo contdneeuoq contdneeouq contdneeoqu
contdenoque contdenoqeu contdenouqe contdenoueq contdenoeuq contdenoequ contdenqoue contdenqoeu contdenquoe contdenqueo
contdenqeuo contdenqeou contdenuqoe contdenuqeo contdenuoqe contdenuoeq contdenueoq contdenueqo contdenequo contdeneqou
contdeneuqo contdeneuoq contdeneouq contdeneoqu contdeonque contdeonqeu contdeonuqe contdeonueq contdeoneuq contdeonequ
contdeoqnue contdeoqneu contdeoqune contdeoquen contdeoqeun contdeoqenu contdeouqne contdeouqen contdeounqe contdeouneq
contdeouenq contdeoueqn contdeoequn contdeoeqnu contdeoeuqn contdeoeunq contdeoenuq contdeoenqu contdeqonue contdeqoneu
contdeqoune contdeqouen contdeqoeun contdeqoenu contdeqnoue contdeqnoeu contdeqnuoe contdeqnueo contdeqneuo contdeqneou
contdequnoe contdequneo contdequone contdequoen contdequeon contdequeno contdeqenuo contdeqenou contdeqeuno contdeqeuon
contdeqeoun contdeqeonu contdeuoqne contdeuoqen contdeuonqe contdeuoneq contdeuoenq contdeuoeqn contdeuqone contdeuqoen
contdeuqnoe contdeuqneo contdeuqeno contdeuqeon contdeunqoe contdeunqeo contdeunoqe contdeunoeq contdeuneoq contdeuneqo
contdeueqno contdeueqon contdeuenqo contdeuenoq contdeueonq contdeueoqn contdeeoqun contdeeoqnu contdeeouqn contdeeounq
contdeeonuq contdeeonqu contdeeqoun contdeeqonu contdeequon contdeequno contdeeqnuo contdeeqnou contdeeuqon contdeeuqno
contdeeuoqn contdeeuonq contdeeunoq contdeeunqo contdeenquo contdeenqou contdeenuqo contdeenuoq contdeenouq contdeenoqu
contdoenque contdoenqeu contdoenuqe contdoenueq contdoeneuq contdoenequ contdoeqnue contdoeqneu contdoequne contdoequen
contdoeqeun contdoeqenu contdoeuqne contdoeuqen contdoeunqe contdoeuneq contdoeuenq contdoeueqn contdoeequn contdoeeqnu
contdoeeuqn contdoeeunq contdoeenuq contdoeenqu contdoneque contdoneqeu contdoneuqe contdoneueq contdoneeuq contdoneequ
contdonqeue contdonqeeu contdonquee contdonquee contdonqeue contdonqeeu contdonuqee contdonuqee contdonueqe contdonueeq
contdonueeq contdonueqe contdoneque contdoneqeu contdoneuqe contdoneueq contdoneeuq contdoneequ contdoqneue contdoqneeu
contdoqnuee contdoqnuee contdoqneue contdoqneeu contdoqenue contdoqeneu contdoqeune contdoqeuen contdoqeeun contdoqeenu
contdoquene contdoqueen contdoqunee contdoqunee contdoquene contdoqueen contdoqeeun contdoqeenu contdoqeuen contdoqeune
contdoqenue contdoqeneu contdounqee contdounqee contdouneqe contdouneeq contdouneeq contdouneqe contdouqnee contdouqnee
contdouqene contdouqeen contdouqeen contdouqene contdoueqne contdoueqen contdouenqe contdoueneq contdoueenq contdoueeqn
contdoueqen contdoueqne contdoueeqn contdoueenq contdoueneq contdouenqe contdoenque contdoenqeu contdoenuqe contdoenueq
contdoeneuq contdoenequ contdoeqnue contdoeqneu contdoequne contdoequen contdoeqeun contdoeqenu contdoeuqne contdoeuqen
contdoeunqe contdoeuneq contdoeuenq contdoeueqn contdoeequn contdoeeqnu contdoeeuqn contdoeeunq contdoeenuq contdoeenqu
contdqeonue contdqeoneu contdqeoune contdqeouen contdqeoeun contdqeoenu contdqenoue contdqenoeu contdqenuoe contdqenueo
contdqeneuo contdqeneou contdqeunoe contdqeuneo contdqeuone contdqeuoen contdqeueon contdqeueno contdqeenuo contdqeenou
contdqeeuno contdqeeuon contdqeeoun contdqeeonu contdqoenue contdqoeneu contdqoeune contdqoeuen contdqoeeun contdqoeenu
contdqoneue contdqoneeu contdqonuee contdqonuee contdqoneue contdqoneeu contdqounee contdqounee contdqouene contdqoueen
contdqoueen contdqouene contdqoenue contdqoeneu contdqoeune contdqoeuen contdqoeeun contdqoeenu contdqnoeue contdqnoeeu
contdqnouee contdqnouee contdqnoeue contdqnoeeu contdqneoue contdqneoeu contdqneuoe contdqneueo contdqneeuo contdqneeou
contdqnueoe contdqnueeo contdqnuoee contdqnuoee contdqnueoe contdqnueeo contdqneeuo contdqneeou contdqneueo contdqneuoe
contdqneoue contdqneoeu contdquonee contdquonee contdquoene contdquoeen contdquoeen contdquoene contdqunoee contdqunoee
contdquneoe contdquneeo contdquneeo contdquneoe contdquenoe contdqueneo contdqueone contdqueoen contdqueeon contdqueeno
contdqueneo contdquenoe contdqueeno contdqueeon contdqueoen contdqueone contdqeonue contdqeoneu contdqeoune contdqeouen
contdqeoeun contdqeoenu contdqenoue contdqenoeu contdqenuoe contdqenueo contdqeneuo contdqeneou contdqeunoe contdqeuneo
contdqeuone contdqeuoen contdqeueon contdqeueno contdqeenuo contdqeenou contdqeeuno contdqeeuon contdqeeoun contdqeeonu
contdueoqne contdueoqen contdueonqe contdueoneq contdueoenq contdueoeqn contdueqone contdueqoen contdueqnoe contdueqneo
contdueqeno contdueqeon contduenqoe contduenqeo contduenoqe contduenoeq contdueneoq contdueneqo contdueeqno contdueeqon
contdueenqo contdueenoq contdueeonq contdueeoqn contduoeqne contduoeqen contduoenqe contduoeneq contduoeenq contduoeeqn
contduoqene contduoqeen contduoqnee contduoqnee contduoqene contduoqeen contduonqee contduonqee contduoneqe contduoneeq
contduoneeq contduoneqe contduoeqne contduoeqen contduoenqe contduoeneq contduoeenq contduoeeqn contduqoene contduqoeen
contduqonee contduqonee contduqoene contduqoeen contduqeone contduqeoen contduqenoe contduqeneo contduqeeno contduqeeon
contduqneoe contduqneeo contduqnoee contduqnoee contduqneoe contduqneeo contduqeeno contduqeeon contduqeneo contduqenoe
