easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

uncustomarily

cryogenically

abroma

ascorbata

nonallegation

indevotional

gomorrha

reappearing

raphaelic

unerasable

persequebantur

fallcreek

sobeaux

pcmark

phlebolithic

dropt

vedette

saevi


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: conquireturque
cipher variations:
dporvjsfuvsrvf eqpswktgvwtswg frqtxluhwxutxh gsruymvixyvuyi htsvznwjyzwvzj
iutwaoxkzaxwak jvuxbpylabyxbl kwvycqzmbczycm lxwzdrancdazdn myxaesbodebaeo
nzybftcpefcbfp oazcgudqfgdcgq pbadhverghedhr qcbeiwfshifeis rdcfjxgtijgfjt
sedgkyhujkhgku tfehlzivklihlv ugfimajwlmjimw vhgjnbkxmnkjnx wihkoclynolkoy
xjilpdmzopmlpz ykjmqenapqnmqa zlknrfobqronrb amlosgpcrsposc bnmpthqdstqptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: conquireturque
Cipher: xlmjfrivgfijfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: conquireturque
Cipher: AAABA ABBAB ABBAA ABBBB BAABB ABAAA BAAAA AABAA BAABA BAABB BAAAA ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: conquireturque
cipher variations:
dporvjsfuvsrvfhroxjzangjaxjnltodxpivsxidxvpvojlfqdelqjldtxopzvylqzypzlxzovnlgtcngvntfdohprwjapwhpjjfondhermdendr
nhotrxmzyrmtrzrjozfnuhkfuzfhvloftdcpwtcftpznolhtkxihklhxeqpswktgvwtswgispykabohkbykomupeyqjwtyjeywqwpkmgrefmrkme
uypqawzmrazqamyapwomhudohwougepiqsxkbqxiqkkgpoeifsnefoesoipusynazsnusaskpagovilgvagiwmpguedqxudguqaopmiulyjilmiy
frqtxluhwxutxhjtqzlbcpilczlpnvqfzrkxuzkfzxrxqlnhsfgnslnfvzqrbxansbarbnzbqxpnivepixpvhfqjrtylcryjrllhqpfjgtofgpft
pjqvtzobatovtbtlqbhpwjmhwbhjxnqhvferyvehvrbpqnjvmzkjmnjzgsruymvixyvuyikuramcdqjmdamqowrgaslyvalgaysyrmoitghotmog
warscybotcbscoacryqojwfqjyqwigrksuzmdszksmmirqgkhupghqguqkrwuapcbupwucumrciqxknixcikyoriwgfszwfiwscqrokwnalknoka
htsvznwjyzwvzjlvsbnderknebnrpxshbtmzwbmhbztzsnpjuhipunphxbstdzcpudctdpbdszrpkxgrkzrxjhsltvanetaltnnjsrhlivqhirhv
rlsxvbqdcvqxvdvnsdjrylojydjlzpsjxhgtaxgjxtdrsplxobmloplbiutwaoxkzaxwakmwtcoefslofcosqyticunaxcnicauatoqkvijqvoqi
yctueadqvedueqcetasqlyhslasykitmuwbofubmuooktsimjwrijsiwsmtywcredwrywewotekszmpkzekmaqtkyihubyhkyuestqmypcnmpqmc
jvuxbpylabyxblnxudpfgtmpgdptrzujdvobydojdbvbuprlwjkrwprjzduvfberwfevfrdfubtrmzitmbtzljunvxcpgvcnvpplutjnkxsjktjx
tnuzxdsfexszxfxpufltanqlaflnbrulzjivczilzvfturnzqdonqrndkwvycqzmbczycmoyveqghunqhequsavkewpczepkecwcvqsmxklsxqsk
aevwgcfsxgfwgsegvcusnajuncuamkvowydqhwdowqqmvukolytklukyuovayetgfytaygyqvgmubormbgmocsvmakjwdajmawguvsoareporsoe
lxwzdrancdazdnpzwfrhivorifrvtbwlfxqdafqlfdxdwrtnylmtyrtlbfwxhdgtyhgxhtfhwdvtobkvodvbnlwpxzerixepxrrnwvlpmzulmvlz
vpwbzfuhgzubzhzrwhnvcpsnchnpdtwnblkxebknbxhvwtpbsfqpstpfmyxaesbodebaeoqaxgsijwpsjgswucxmgyrebgrmgeyexsuozmnuzsum
cgxyiehuzihyiugixewupclwpewcomxqyafsjyfqyssoxwmqnavmnwmawqxcagvihavcaiasxiowdqtodioqeuxocmlyfclocyiwxuqctgrqtuqg
nzybftcpefcbfprbyhtjkxqtkhtxvdynhzsfchsnhfzfytvpanovatvndhyzjfivajizjvhjyfxvqdmxqfxdpnyrzbgtkzgrzttpyxnrobwnoxnb