contduqeone contduqeoen contdunoqee contdunoqee contdunoeqe contdunoeeq contdunoeeq contdunoeqe contdunqoee contdunqoee
contdunqeoe contdunqeeo contdunqeeo contdunqeoe contduneqoe contduneqeo contduneoqe contduneoeq contduneeoq contduneeqo
contduneqeo contduneqoe contduneeqo contduneeoq contduneoeq contduneoqe contdueoqne contdueoqen contdueonqe contdueoneq
contdueoenq contdueoeqn contdueqone contdueqoen contdueqnoe contdueqneo contdueqeno contdueqeon contduenqoe contduenqeo
contduenoqe contduenoeq contdueneoq contdueneqo contdueeqno contdueeqon contdueenqo contdueenoq contdueeonq contdueeoqn
contdeeoqun contdeeoqnu contdeeouqn contdeeounq contdeeonuq contdeeonqu contdeeqoun contdeeqonu contdeequon contdeequno
contdeeqnuo contdeeqnou contdeeuqon contdeeuqno contdeeuoqn contdeeuonq contdeeunoq contdeeunqo contdeenquo contdeenqou
contdeenuqo contdeenuoq contdeenouq contdeenoqu contdeoequn contdeoeqnu contdeoeuqn contdeoeunq contdeoenuq contdeoenqu
contdeoqeun contdeoqenu contdeoquen contdeoqune contdeoqnue contdeoqneu contdeouqen contdeouqne contdeoueqn contdeouenq
contdeouneq contdeounqe contdeonque contdeonqeu contdeonuqe contdeonueq contdeoneuq contdeonequ contdeqoeun contdeqoenu
contdeqouen contdeqoune contdeqonue contdeqoneu contdeqeoun contdeqeonu contdeqeuon contdeqeuno contdeqenuo contdeqenou
contdequeon contdequeno contdequoen contdequone contdequnoe contdequneo contdeqneuo contdeqneou contdeqnueo contdeqnuoe
contdeqnoue contdeqnoeu contdeuoqen contdeuoqne contdeuoeqn contdeuoenq contdeuoneq contdeuonqe contdeuqoen contdeuqone
contdeuqeon contdeuqeno contdeuqneo contdeuqnoe contdeueqon contdeueqno contdeueoqn contdeueonq contdeuenoq contdeuenqo
contdeunqeo contdeunqoe contdeuneqo contdeuneoq contdeunoeq contdeunoqe contdenoque contdenoqeu contdenouqe contdenoueq
contdenoeuq contdenoequ contdenqoue contdenqoeu contdenquoe contdenqueo contdenqeuo contdenqeou contdenuqoe contdenuqeo
contdenuoqe contdenuoeq contdenueoq contdenueqo contdenequo contdeneqou contdeneuqo contdeneuoq contdeneouq contdeneoqu
contondeque contondeqeu contondeuqe contondeueq contondeeuq contondeequ contondqeue contondqeeu contondquee contondquee
contondqeue contondqeeu contonduqee contonduqee contondueqe contondueeq contondueeq contondueqe contondeque contondeqeu
contondeuqe contondeueq contondeeuq contondeequ contonedque contonedqeu contoneduqe contonedueq contonedeuq contonedequ
contoneqdue contoneqdeu contonequde contonequed contoneqeud contoneqedu contoneuqde contoneuqed contoneudqe contoneudeq
contoneuedq contoneueqd contoneequd contoneeqdu contoneeuqd contoneeudq contoneeduq contoneedqu contonqedue contonqedeu
contonqeude contonqeued contonqeeud contonqeedu contonqdeue contonqdeeu contonqduee contonqduee contonqdeue contonqdeeu
contonqudee contonqudee contonquede contonqueed contonqueed contonquede contonqedue contonqedeu contonqeude contonqeued
contonqeeud contonqeedu contonueqde contonueqed contonuedqe contonuedeq contonueedq contonueeqd contonuqede contonuqeed
contonuqdee contonuqdee contonuqede contonuqeed contonudqee contonudqee contonudeqe contonudeeq contonudeeq contonudeqe
contonueqde contonueqed contonuedqe contonuedeq contonueedq contonueeqd contoneequd contoneeqdu contoneeuqd contoneeudq
contoneeduq contoneedqu contoneqeud contoneqedu contonequed contonequde contoneqdue contoneqdeu contoneuqed contoneuqde
contoneueqd contoneuedq contoneudeq contoneudqe contonedque contonedqeu contoneduqe contonedueq contonedeuq contonedequ
contodneque contodneqeu contodneuqe contodneueq contodneeuq contodneequ contodnqeue contodnqeeu contodnquee contodnquee
contodnqeue contodnqeeu contodnuqee contodnuqee contodnueqe contodnueeq contodnueeq contodnueqe contodneque contodneqeu
contodneuqe contodneueq contodneeuq contodneequ contodenque contodenqeu contodenuqe contodenueq contodeneuq contodenequ
contodeqnue contodeqneu contodequne contodequen contodeqeun contodeqenu contodeuqne contodeuqen contodeunqe contodeuneq
contodeuenq contodeueqn contodeequn contodeeqnu contodeeuqn contodeeunq contodeenuq contodeenqu contodqenue contodqeneu
contodqeune contodqeuen contodqeeun contodqeenu contodqneue contodqneeu contodqnuee contodqnuee contodqneue contodqneeu
contodqunee contodqunee contodquene contodqueen contodqueen contodquene contodqenue contodqeneu contodqeune contodqeuen
contodqeeun contodqeenu contodueqne contodueqen contoduenqe contodueneq contodueenq contodueeqn contoduqene contoduqeen
contoduqnee contoduqnee contoduqene contoduqeen contodunqee contodunqee contoduneqe contoduneeq contoduneeq contoduneqe
contodueqne contodueqen contoduenqe contodueneq contodueenq contodueeqn contodeequn contodeeqnu contodeeuqn contodeeunq
contodeenuq contodeenqu contodeqeun contodeqenu contodequen contodequne contodeqnue contodeqneu contodeuqen contodeuqne
contodeueqn contodeuenq contodeuneq contodeunqe contodenque contodenqeu contodenuqe contodenueq contodeneuq contodenequ
contoednque contoednqeu contoednuqe contoednueq contoedneuq contoednequ contoedqnue contoedqneu contoedqune contoedquen
contoedqeun contoedqenu contoeduqne contoeduqen contoedunqe contoeduneq contoeduenq contoedueqn contoedequn contoedeqnu
contoedeuqn contoedeunq contoedenuq contoedenqu contoendque contoendqeu contoenduqe contoendueq contoendeuq contoendequ
contoenqdue contoenqdeu contoenqude contoenqued contoenqeud contoenqedu contoenuqde contoenuqed contoenudqe contoenudeq
contoenuedq contoenueqd contoenequd contoeneqdu contoeneuqd contoeneudq contoeneduq contoenedqu contoeqndue contoeqndeu
contoeqnude contoeqnued contoeqneud contoeqnedu contoeqdnue contoeqdneu contoeqdune contoeqduen contoeqdeun contoeqdenu
contoequdne contoequden contoequnde contoequned contoequend contoequedn contoeqedun contoeqednu contoeqeudn contoeqeund
contoeqenud contoeqendu contoeunqde contoeunqed contoeundqe contoeundeq contoeunedq contoeuneqd contoeuqnde contoeuqned
contoeuqdne contoeuqden contoeuqedn contoeuqend contoeudqne contoeudqen contoeudnqe contoeudneq contoeudenq contoeudeqn
contoeueqdn contoeueqnd contoeuedqn contoeuednq contoeuendq contoeuenqd contoeenqud contoeenqdu contoeenuqd contoeenudq
contoeenduq contoeendqu contoeeqnud contoeeqndu contoeeqund contoeequdn contoeeqdun contoeeqdnu contoeeuqnd contoeeuqdn
contoeeunqd contoeeundq contoeeudnq contoeeudqn contoeedqun contoeedqnu contoeeduqn contoeedunq contoeednuq contoeednqu
contoqdenue contoqdeneu contoqdeune contoqdeuen contoqdeeun contoqdeenu contoqdneue contoqdneeu contoqdnuee contoqdnuee
contoqdneue contoqdneeu contoqdunee contoqdunee contoqduene contoqdueen contoqdueen contoqduene contoqdenue contoqdeneu
contoqdeune contoqdeuen contoqdeeun contoqdeenu contoqednue contoqedneu contoqedune contoqeduen contoqedeun contoqedenu
contoqendue contoqendeu contoqenude contoqenued contoqeneud contoqenedu contoqeunde contoqeuned contoqeudne contoqeuden
contoqeuedn contoqeuend contoqeenud contoqeendu contoqeeund contoqeeudn contoqeedun contoqeednu contoqnedue contoqnedeu
contoqneude contoqneued contoqneeud contoqneedu contoqndeue contoqndeeu contoqnduee contoqnduee contoqndeue contoqndeeu
contoqnudee contoqnudee contoqnuede contoqnueed contoqnueed contoqnuede contoqnedue contoqnedeu contoqneude contoqneued
contoqneeud contoqneedu contoquende contoquened contoquedne contoqueden contoqueedn contoqueend contoqunede contoquneed
contoqundee contoqundee contoqunede contoquneed contoqudnee contoqudnee contoqudene contoqudeen contoqudeen contoqudene
contoquende contoquened contoquedne contoqueden contoqueedn contoqueend contoqeenud contoqeendu contoqeeund contoqeeudn
contoqeedun contoqeednu contoqeneud contoqenedu contoqenued contoqenude contoqendue contoqendeu contoqeuned contoqeunde
contoqeuend contoqeuedn contoqeuden contoqeudne contoqednue contoqedneu contoqedune contoqeduen contoqedeun contoqedenu
contoudeqne contoudeqen contoudenqe contoudeneq contoudeenq contoudeeqn contoudqene contoudqeen contoudqnee contoudqnee
contoudqene contoudqeen contoudnqee contoudnqee contoudneqe contoudneeq contoudneeq contoudneqe contoudeqne contoudeqen
contoudenqe contoudeneq contoudeenq contoudeeqn contouedqne contouedqen contouednqe contouedneq contouedenq contouedeqn
contoueqdne contoueqden contoueqnde contoueqned contoueqend contoueqedn contouenqde contouenqed contouendqe contouendeq
contouenedq contoueneqd contoueeqnd contoueeqdn contoueenqd contoueendq contoueednq contoueedqn contouqedne contouqeden
contouqende contouqened contouqeend contouqeedn contouqdene contouqdeen contouqdnee contouqdnee contouqdene contouqdeen
contouqndee contouqndee contouqnede contouqneed contouqneed contouqnede contouqedne contouqeden contouqende contouqened
contouqeend contouqeedn contouneqde contouneqed contounedqe contounedeq contouneedq contouneeqd contounqede contounqeed
contounqdee contounqdee contounqede contounqeed contoundqee contoundqee contoundeqe contoundeeq contoundeeq contoundeqe
contouneqde contouneqed contounedqe contounedeq contouneedq contouneeqd contoueeqnd contoueeqdn contoueenqd contoueendq
contoueednq contoueedqn contoueqend contoueqedn contoueqned contoueqnde contoueqdne contoueqden contouenqed contouenqde
contoueneqd contouenedq contouendeq contouendqe contouedqne contouedqen contouednqe contouedneq contouedenq contouedeqn
contoedequn contoedeqnu contoedeuqn contoedeunq contoedenuq contoedenqu contoedqeun contoedqenu contoedquen contoedqune
contoedqnue contoedqneu contoeduqen contoeduqne contoedueqn contoeduenq contoeduneq contoedunqe contoednque contoednqeu
contoednuqe contoednueq contoedneuq contoednequ contoeedqun contoeedqnu contoeeduqn contoeedunq contoeednuq contoeednqu
contoeeqdun contoeeqdnu contoeequdn contoeeqund contoeeqnud contoeeqndu contoeeuqdn contoeeuqnd contoeeudqn contoeeudnq
contoeeundq contoeeunqd contoeenqud contoeenqdu contoeenuqd contoeenudq contoeenduq contoeendqu contoeqedun contoeqednu
contoeqeudn contoeqeund contoeqenud contoeqendu contoeqdeun contoeqdenu contoeqduen contoeqdune contoeqdnue contoeqdneu
contoequden contoequdne contoequedn contoequend contoequned contoequnde contoeqndue contoeqndeu contoeqnude contoeqnued
contoeqneud contoeqnedu contoeueqdn contoeueqnd contoeuedqn contoeuednq contoeuendq contoeuenqd contoeuqedn contoeuqend
contoeuqden contoeuqdne contoeuqnde contoeuqned contoeudqen contoeudqne contoeudeqn contoeudenq contoeudneq contoeudnqe
contoeunqde contoeunqed contoeundqe contoeundeq contoeunedq contoeuneqd contoenequd contoeneqdu contoeneuqd contoeneudq