xrydbhwjibwdbjbtyjpxerupejprfvypdnmzgdmpdzjxyvrduhsruvrhoazcgudqfgdcgqscziuklyruliuywezoiatgditoigagzuwqbopwbuwo
eizakgjwbkjakwikzgywrenyrgyeqozsachulahsauuqzyospcxopyocyszecixkjcxeckcuzkqyfsvqfkqsgwzqeonahenqeakyzwsevitsvwsi
pbadhverghedhrtdajvlmzsvmjvzxfapjbuhejupjhbhavxrcpqxcvxpfjablhkxclkblxjlahzxsfozshzfrpatbdivmbitbvvrazptqdypqzpd
ztafdjylkdyfdldvalrzgtwrglrthxarfpobiforfblzaxtfwjutwxtjqcbeiwfshifeisuebkwmnatwnkwaygbqkcvifkvqkicibwysdqrydwyq
gkbcmilydmlcmykmbiaytgpatiagsqbucejwncjucwwsbaqurezqraqeaubgekzmlezgemewbmsahuxshmsuiybsgqpcjgpsgcmabyugxkvuxyuk
rdcfjxgtijgfjtvfclxnobuxolxbzhcrldwjglwrljdjcxzterszexzrhlcdnjmzenmdnzlncjbzuhqbujbhtrcvdfkxodkvdxxtcbrvsfarsbrf
bvchflanmfahfnfxcntbivytintvjzcthrqdkhqthdnbczvhylwvyzvlsedgkyhujkhgkuwgdmyopcvypmycaidsmexkhmxsmkekdyaufstafyas
imdeoknafoneoamodkcavircvkciusdweglypelweyyudcswtgbstcsgcwdigmbongbigogydoucjwzujouwkaduisreliruieocdawizmxwzawm
tfehlzivklihlvxhenzpqdwzqnzdbjetnfylinytnlflezbvgtubgzbtjnefplobgpofpbnpeldbwjsdwldjvtexfhmzqfmxfzzvedtxuhctudth
dxejhncpohcjhphzepvdkxavkpvxlbevjtsfmjsvjfpdebxjanyxabxnugfimajwlmjimwyifoaqrexaroaeckfuogzmjozuomgmfacwhuvchacu
kofgqmpchqpgqcoqfmecxktexmekwufyginargnygaawfeuyviduveuieyfkiodqpidkiqiafqwelybwlqwymcfwkutgnktwkgqefcykbozybcyo
vhgjnbkxmnkjnxzjgpbrsfybspbfdlgvphankpavpnhngbdxivwdibdvlpghrnqdirqhrdprgnfdylufynflxvgzhjobshozhbbxgfvzwjevwfvj
fzgljperqjeljrjbgrxfmzcxmrxzndgxlvuholuxlhrfgdzlcpazcdzpwihkoclynolkoyakhqcstgzctqcgemhwqibolqbwqoiohceyjwxejcew
mqhisorejsriseqshogezmvgzogmywhaikpctipaiccyhgwaxkfwxgwkgahmkqfsrkfmkskchsygnadynsyaoehymwvipmvymisgheamdqbadeaq
xjilpdmzopmlpzblirdtuhadurdhfnixrjcpmrcxrpjpidfzkxyfkdfxnrijtpsfktsjtfrtiphfanwhaphnzxibjlqdujqbjddzihxbylgxyhxl
hbinlrgtslgnltlditzhobezotzbpfiznxwjqnwznjthifbnercbefbrykjmqenapqnmqacmjseuvibevseigojyskdqnsdysqkqjegalyzglegy
osjkuqtglutkugsujqigboxibqioayjckmrevkrckeeajiyczmhyziymicjomshutmhomumejuaipcfapuacqgjaoyxkroxaokuijgcofsdcfgcs
zlknrfobqronrbdnktfvwjcfwtfjhpkztleroteztrlrkfhbmzahmfhzptklvruhmvulvhtvkrjhcpyjcrjpbzkdlnsfwlsdlffbkjzdanizajzn
jdkpntivunipnvnfkvbjqdgbqvbdrhkbpzylspybplvjkhdpgtedghdtamlosgpcrsposceolugwxkdgxugkiqlaumfspufausmslgicnabingia
qulmwsvinwvmwiuwlskidqzkdskqcalemotgxmtemggclkaebojabkaokelqoujwvojqowoglwckrehcrwcesilcqazmtqzcqmwklieqhufehieu
bnmpthqdstqptdfpmvhxylehyvhljrmbvngtqvgbvtntmhjdobcjohjbrvmnxtwjoxwnxjvxmtljeraletlrdbmfnpuhynufnhhdmlbfcpkbclbp
lfmrpvkxwpkrpxphmxdlsfidsxdftjmdrbanuradrnxlmjfrivgfijfvconquireturquegqnwiyzmfizwimksncwohurwhcwuounikepcdkpikc
swnoyuxkpyxoykwynumkfsbmfumsecngoqvizovgoiienmcgdqlcdmcqmgnsqwlyxqlsqyqinyemtgjetyeguknescbovsbesoymnkgsjwhgjkgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: conquireturque
Cipher: pbadhverghedhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: conquireturque
Cipher: 3143331454422451445424145451

Extended Methods:
Method #1

Plaintext: conquireturque
method variations:
htsvzowkyzwvzknyxaetbpdebaepsdcfkyguikgfkuxihlpdmzopmlpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
c o n q u i r e t u r q u e 
3 4 3 1 5 4 2 5 4 5 2 1 5 5 
1 3 3 4 4 2 4 1 4 4 4 4 4 1 
They are then read out in rows:
3431542545215513344241444441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: conquireturque
Cipher: scuwybzlsidttd

Read more ...
Method #3

Plaintext: conquireturque
method variations:
qncytgyqyidyyl ncytgyqyidyylq cytgyqyidyylqn
ytgyqyidyylqnc tgyqyidyylqncy gyqyidyylqncyt
yqyidyylqncytg qyidyylqncytgy yidyylqncytgyq
idyylqncytgyqy dyylqncytgyqyi yylqncytgyqyid
ylqncytgyqyidy lqncytgyqyidyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: conquireturque

first 5040 cipher variations(86661001946 total)
conquireturque conquireturqeu conquireturuqe conquireturueq conquiretureuq conquireturequ conquiretuqrue conquiretuqreu
conquiretuqure conquiretuquer conquiretuqeur conquiretuqeru conquiretuuqre conquiretuuqer conquiretuurqe conquiretuureq
conquiretuuerq conquiretuueqr conquiretuequr conquiretueqru conquiretueuqr conquiretueurq conquiretueruq conquiretuerqu
conquiretruque conquiretruqeu conquiretruuqe conquiretruueq conquiretrueuq conquiretruequ conquiretrquue conquiretrqueu
conquiretrquue conquiretrqueu conquiretrqeuu conquiretrqeuu conquiretruque conquiretruqeu conquiretruuqe conquiretruueq
conquiretrueuq conquiretruequ conquiretrequu conquiretrequu conquiretreuqu conquiretreuuq conquiretreuuq conquiretreuqu
conquiretqruue conquiretqrueu conquiretqruue conquiretqrueu conquiretqreuu conquiretqreuu conquiretqurue conquiretqureu
conquiretquure conquiretquuer conquiretqueur conquiretqueru conquiretquure conquiretquuer conquiretqurue conquiretqureu
conquiretqueru conquiretqueur conquiretqeuur conquiretqeuru conquiretqeuur conquiretqeuru conquiretqeruu conquiretqeruu
conquireturque conquireturqeu conquireturuqe conquireturueq conquiretureuq conquireturequ conquiretuqrue conquiretuqreu
conquiretuqure conquiretuquer conquiretuqeur conquiretuqeru conquiretuuqre conquiretuuqer conquiretuurqe conquiretuureq
conquiretuuerq conquiretuueqr conquiretuequr conquiretueqru conquiretueuqr conquiretueurq conquiretueruq conquiretuerqu
conquireterquu conquireterquu conquireteruqu conquireteruuq conquireteruuq conquireteruqu conquireteqruu conquireteqruu
conquiretequru conquiretequur conquiretequur conquiretequru conquireteuqru conquireteuqur conquireteurqu conquireteuruq
conquireteuurq conquireteuuqr conquireteuqur conquireteuqru conquireteuuqr conquireteuurq conquireteuruq conquireteurqu
conquireutrque conquireutrqeu conquireutruqe conquireutrueq conquireutreuq conquireutrequ conquireutqrue conquireutqreu
conquireutqure conquireutquer conquireutqeur conquireutqeru conquireutuqre conquireutuqer conquireuturqe conquireutureq
conquireutuerq conquireutueqr conquireutequr conquireuteqru conquireuteuqr conquireuteurq conquireuteruq conquireuterqu
conquireurtque conquireurtqeu conquireurtuqe conquireurtueq conquireurteuq conquireurtequ conquireurqtue conquireurqteu
conquireurqute conquireurquet conquireurqeut conquireurqetu conquireuruqte conquireuruqet conquireurutqe conquireuruteq
conquireuruetq conquireurueqt conquireurequt conquireureqtu conquireureuqt conquireureutq conquireuretuq conquireuretqu
conquireuqrtue conquireuqrteu conquireuqrute conquireuqruet conquireuqreut conquireuqretu conquireuqtrue conquireuqtreu
conquireuqture conquireuqtuer conquireuqteur conquireuqteru conquireuqutre conquireuquter conquireuqurte conquireuquret
conquireuquert conquireuquetr conquireuqetur conquireuqetru conquireuqeutr conquireuqeurt conquireuqerut conquireuqertu