contoeneduq contoenedqu contoenqeud contoenqedu contoenqued contoenqude contoenqdue contoenqdeu contoenuqed contoenuqde
contoenueqd contoenuedq contoenudeq contoenudqe contoendque contoendqeu contoenduqe contoendueq contoendeuq contoendequ
contqndoeue contqndoeeu contqndouee contqndouee contqndoeue contqndoeeu contqndeoue contqndeoeu contqndeuoe contqndeueo
contqndeeuo contqndeeou contqndueoe contqndueeo contqnduoee contqnduoee contqndueoe contqndueeo contqndeeuo contqndeeou
contqndeueo contqndeuoe contqndeoue contqndeoeu contqnodeue contqnodeeu contqnoduee contqnoduee contqnodeue contqnodeeu
contqnoedue contqnoedeu contqnoeude contqnoeued contqnoeeud contqnoeedu contqnouede contqnoueed contqnoudee contqnoudee
contqnouede contqnoueed contqnoeeud contqnoeedu contqnoeued contqnoeude contqnoedue contqnoedeu contqneodue contqneodeu
contqneoude contqneoued contqneoeud contqneoedu contqnedoue contqnedoeu contqneduoe contqnedueo contqnedeuo contqnedeou
contqneudoe contqneudeo contqneuode contqneuoed contqneueod contqneuedo contqneeduo contqneedou contqneeudo contqneeuod
contqneeoud contqneeodu contqnuoede contqnuoeed contqnuodee contqnuodee contqnuoede contqnuoeed contqnueode contqnueoed
contqnuedoe contqnuedeo contqnueedo contqnueeod contqnudeoe contqnudeeo contqnudoee contqnudoee contqnudeoe contqnudeeo
contqnueedo contqnueeod contqnuedeo contqnuedoe contqnueode contqnueoed contqneoeud contqneoedu contqneoued contqneoude
contqneodue contqneodeu contqneeoud contqneeodu contqneeuod contqneeudo contqneeduo contqneedou contqneueod contqneuedo
contqneuoed contqneuode contqneudoe contqneudeo contqnedeuo contqnedeou contqnedueo contqneduoe contqnedoue contqnedoeu
contqdnoeue contqdnoeeu contqdnouee contqdnouee contqdnoeue contqdnoeeu contqdneoue contqdneoeu contqdneuoe contqdneueo
contqdneeuo contqdneeou contqdnueoe contqdnueeo contqdnuoee contqdnuoee contqdnueoe contqdnueeo contqdneeuo contqdneeou
contqdneueo contqdneuoe contqdneoue contqdneoeu contqdoneue contqdoneeu contqdonuee contqdonuee contqdoneue contqdoneeu
contqdoenue contqdoeneu contqdoeune contqdoeuen contqdoeeun contqdoeenu contqdouene contqdoueen contqdounee contqdounee
contqdouene contqdoueen contqdoeeun contqdoeenu contqdoeuen contqdoeune contqdoenue contqdoeneu contqdeonue contqdeoneu
contqdeoune contqdeouen contqdeoeun contqdeoenu contqdenoue contqdenoeu contqdenuoe contqdenueo contqdeneuo contqdeneou
contqdeunoe contqdeuneo contqdeuone contqdeuoen contqdeueon contqdeueno contqdeenuo contqdeenou contqdeeuno contqdeeuon
contqdeeoun contqdeeonu contqduoene contqduoeen contqduonee contqduonee contqduoene contqduoeen contqdueone contqdueoen
contqduenoe contqdueneo contqdueeno contqdueeon contqduneoe contqduneeo contqdunoee contqdunoee contqduneoe contqduneeo
contqdueeno contqdueeon contqdueneo contqduenoe contqdueone contqdueoen contqdeoeun contqdeoenu contqdeouen contqdeoune
contqdeonue contqdeoneu contqdeeoun contqdeeonu contqdeeuon contqdeeuno contqdeenuo contqdeenou contqdeueon contqdeueno
contqdeuoen contqdeuone contqdeunoe contqdeuneo contqdeneuo contqdeneou contqdenueo contqdenuoe contqdenoue contqdenoeu
contqodneue contqodneeu contqodnuee contqodnuee contqodneue contqodneeu contqodenue contqodeneu contqodeune contqodeuen
contqodeeun contqodeenu contqoduene contqodueen contqodunee contqodunee contqoduene contqodueen contqodeeun contqodeenu
contqodeuen contqodeune contqodenue contqodeneu contqondeue contqondeeu contqonduee contqonduee contqondeue contqondeeu
contqonedue contqonedeu contqoneude contqoneued contqoneeud contqoneedu contqonuede contqonueed contqonudee contqonudee
contqonuede contqonueed contqoneeud contqoneedu contqoneued contqoneude contqonedue contqonedeu contqoendue contqoendeu
contqoenude contqoenued contqoeneud contqoenedu contqoednue contqoedneu contqoedune contqoeduen contqoedeun contqoedenu
contqoeudne contqoeuden contqoeunde contqoeuned contqoeuend contqoeuedn contqoeedun contqoeednu contqoeeudn contqoeeund
contqoeenud contqoeendu contqounede contqouneed contqoundee contqoundee contqounede contqouneed contqouende contqouened
contqouedne contqoueden contqoueedn contqoueend contqoudene contqoudeen contqoudnee contqoudnee contqoudene contqoudeen
contqoueedn contqoueend contqoueden contqouedne contqouende contqouened contqoeneud contqoenedu contqoenued contqoenude
contqoendue contqoendeu contqoeenud contqoeendu contqoeeund contqoeeudn contqoeedun contqoeednu contqoeuend contqoeuedn
contqoeuned contqoeunde contqoeudne contqoeuden contqoedeun contqoedenu contqoeduen contqoedune contqoednue contqoedneu
contqedonue contqedoneu contqedoune contqedouen contqedoeun contqedoenu contqednoue contqednoeu contqednuoe contqednueo
contqedneuo contqedneou contqedunoe contqeduneo contqeduone contqeduoen contqedueon contqedueno contqedenuo contqedenou
contqedeuno contqedeuon contqedeoun contqedeonu contqeodnue contqeodneu contqeodune contqeoduen contqeodeun contqeodenu
contqeondue contqeondeu contqeonude contqeonued contqeoneud contqeonedu contqeounde contqeouned contqeoudne contqeouden
contqeouedn contqeouend contqeoenud contqeoendu contqeoeund contqeoeudn contqeoedun contqeoednu contqenodue contqenodeu
contqenoude contqenoued contqenoeud contqenoedu contqendoue contqendoeu contqenduoe contqendueo contqendeuo contqendeou