conquireuurqte conquireuurqet conquireuurtqe conquireuurteq conquireuuretq conquireuureqt conquireuuqrte conquireuuqret
conquireuuqtre conquireuuqter conquireuuqetr conquireuuqert conquireuutqre conquireuutqer conquireuutrqe conquireuutreq
conquireuuterq conquireuuteqr conquireuueqtr conquireuueqrt conquireuuetqr conquireuuetrq conquireuuertq conquireuuerqt
conquireuerqut conquireuerqtu conquireueruqt conquireuerutq conquireuertuq conquireuertqu conquireueqrut conquireueqrtu
conquireuequrt conquireuequtr conquireueqtur conquireueqtru conquireueuqrt conquireueuqtr conquireueurqt conquireueurtq
conquireueutrq conquireueutqr conquireuetqur conquireuetqru conquireuetuqr conquireueturq conquireuetruq conquireuetrqu
conquirerutque conquirerutqeu conquirerutuqe conquirerutueq conquireruteuq conquirerutequ conquireruqtue conquireruqteu
conquireruqute conquireruquet conquireruqeut conquireruqetu conquireruuqte conquireruuqet conquireruutqe conquireruuteq
conquireruuetq conquireruueqt conquireruequt conquirerueqtu conquirerueuqt conquirerueutq conquireruetuq conquireruetqu
conquirertuque conquirertuqeu conquirertuuqe conquirertuueq conquirertueuq conquirertuequ conquirertquue conquirertqueu
conquirertquue conquirertqueu conquirertqeuu conquirertqeuu conquirertuque conquirertuqeu conquirertuuqe conquirertuueq
conquirertueuq conquirertuequ conquirertequu conquirertequu conquirerteuqu conquirerteuuq conquirerteuuq conquirerteuqu
conquirerqtuue conquirerqtueu conquirerqtuue conquirerqtueu conquirerqteuu conquirerqteuu conquirerqutue conquirerquteu
conquirerquute conquirerquuet conquirerqueut conquirerquetu conquirerquute conquirerquuet conquirerqutue conquirerquteu
conquirerquetu conquirerqueut conquirerqeuut conquirerqeutu conquirerqeuut conquirerqeutu conquirerqetuu conquirerqetuu
conquirerutque conquirerutqeu conquirerutuqe conquirerutueq conquireruteuq conquirerutequ conquireruqtue conquireruqteu
conquireruqute conquireruquet conquireruqeut conquireruqetu conquireruuqte conquireruuqet conquireruutqe conquireruuteq
conquireruuetq conquireruueqt conquireruequt conquirerueqtu conquirerueuqt conquirerueutq conquireruetuq conquireruetqu
conquireretquu conquireretquu conquireretuqu conquireretuuq conquireretuuq conquireretuqu conquirereqtuu conquirereqtuu
conquirerequtu conquirerequut conquirerequut conquirerequtu conquirereuqtu conquirereuqut conquirereutqu conquirereutuq
conquirereuutq conquirereuuqt conquirereuqut conquirereuqtu conquirereuuqt conquirereuutq conquirereutuq conquirereutqu
conquirequrtue conquirequrteu conquirequrute conquirequruet conquirequreut conquirequretu conquirequtrue conquirequtreu
conquirequture conquirequtuer conquirequteur conquirequteru conquirequutre conquirequuter conquirequurte conquirequuret
conquirequuert conquirequuetr conquirequetur conquirequetru conquirequeutr conquirequeurt conquirequerut conquirequertu
conquireqrutue conquireqruteu conquireqruute conquireqruuet conquireqrueut conquireqruetu conquireqrtuue conquireqrtueu
conquireqrtuue conquireqrtueu conquireqrteuu conquireqrteuu conquireqrutue conquireqruteu conquireqruute conquireqruuet
conquireqrueut conquireqruetu conquireqretuu conquireqretuu conquireqreutu conquireqreuut conquireqreuut conquireqreutu
conquireqtruue conquireqtrueu conquireqtruue conquireqtrueu conquireqtreuu conquireqtreuu conquireqturue conquireqtureu
conquireqtuure conquireqtuuer conquireqtueur conquireqtueru conquireqtuure conquireqtuuer conquireqturue conquireqtureu
conquireqtueru conquireqtueur conquireqteuur conquireqteuru conquireqteuur conquireqteuru conquireqteruu conquireqteruu
conquirequrtue conquirequrteu conquirequrute conquirequruet conquirequreut conquirequretu conquirequtrue conquirequtreu
conquirequture conquirequtuer conquirequteur conquirequteru conquirequutre conquirequuter conquirequurte conquirequuret