contqenudoe contqenudeo contqenuode contqenuoed contqenueod contqenuedo contqeneduo contqenedou contqeneudo contqeneuod
contqeneoud contqeneodu contqeuonde contqeuoned contqeuodne contqeuoden contqeuoedn contqeuoend contqeunode contqeunoed
contqeundoe contqeundeo contqeunedo contqeuneod contqeudnoe contqeudneo contqeudone contqeudoen contqeudeon contqeudeno
contqeuendo contqeuenod contqeuedno contqeuedon contqeueodn contqeueond contqeeonud contqeeondu contqeeound contqeeoudn
contqeeodun contqeeodnu contqeenoud contqeenodu contqeenuod contqeenudo contqeenduo contqeendou contqeeunod contqeeundo
contqeeuond contqeeuodn contqeeudon contqeeudno contqeednuo contqeednou contqeeduno contqeeduon contqeedoun contqeedonu
contqudoene contqudoeen contqudonee contqudonee contqudoene contqudoeen contqudeone contqudeoen contqudenoe contqudeneo
contqudeeno contqudeeon contqudneoe contqudneeo contqudnoee contqudnoee contqudneoe contqudneeo contqudeeno contqudeeon
contqudeneo contqudenoe contqudeone contqudeoen contquodene contquodeen contquodnee contquodnee contquodene contquodeen
contquoedne contquoeden contquoende contquoened contquoeend contquoeedn contquonede contquoneed contquondee contquondee
contquonede contquoneed contquoeend contquoeedn contquoened contquoende contquoedne contquoeden contqueodne contqueoden
contqueonde contqueoned contqueoend contqueoedn contquedone contquedoen contquednoe contquedneo contquedeno contquedeon
contquendoe contquendeo contquenode contquenoed contqueneod contquenedo contqueedno contqueedon contqueendo contqueenod
contqueeond contqueeodn contqunoede contqunoeed contqunodee contqunodee contqunoede contqunoeed contquneode contquneoed
contqunedoe contqunedeo contquneedo contquneeod contqundeoe contqundeeo contqundoee contqundoee contqundeoe contqundeeo
contquneedo contquneeod contqunedeo contqunedoe contquneode contquneoed contqueoend contqueoedn contqueoned contqueonde
contqueodne contqueoden contqueeond contqueeodn contqueenod contqueendo contqueedno contqueedon contqueneod contquenedo
contquenoed contquenode contquendoe contquendeo contquedeno contquedeon contquedneo contquednoe contquedone contquedoen
contqedoeun contqedoenu contqedouen contqedoune contqedonue contqedoneu contqedeoun contqedeonu contqedeuon contqedeuno
contqedenuo contqedenou contqedueon contqedueno contqeduoen contqeduone contqedunoe contqeduneo contqedneuo contqedneou
contqednueo contqednuoe contqednoue contqednoeu contqeodeun contqeodenu contqeoduen contqeodune contqeodnue contqeodneu
contqeoedun contqeoednu contqeoeudn contqeoeund contqeoenud contqeoendu contqeouedn contqeouend contqeouden contqeoudne
contqeounde contqeouned contqeoneud contqeonedu contqeonued contqeonude contqeondue contqeondeu contqeeodun contqeeodnu
contqeeoudn contqeeound contqeeonud contqeeondu contqeedoun contqeedonu contqeeduon contqeeduno contqeednuo contqeednou
contqeeudon contqeeudno contqeeuodn contqeeuond contqeeunod contqeeundo contqeenduo contqeendou contqeenudo contqeenuod
contqeenoud contqeenodu contqeuoedn contqeuoend contqeuoden contqeuodne contqeuonde contqeuoned contqeueodn contqeueond
contqeuedon contqeuedno contqeuendo contqeuenod contqeudeon contqeudeno contqeudoen contqeudone contqeudnoe contqeudneo
contqeunedo contqeuneod contqeundeo contqeundoe contqeunode contqeunoed contqenoeud contqenoedu contqenoued contqenoude
contqenodue contqenodeu contqeneoud contqeneodu contqeneuod contqeneudo contqeneduo contqenedou contqenueod contqenuedo
contqenuoed contqenuode contqenudoe contqenudeo contqendeuo contqendeou contqendueo contqenduoe contqendoue contqendoeu
contundoqee contundoqee contundoeqe contundoeeq contundoeeq contundoeqe contundqoee contundqoee contundqeoe contundqeeo
contundqeeo contundqeoe contundeqoe contundeqeo contundeoqe contundeoeq contundeeoq contundeeqo contundeqeo contundeqoe
contundeeqo contundeeoq contundeoeq contundeoqe contunodqee contunodqee contunodeqe contunodeeq contunodeeq contunodeqe
contunoqdee contunoqdee contunoqede contunoqeed contunoqeed contunoqede contunoeqde contunoeqed contunoedqe contunoedeq
contunoeedq contunoeeqd contunoeqed contunoeqde contunoeeqd contunoeedq contunoedeq contunoedqe contunqodee contunqodee
contunqoede contunqoeed contunqoeed contunqoede contunqdoee contunqdoee contunqdeoe contunqdeeo contunqdeeo contunqdeoe
contunqedoe contunqedeo contunqeode contunqeoed contunqeeod contunqeedo contunqedeo contunqedoe contunqeedo contunqeeod
contunqeoed contunqeode contuneoqde contuneoqed contuneodqe contuneodeq contuneoedq contuneoeqd contuneqode contuneqoed
contuneqdoe contuneqdeo contuneqedo contuneqeod contunedqoe contunedqeo contunedoqe contunedoeq contunedeoq contunedeqo
contuneeqdo contuneeqod contuneedqo contuneedoq contuneeodq contuneeoqd contuneoqed contuneoqde contuneoeqd contuneoedq
contuneodeq contuneodqe contuneqoed contuneqode contuneqeod contuneqedo contuneqdeo contuneqdoe contuneeqod contuneeqdo
contuneeoqd contuneeodq contuneedoq contuneedqo contunedqeo contunedqoe contunedeqo contunedeoq contunedoeq contunedoqe
contudnoqee contudnoqee contudnoeqe contudnoeeq contudnoeeq contudnoeqe contudnqoee contudnqoee contudnqeoe contudnqeeo
contudnqeeo contudnqeoe contudneqoe contudneqeo contudneoqe contudneoeq contudneeoq contudneeqo contudneqeo contudneqoe
contudneeqo contudneeoq contudneoeq contudneoqe contudonqee contudonqee contudoneqe contudoneeq contudoneeq contudoneqe
contudoqnee contudoqnee contudoqene contudoqeen contudoqeen contudoqene contudoeqne contudoeqen contudoenqe contudoeneq
contudoeenq contudoeeqn contudoeqen contudoeqne contudoeeqn contudoeenq contudoeneq contudoenqe contudqonee contudqonee
contudqoene contudqoeen contudqoeen contudqoene contudqnoee contudqnoee contudqneoe contudqneeo contudqneeo contudqneoe
contudqenoe contudqeneo contudqeone contudqeoen contudqeeon contudqeeno contudqeneo contudqenoe contudqeeno contudqeeon
contudqeoen contudqeone contudeoqne contudeoqen contudeonqe contudeoneq contudeoenq contudeoeqn contudeqone contudeqoen
contudeqnoe contudeqneo contudeqeno contudeqeon contudenqoe contudenqeo contudenoqe contudenoeq contudeneoq contudeneqo
contudeeqno contudeeqon contudeenqo contudeenoq contudeeonq contudeeoqn contudeoqen contudeoqne contudeoeqn contudeoenq
contudeoneq contudeonqe contudeqoen contudeqone contudeqeon contudeqeno contudeqneo contudeqnoe contudeeqon contudeeqno
contudeeoqn contudeeonq contudeenoq contudeenqo contudenqeo contudenqoe contudeneqo contudeneoq contudenoeq contudenoqe
contuodnqee contuodnqee contuodneqe contuodneeq contuodneeq contuodneqe contuodqnee contuodqnee contuodqene contuodqeen
contuodqeen contuodqene contuodeqne contuodeqen contuodenqe contuodeneq contuodeenq contuodeeqn contuodeqen contuodeqne
contuodeeqn contuodeenq contuodeneq contuodenqe contuondqee contuondqee contuondeqe contuondeeq contuondeeq contuondeqe
contuonqdee contuonqdee contuonqede contuonqeed contuonqeed contuonqede contuoneqde contuoneqed contuonedqe contuonedeq
contuoneedq contuoneeqd contuoneqed contuoneqde contuoneeqd contuoneedq contuonedeq contuonedqe contuoqndee contuoqndee
contuoqnede contuoqneed contuoqneed contuoqnede contuoqdnee contuoqdnee contuoqdene contuoqdeen contuoqdeen contuoqdene
contuoqedne contuoqeden contuoqende contuoqened contuoqeend contuoqeedn contuoqeden contuoqedne contuoqeedn contuoqeend
contuoqened contuoqende contuoenqde contuoenqed contuoendqe contuoendeq contuoenedq contuoeneqd contuoeqnde contuoeqned
contuoeqdne contuoeqden contuoeqedn contuoeqend contuoedqne contuoedqen contuoednqe contuoedneq contuoedenq contuoedeqn
contuoeeqdn contuoeeqnd contuoeedqn contuoeednq contuoeendq contuoeenqd contuoenqed contuoenqde contuoeneqd contuoenedq
contuoendeq contuoendqe contuoeqned contuoeqnde contuoeqend contuoeqedn contuoeqden contuoeqdne contuoeeqnd contuoeeqdn
contuoeenqd contuoeendq contuoeednq contuoeedqn contuoedqen contuoedqne contuoedeqn contuoedenq contuoedneq contuoednqe
contuqdonee contuqdonee contuqdoene contuqdoeen contuqdoeen contuqdoene contuqdnoee contuqdnoee contuqdneoe contuqdneeo
contuqdneeo contuqdneoe contuqdenoe contuqdeneo contuqdeone contuqdeoen contuqdeeon contuqdeeno contuqdeneo contuqdenoe
contuqdeeno contuqdeeon contuqdeoen contuqdeone contuqodnee contuqodnee contuqodene contuqodeen contuqodeen contuqodene
contuqondee contuqondee contuqonede contuqoneed contuqoneed contuqonede contuqoende contuqoened contuqoedne contuqoeden
contuqoeedn contuqoeend contuqoened contuqoende contuqoeend contuqoeedn contuqoeden contuqoedne contuqnodee contuqnodee
contuqnoede contuqnoeed contuqnoeed contuqnoede contuqndoee contuqndoee contuqndeoe contuqndeeo contuqndeeo contuqndeoe
contuqnedoe contuqnedeo contuqneode contuqneoed contuqneeod contuqneedo contuqnedeo contuqnedoe contuqneedo contuqneeod
contuqneoed contuqneode contuqeonde contuqeoned contuqeodne contuqeoden contuqeoedn contuqeoend contuqenode contuqenoed
contuqendoe contuqendeo contuqenedo contuqeneod contuqednoe contuqedneo contuqedone contuqedoen contuqedeon contuqedeno
contuqeendo contuqeenod contuqeedno contuqeedon contuqeeodn contuqeeond contuqeoned contuqeonde contuqeoend contuqeoedn
contuqeoden contuqeodne contuqenoed contuqenode contuqeneod contuqenedo contuqendeo contuqendoe contuqeenod contuqeendo
contuqeeond contuqeeodn contuqeedon contuqeedno contuqedneo contuqednoe contuqedeno contuqedeon contuqedoen contuqedone
contuedoqne contuedoqen contuedonqe contuedoneq contuedoenq contuedoeqn contuedqone contuedqoen contuedqnoe contuedqneo
contuedqeno contuedqeon contuednqoe contuednqeo contuednoqe contuednoeq contuedneoq contuedneqo contuedeqno contuedeqon
contuedenqo contuedenoq contuedeonq contuedeoqn contueodqne contueodqen contueodnqe contueodneq contueodenq contueodeqn
contueoqdne contueoqden contueoqnde contueoqned contueoqend contueoqedn contueonqde contueonqed contueondqe contueondeq
contueonedq contueoneqd contueoeqnd contueoeqdn contueoenqd contueoendq contueoednq contueoedqn contueqodne contueqoden
contueqonde contueqoned contueqoend contueqoedn contueqdone contueqdoen contueqdnoe contueqdneo contueqdeno contueqdeon
contueqndoe contueqndeo contueqnode contueqnoed contueqneod contueqnedo contueqedno contueqedon contueqendo contueqenod
contueqeond contueqeodn contuenoqde contuenoqed contuenodqe contuenodeq contuenoedq contuenoeqd contuenqode contuenqoed
contuenqdoe contuenqdeo contuenqedo contuenqeod contuendqoe contuendqeo contuendoqe contuendoeq contuendeoq contuendeqo