conquirequuert conquirequuetr conquirequetur conquirequetru conquirequeutr conquirequeurt conquirequerut conquirequertu
conquireqertuu conquireqertuu conquireqerutu conquireqeruut conquireqeruut conquireqerutu conquireqetruu conquireqetruu
conquireqeturu conquireqetuur conquireqetuur conquireqeturu conquireqeutru conquireqeutur conquireqeurtu conquireqeurut
conquireqeuurt conquireqeuutr conquireqeutur conquireqeutru conquireqeuutr conquireqeuurt conquireqeurut conquireqeurtu
conquireuurqte conquireuurqet conquireuurtqe conquireuurteq conquireuuretq conquireuureqt conquireuuqrte conquireuuqret
conquireuuqtre conquireuuqter conquireuuqetr conquireuuqert conquireuutqre conquireuutqer conquireuutrqe conquireuutreq
conquireuuterq conquireuuteqr conquireuueqtr conquireuueqrt conquireuuetqr conquireuuetrq conquireuuertq conquireuuerqt
conquireuruqte conquireuruqet conquireurutqe conquireuruteq conquireuruetq conquireurueqt conquireurqute conquireurquet
conquireurqtue conquireurqteu conquireurqetu conquireurqeut conquireurtque conquireurtqeu conquireurtuqe conquireurtueq
conquireurteuq conquireurtequ conquireureqtu conquireurequt conquireuretqu conquireuretuq conquireureutq conquireureuqt
conquireuqrute conquireuqruet conquireuqrtue conquireuqrteu conquireuqretu conquireuqreut conquireuqurte conquireuquret
conquireuqutre conquireuquter conquireuquetr conquireuquert conquireuqture conquireuqtuer conquireuqtrue conquireuqtreu
conquireuqteru conquireuqteur conquireuqeutr conquireuqeurt conquireuqetur conquireuqetru conquireuqertu conquireuqerut
conquireutrque conquireutrqeu conquireutruqe conquireutrueq conquireutreuq conquireutrequ conquireutqrue conquireutqreu
conquireutqure conquireutquer conquireutqeur conquireutqeru conquireutuqre conquireutuqer conquireuturqe conquireutureq
conquireutuerq conquireutueqr conquireutequr conquireuteqru conquireuteuqr conquireuteurq conquireuteruq conquireuterqu
conquireuerqtu conquireuerqut conquireuertqu conquireuertuq conquireuerutq conquireueruqt conquireueqrtu conquireueqrut
conquireueqtru conquireueqtur conquireuequtr conquireuequrt conquireuetqru conquireuetqur conquireuetrqu conquireuetruq
conquireueturq conquireuetuqr conquireueuqtr conquireueuqrt conquireueutqr conquireueutrq conquireueurtq conquireueurqt
conquireeurqut conquireeurqtu conquireeuruqt conquireeurutq conquireeurtuq conquireeurtqu conquireeuqrut conquireeuqrtu
conquireeuqurt conquireeuqutr conquireeuqtur conquireeuqtru conquireeuuqrt conquireeuuqtr conquireeuurqt conquireeuurtq
conquireeuutrq conquireeuutqr conquireeutqur conquireeutqru conquireeutuqr conquireeuturq conquireeutruq conquireeutrqu
conquireeruqut conquireeruqtu conquireeruuqt conquireeruutq conquireerutuq conquireerutqu conquireerquut conquireerqutu
conquireerquut conquireerqutu conquireerqtuu conquireerqtuu conquireeruqut conquireeruqtu conquireeruuqt conquireeruutq
conquireerutuq conquireerutqu conquireertquu conquireertquu conquireertuqu conquireertuuq conquireertuuq conquireertuqu
conquireeqruut conquireeqrutu conquireeqruut conquireeqrutu conquireeqrtuu conquireeqrtuu conquireequrut conquireequrtu
conquireequurt conquireequutr conquireequtur conquireequtru conquireequurt conquireequutr conquireequrut conquireequrtu
conquireequtru conquireequtur conquireeqtuur conquireeqturu conquireeqtuur conquireeqturu conquireeqtruu conquireeqtruu
conquireeurqut conquireeurqtu conquireeuruqt conquireeurutq conquireeurtuq conquireeurtqu conquireeuqrut conquireeuqrtu
conquireeuqurt conquireeuqutr conquireeuqtur conquireeuqtru conquireeuuqrt conquireeuuqtr conquireeuurqt conquireeuurtq
conquireeuutrq conquireeuutqr conquireeutqur conquireeutqru conquireeutuqr conquireeuturq conquireeutruq conquireeutrqu