contueneqdo contueneqod contuenedqo contuenedoq contueneodq contueneoqd contueeoqnd contueeoqdn contueeonqd contueeondq
contueeodnq contueeodqn contueeqond contueeqodn contueeqnod contueeqndo contueeqdno contueeqdon contueenqod contueenqdo
contueenoqd contueenodq contueendoq contueendqo contueedqno contueedqon contueednqo contueednoq contueedonq contueedoqn
contuedoqen contuedoqne contuedoeqn contuedoenq contuedoneq contuedonqe contuedqoen contuedqone contuedqeon contuedqeno
contuedqneo contuedqnoe contuedeqon contuedeqno contuedeoqn contuedeonq contuedenoq contuedenqo contuednqeo contuednqoe
contuedneqo contuedneoq contuednoeq contuednoqe contueodqen contueodqne contueodeqn contueodenq contueodneq contueodnqe
contueoqden contueoqdne contueoqedn contueoqend contueoqned contueoqnde contueoeqdn contueoeqnd contueoedqn contueoednq
contueoendq contueoenqd contueonqed contueonqde contueoneqd contueonedq contueondeq contueondqe contueqoden contueqodne
contueqoedn contueqoend contueqoned contueqonde contueqdoen contueqdone contueqdeon contueqdeno contueqdneo contueqdnoe
contueqedon contueqedno contueqeodn contueqeond contueqenod contueqendo contueqndeo contueqndoe contueqnedo contueqneod
contueqnoed contueqnode contueeoqdn contueeoqnd contueeodqn contueeodnq contueeondq contueeonqd contueeqodn contueeqond
contueeqdon contueeqdno contueeqndo contueeqnod contueedqon contueedqno contueedoqn contueedonq contueednoq contueednqo
contueenqdo contueenqod contueendqo contueendoq contueenodq contueenoqd contuenoqed contuenoqde contuenoeqd contuenoedq
contuenodeq contuenodqe contuenqoed contuenqode contuenqeod contuenqedo contuenqdeo contuenqdoe contueneqod contueneqdo
contueneoqd contueneodq contuenedoq contuenedqo contuendqeo contuendqoe contuendeqo contuendeoq contuendoeq contuendoqe
contendoque contendoqeu contendouqe contendoueq contendoeuq contendoequ contendqoue contendqoeu contendquoe contendqueo
contendqeuo contendqeou contenduqoe contenduqeo contenduoqe contenduoeq contendueoq contendueqo contendequo contendeqou
contendeuqo contendeuoq contendeouq contendeoqu contenodque contenodqeu contenoduqe contenodueq contenodeuq contenodequ
contenoqdue contenoqdeu contenoqude contenoqued contenoqeud contenoqedu contenouqde contenouqed contenoudqe contenoudeq
contenouedq contenoueqd contenoequd contenoeqdu contenoeuqd contenoeudq contenoeduq contenoedqu contenqodue contenqodeu
contenqoude contenqoued contenqoeud contenqoedu contenqdoue contenqdoeu contenqduoe contenqdueo contenqdeuo contenqdeou
contenqudoe contenqudeo contenquode contenquoed contenqueod contenquedo contenqeduo contenqedou contenqeudo contenqeuod
contenqeoud contenqeodu contenuoqde contenuoqed contenuodqe contenuodeq contenuoedq contenuoeqd contenuqode contenuqoed
contenuqdoe contenuqdeo contenuqedo contenuqeod contenudqoe contenudqeo contenudoqe contenudoeq contenudeoq contenudeqo
contenueqdo contenueqod contenuedqo contenuedoq contenueodq contenueoqd conteneoqud conteneoqdu conteneouqd conteneoudq
conteneoduq conteneodqu conteneqoud conteneqodu contenequod contenequdo conteneqduo conteneqdou conteneuqod conteneuqdo
conteneuoqd conteneuodq conteneudoq conteneudqo contenedquo contenedqou conteneduqo conteneduoq contenedouq contenedoqu
contednoque contednoqeu contednouqe contednoueq contednoeuq contednoequ contednqoue contednqoeu contednquoe contednqueo
contednqeuo contednqeou contednuqoe contednuqeo contednuoqe contednuoeq contednueoq contednueqo contednequo contedneqou
contedneuqo contedneuoq contedneouq contedneoqu contedonque contedonqeu contedonuqe contedonueq contedoneuq contedonequ
contedoqnue contedoqneu contedoqune contedoquen contedoqeun contedoqenu contedouqne contedouqen contedounqe contedouneq
contedouenq contedoueqn contedoequn contedoeqnu contedoeuqn contedoeunq contedoenuq contedoenqu contedqonue contedqoneu
contedqoune contedqouen contedqoeun contedqoenu contedqnoue contedqnoeu contedqnuoe contedqnueo contedqneuo contedqneou
contedqunoe contedquneo contedquone contedquoen contedqueon contedqueno contedqenuo contedqenou contedqeuno contedqeuon
contedqeoun contedqeonu conteduoqne conteduoqen conteduonqe conteduoneq conteduoenq conteduoeqn conteduqone conteduqoen
conteduqnoe conteduqneo conteduqeno conteduqeon contedunqoe contedunqeo contedunoqe contedunoeq conteduneoq conteduneqo
contedueqno contedueqon conteduenqo conteduenoq contedueonq contedueoqn contedeoqun contedeoqnu contedeouqn contedeounq
contedeonuq contedeonqu contedeqoun contedeqonu contedequon contedequno contedeqnuo contedeqnou contedeuqon contedeuqno
contedeuoqn contedeuonq contedeunoq contedeunqo contedenquo contedenqou contedenuqo contedenuoq contedenouq contedenoqu
conteodnque conteodnqeu conteodnuqe conteodnueq conteodneuq conteodnequ conteodqnue conteodqneu conteodqune conteodquen
conteodqeun conteodqenu conteoduqne conteoduqen conteodunqe conteoduneq conteoduenq conteodueqn conteodequn conteodeqnu
conteodeuqn conteodeunq conteodenuq conteodenqu conteondque conteondqeu conteonduqe conteondueq conteondeuq conteondequ
conteonqdue conteonqdeu conteonqude conteonqued conteonqeud conteonqedu conteonuqde conteonuqed conteonudqe conteonudeq
conteonuedq conteonueqd conteonequd conteoneqdu conteoneuqd conteoneudq conteoneduq conteonedqu conteoqndue conteoqndeu