conquireetrquu conquireetrquu conquireetruqu conquireetruuq conquireetruuq conquireetruqu conquireetqruu conquireetqruu
conquireetquru conquireetquur conquireetquur conquireetquru conquireetuqru conquireetuqur conquireeturqu conquireeturuq
conquireetuurq conquireetuuqr conquireetuqur conquireetuqru conquireetuuqr conquireetuurq conquireeturuq conquireeturqu
conquirteurque conquirteurqeu conquirteuruqe conquirteurueq conquirteureuq conquirteurequ conquirteuqrue conquirteuqreu
conquirteuqure conquirteuquer conquirteuqeur conquirteuqeru conquirteuuqre conquirteuuqer conquirteuurqe conquirteuureq
conquirteuuerq conquirteuueqr conquirteuequr conquirteueqru conquirteueuqr conquirteueurq conquirteueruq conquirteuerqu
conquirteruque conquirteruqeu conquirteruuqe conquirteruueq conquirterueuq conquirteruequ conquirterquue conquirterqueu
conquirterquue conquirterqueu conquirterqeuu conquirterqeuu conquirteruque conquirteruqeu conquirteruuqe conquirteruueq
conquirterueuq conquirteruequ conquirterequu conquirterequu conquirtereuqu conquirtereuuq conquirtereuuq conquirtereuqu
conquirteqruue conquirteqrueu conquirteqruue conquirteqrueu conquirteqreuu conquirteqreuu conquirtequrue conquirtequreu
conquirtequure conquirtequuer conquirtequeur conquirtequeru conquirtequure conquirtequuer conquirtequrue conquirtequreu
conquirtequeru conquirtequeur conquirteqeuur conquirteqeuru conquirteqeuur conquirteqeuru conquirteqeruu conquirteqeruu
conquirteurque conquirteurqeu conquirteuruqe conquirteurueq conquirteureuq conquirteurequ conquirteuqrue conquirteuqreu
conquirteuqure conquirteuquer conquirteuqeur conquirteuqeru conquirteuuqre conquirteuuqer conquirteuurqe conquirteuureq
conquirteuuerq conquirteuueqr conquirteuequr conquirteueqru conquirteueuqr conquirteueurq conquirteueruq conquirteuerqu
conquirteerquu conquirteerquu conquirteeruqu conquirteeruuq conquirteeruuq conquirteeruqu conquirteeqruu conquirteeqruu
conquirteequru conquirteequur conquirteequur conquirteequru conquirteeuqru conquirteeuqur conquirteeurqu conquirteeuruq
conquirteeuurq conquirteeuuqr conquirteeuqur conquirteeuqru conquirteeuuqr conquirteeuurq conquirteeuruq conquirteeurqu
conquirtuerque conquirtuerqeu conquirtueruqe conquirtuerueq conquirtuereuq conquirtuerequ conquirtueqrue conquirtueqreu
conquirtuequre conquirtuequer conquirtueqeur conquirtueqeru conquirtueuqre conquirtueuqer conquirtueurqe conquirtueureq
conquirtueuerq conquirtueueqr conquirtueequr conquirtueeqru conquirtueeuqr conquirtueeurq conquirtueeruq conquirtueerqu
conquirtureque conquirtureqeu conquirtureuqe conquirtureueq conquirtureeuq conquirtureequ conquirturqeue conquirturqeeu
conquirturquee conquirturquee conquirturqeue conquirturqeeu conquirturuqee conquirturuqee conquirturueqe conquirturueeq
conquirturueeq conquirturueqe conquirtureque conquirtureqeu conquirtureuqe conquirtureueq conquirtureeuq conquirtureequ
conquirtuqreue conquirtuqreeu conquirtuqruee conquirtuqruee conquirtuqreue conquirtuqreeu conquirtuqerue conquirtuqereu
conquirtuqeure conquirtuqeuer conquirtuqeeur conquirtuqeeru conquirtuquere conquirtuqueer conquirtuquree conquirtuquree
conquirtuquere conquirtuqueer conquirtuqeeur conquirtuqeeru conquirtuqeuer conquirtuqeure conquirtuqerue conquirtuqereu
conquirtuurqee conquirtuurqee conquirtuureqe conquirtuureeq conquirtuureeq conquirtuureqe conquirtuuqree conquirtuuqree
conquirtuuqere conquirtuuqeer conquirtuuqeer conquirtuuqere conquirtuueqre conquirtuueqer conquirtuuerqe conquirtuuereq
conquirtuueerq conquirtuueeqr conquirtuueqer conquirtuueqre conquirtuueeqr conquirtuueerq conquirtuuereq conquirtuuerqe
conquirtuerque conquirtuerqeu conquirtueruqe conquirtuerueq conquirtuereuq conquirtuerequ conquirtueqrue conquirtueqreu
conquirtuequre conquirtuequer conquirtueqeur conquirtueqeru conquirtueuqre conquirtueuqer conquirtueurqe conquirtueureq
conquirtueuerq conquirtueueqr conquirtueequr conquirtueeqru conquirtueeuqr conquirtueeurq conquirtueeruq conquirtueerqu
conquirtrueque conquirtrueqeu conquirtrueuqe conquirtrueueq conquirtrueeuq conquirtrueequ conquirtruqeue conquirtruqeeu
conquirtruquee conquirtruquee conquirtruqeue conquirtruqeeu conquirtruuqee conquirtruuqee conquirtruueqe conquirtruueeq
conquirtruueeq conquirtruueqe conquirtrueque conquirtrueqeu conquirtrueuqe conquirtrueueq conquirtrueeuq conquirtrueequ
conquirtreuque conquirtreuqeu conquirtreuuqe conquirtreuueq conquirtreueuq conquirtreuequ conquirtrequue conquirtrequeu
conquirtrequue conquirtrequeu conquirtreqeuu conquirtreqeuu conquirtreuque conquirtreuqeu conquirtreuuqe conquirtreuueq
conquirtreueuq conquirtreuequ conquirtreequu conquirtreequu conquirtreeuqu conquirtreeuuq conquirtreeuuq conquirtreeuqu
conquirtrqeuue conquirtrqeueu conquirtrqeuue conquirtrqeueu conquirtrqeeuu conquirtrqeeuu conquirtrqueue conquirtrqueeu
conquirtrquuee conquirtrquuee conquirtrqueue conquirtrqueeu conquirtrquuee conquirtrquuee conquirtrqueue conquirtrqueeu
conquirtrqueeu conquirtrqueue conquirtrqeuue conquirtrqeueu conquirtrqeuue conquirtrqeueu conquirtrqeeuu conquirtrqeeuu
conquirtrueque conquirtrueqeu conquirtrueuqe conquirtrueueq conquirtrueeuq conquirtrueequ conquirtruqeue conquirtruqeeu
conquirtruquee conquirtruquee conquirtruqeue conquirtruqeeu conquirtruuqee conquirtruuqee conquirtruueqe conquirtruueeq
conquirtruueeq conquirtruueqe conquirtrueque conquirtrueqeu conquirtrueuqe conquirtrueueq conquirtrueeuq conquirtrueequ
conquirtreequu conquirtreequu conquirtreeuqu conquirtreeuuq conquirtreeuuq conquirtreeuqu conquirtreqeuu conquirtreqeuu
conquirtrequeu conquirtrequue conquirtrequue conquirtrequeu conquirtreuqeu conquirtreuque conquirtreuequ conquirtreueuq
conquirtreuueq conquirtreuuqe conquirtreuque conquirtreuqeu conquirtreuuqe conquirtreuueq conquirtreueuq conquirtreuequ
conquirtqureue conquirtqureeu conquirtquruee conquirtquruee conquirtqureue conquirtqureeu conquirtquerue conquirtquereu
conquirtqueure conquirtqueuer conquirtqueeur conquirtqueeru conquirtquuere conquirtquueer conquirtquuree conquirtquuree
conquirtquuere conquirtquueer conquirtqueeur conquirtqueeru conquirtqueuer conquirtqueure conquirtquerue conquirtquereu
conquirtqrueue conquirtqrueeu conquirtqruuee conquirtqruuee conquirtqrueue conquirtqrueeu conquirtqreuue conquirtqreueu
conquirtqreuue conquirtqreueu conquirtqreeuu conquirtqreeuu conquirtqrueue conquirtqrueeu conquirtqruuee conquirtqruuee
conquirtqrueue conquirtqrueeu conquirtqreeuu conquirtqreeuu conquirtqreueu conquirtqreuue conquirtqreuue conquirtqreueu
conquirtqeruue conquirtqerueu conquirtqeruue conquirtqerueu conquirtqereuu conquirtqereuu conquirtqeurue conquirtqeureu
conquirtqeuure conquirtqeuuer conquirtqeueur conquirtqeueru conquirtqeuure conquirtqeuuer conquirtqeurue conquirtqeureu
conquirtqeueru conquirtqeueur conquirtqeeuur conquirtqeeuru conquirtqeeuur conquirtqeeuru conquirtqeeruu conquirtqeeruu
conquirtqureue conquirtqureeu conquirtquruee conquirtquruee conquirtqureue conquirtqureeu conquirtquerue conquirtquereu
conquirtqueure conquirtqueuer conquirtqueeur conquirtqueeru conquirtquuere conquirtquueer conquirtquuree conquirtquuree
conquirtquuere conquirtquueer conquirtqueeur conquirtqueeru conquirtqueuer conquirtqueure conquirtquerue conquirtquereu
conquirtqereuu conquirtqereuu conquirtqerueu conquirtqeruue conquirtqeruue conquirtqerueu conquirtqeeruu conquirtqeeruu
conquirtqeeuru conquirtqeeuur conquirtqeeuur conquirtqeeuru conquirtqeueru conquirtqeueur conquirtqeureu conquirtqeurue
conquirtqeuure conquirtqeuuer conquirtqeueur conquirtqeueru conquirtqeuuer conquirtqeuure conquirtqeurue conquirtqeureu