conteoqnude conteoqnued conteoqneud conteoqnedu conteoqdnue conteoqdneu conteoqdune conteoqduen conteoqdeun conteoqdenu
conteoqudne conteoquden conteoqunde conteoquned conteoquend conteoquedn conteoqedun conteoqednu conteoqeudn conteoqeund
conteoqenud conteoqendu conteounqde conteounqed conteoundqe conteoundeq conteounedq conteouneqd conteouqnde conteouqned
conteouqdne conteouqden conteouqedn conteouqend conteoudqne conteoudqen conteoudnqe conteoudneq conteoudenq conteoudeqn
conteoueqdn conteoueqnd conteouedqn conteouednq conteouendq conteouenqd conteoenqud conteoenqdu conteoenuqd conteoenudq
conteoenduq conteoendqu conteoeqnud conteoeqndu conteoeqund conteoequdn conteoeqdun conteoeqdnu conteoeuqnd conteoeuqdn
conteoeunqd conteoeundq conteoeudnq conteoeudqn conteoedqun conteoedqnu conteoeduqn conteoedunq conteoednuq conteoednqu
conteqdonue conteqdoneu conteqdoune conteqdouen conteqdoeun conteqdoenu conteqdnoue conteqdnoeu conteqdnuoe conteqdnueo
conteqdneuo conteqdneou conteqdunoe conteqduneo conteqduone conteqduoen conteqdueon conteqdueno conteqdenuo conteqdenou
conteqdeuno conteqdeuon conteqdeoun conteqdeonu conteqodnue conteqodneu conteqodune conteqoduen conteqodeun conteqodenu
conteqondue conteqondeu conteqonude conteqonued conteqoneud conteqonedu conteqounde conteqouned conteqoudne conteqouden
conteqouedn conteqouend conteqoenud conteqoendu conteqoeund conteqoeudn conteqoedun conteqoednu conteqnodue conteqnodeu
conteqnoude conteqnoued conteqnoeud conteqnoedu conteqndoue conteqndoeu conteqnduoe conteqndueo conteqndeuo conteqndeou
conteqnudoe conteqnudeo conteqnuode conteqnuoed conteqnueod conteqnuedo conteqneduo conteqnedou conteqneudo conteqneuod
conteqneoud conteqneodu contequonde contequoned contequodne contequoden contequoedn contequoend contequnode contequnoed
contequndoe contequndeo contequnedo contequneod contequdnoe contequdneo contequdone contequdoen contequdeon contequdeno
contequendo contequenod contequedno contequedon contequeodn contequeond conteqeonud conteqeondu conteqeound conteqeoudn
conteqeodun conteqeodnu conteqenoud conteqenodu conteqenuod conteqenudo conteqenduo conteqendou conteqeunod conteqeundo
conteqeuond conteqeuodn conteqeudon conteqeudno conteqednuo conteqednou conteqeduno conteqeduon conteqedoun conteqedonu
conteudoqne conteudoqen conteudonqe conteudoneq conteudoenq conteudoeqn conteudqone conteudqoen conteudqnoe conteudqneo
conteudqeno conteudqeon conteudnqoe conteudnqeo conteudnoqe conteudnoeq conteudneoq conteudneqo conteudeqno conteudeqon
conteudenqo conteudenoq conteudeonq conteudeoqn conteuodqne conteuodqen conteuodnqe conteuodneq conteuodenq conteuodeqn
conteuoqdne conteuoqden conteuoqnde conteuoqned conteuoqend conteuoqedn conteuonqde conteuonqed conteuondqe conteuondeq
conteuonedq conteuoneqd conteuoeqnd conteuoeqdn conteuoenqd conteuoendq conteuoednq conteuoedqn conteuqodne conteuqoden
conteuqonde conteuqoned conteuqoend conteuqoedn conteuqdone conteuqdoen conteuqdnoe conteuqdneo conteuqdeno conteuqdeon
conteuqndoe conteuqndeo conteuqnode conteuqnoed conteuqneod conteuqnedo conteuqedno conteuqedon conteuqendo conteuqenod
conteuqeond conteuqeodn conteunoqde conteunoqed conteunodqe conteunodeq conteunoedq conteunoeqd conteunqode conteunqoed
conteunqdoe conteunqdeo conteunqedo conteunqeod conteundqoe conteundqeo conteundoqe conteundoeq conteundeoq conteundeqo
conteuneqdo conteuneqod conteunedqo conteunedoq conteuneodq conteuneoqd conteueoqnd conteueoqdn conteueonqd conteueondq
conteueodnq conteueodqn conteueqond conteueqodn conteueqnod conteueqndo conteueqdno conteueqdon conteuenqod conteuenqdo
conteuenoqd conteuenodq conteuendoq conteuendqo conteuedqno conteuedqon conteuednqo conteuednoq conteuedonq conteuedoqn
conteedoqun conteedoqnu conteedouqn conteedounq conteedonuq conteedonqu conteedqoun conteedqonu conteedquon conteedquno
conteedqnuo conteedqnou conteeduqon conteeduqno conteeduoqn conteeduonq conteedunoq conteedunqo conteednquo conteednqou
conteednuqo conteednuoq conteednouq conteednoqu conteeodqun conteeodqnu conteeoduqn conteeodunq conteeodnuq conteeodnqu
conteeoqdun conteeoqdnu conteeoqudn conteeoqund conteeoqnud conteeoqndu conteeouqdn conteeouqnd conteeoudqn conteeoudnq
conteeoundq conteeounqd conteeonqud conteeonqdu conteeonuqd conteeonudq conteeonduq conteeondqu conteeqodun conteeqodnu
conteeqoudn conteeqound conteeqonud conteeqondu conteeqdoun conteeqdonu conteeqduon conteeqduno conteeqdnuo conteeqdnou
conteequdon conteequdno conteequodn conteequond conteequnod conteequndo conteeqnduo conteeqndou conteeqnudo conteeqnuod
conteeqnoud conteeqnodu conteeuoqdn conteeuoqnd conteeuodqn conteeuodnq conteeuondq conteeuonqd conteeuqodn conteeuqond
conteeuqdon conteeuqdno conteeuqndo conteeuqnod conteeudqon conteeudqno conteeudoqn conteeudonq conteeudnoq conteeudnqo
conteeunqdo conteeunqod conteeundqo conteeundoq conteeunodq conteeunoqd conteenoqud conteenoqdu conteenouqd conteenoudq
conteenoduq conteenodqu conteenqoud conteenqodu conteenquod conteenqudo conteenqduo conteenqdou conteenuqod conteenuqdo
conteenuoqd conteenuodq conteenudoq conteenudqo conteendquo conteendqou conteenduqo conteenduoq conteendouq conteendoqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us