conquirtuurqee conquirtuurqee conquirtuureqe conquirtuureeq conquirtuureeq conquirtuureqe conquirtuuqree conquirtuuqree
conquirtuuqere conquirtuuqeer conquirtuuqeer conquirtuuqere conquirtuueqre conquirtuueqer conquirtuuerqe conquirtuuereq
conquirtuueerq conquirtuueeqr conquirtuueqer conquirtuueqre conquirtuueeqr conquirtuueerq conquirtuuereq conquirtuuerqe
conquirturuqee conquirturuqee conquirturueqe conquirturueeq conquirturueeq conquirturueqe conquirturquee conquirturquee
conquirturqeue conquirturqeeu conquirturqeeu conquirturqeue conquirtureque conquirtureqeu conquirtureuqe conquirtureueq
conquirtureeuq conquirtureequ conquirtureqeu conquirtureque conquirtureequ conquirtureeuq conquirtureueq conquirtureuqe
conquirtuqruee conquirtuqruee conquirtuqreue conquirtuqreeu conquirtuqreeu conquirtuqreue conquirtuquree conquirtuquree
conquirtuquere conquirtuqueer conquirtuqueer conquirtuquere conquirtuqeure conquirtuqeuer conquirtuqerue conquirtuqereu
conquirtuqeeru conquirtuqeeur conquirtuqeuer conquirtuqeure conquirtuqeeur conquirtuqeeru conquirtuqereu conquirtuqerue
conquirtuerque conquirtuerqeu conquirtueruqe conquirtuerueq conquirtuereuq conquirtuerequ conquirtueqrue conquirtueqreu
conquirtuequre conquirtuequer conquirtueqeur conquirtueqeru conquirtueuqre conquirtueuqer conquirtueurqe conquirtueureq
conquirtueuerq conquirtueueqr conquirtueequr conquirtueeqru conquirtueeuqr conquirtueeurq conquirtueeruq conquirtueerqu
conquirtuerqeu conquirtuerque conquirtuerequ conquirtuereuq conquirtuerueq conquirtueruqe conquirtueqreu conquirtueqrue
conquirtueqeru conquirtueqeur conquirtuequer conquirtuequre conquirtueeqru conquirtueequr conquirtueerqu conquirtueeruq
conquirtueeurq conquirtueeuqr conquirtueuqer conquirtueuqre conquirtueueqr conquirtueuerq conquirtueureq conquirtueurqe
conquirteurque conquirteurqeu conquirteuruqe conquirteurueq conquirteureuq conquirteurequ conquirteuqrue conquirteuqreu
conquirteuqure conquirteuquer conquirteuqeur conquirteuqeru conquirteuuqre conquirteuuqer conquirteuurqe conquirteuureq
conquirteuuerq conquirteuueqr conquirteuequr conquirteueqru conquirteueuqr conquirteueurq conquirteueruq conquirteuerqu
conquirteruque conquirteruqeu conquirteruuqe conquirteruueq conquirterueuq conquirteruequ conquirterquue conquirterqueu
conquirterquue conquirterqueu conquirterqeuu conquirterqeuu conquirteruque conquirteruqeu conquirteruuqe conquirteruueq
conquirterueuq conquirteruequ conquirterequu conquirterequu conquirtereuqu conquirtereuuq conquirtereuuq conquirtereuqu
conquirteqruue conquirteqrueu conquirteqruue conquirteqrueu conquirteqreuu conquirteqreuu conquirtequrue conquirtequreu
conquirtequure conquirtequuer conquirtequeur conquirtequeru conquirtequure conquirtequuer conquirtequrue conquirtequreu
conquirtequeru conquirtequeur conquirteqeuur conquirteqeuru conquirteqeuur conquirteqeuru conquirteqeruu conquirteqeruu
conquirteurque conquirteurqeu conquirteuruqe conquirteurueq conquirteureuq conquirteurequ conquirteuqrue conquirteuqreu
conquirteuqure conquirteuquer conquirteuqeur conquirteuqeru conquirteuuqre conquirteuuqer conquirteuurqe conquirteuureq
conquirteuuerq conquirteuueqr conquirteuequr conquirteueqru conquirteueuqr conquirteueurq conquirteueruq conquirteuerqu
conquirteerquu conquirteerquu conquirteeruqu conquirteeruuq conquirteeruuq conquirteeruqu conquirteeqruu conquirteeqruu
conquirteequru conquirteequur conquirteequur conquirteequru conquirteeuqru conquirteeuqur conquirteeurqu conquirteeuruq
conquirteeuurq conquirteeuuqr conquirteeuqur conquirteeuqru conquirteeuuqr conquirteeuurq conquirteeuruq conquirteeurqu
conquiruterque conquiruterqeu conquiruteruqe conquiruterueq conquirutereuq conquiruterequ conquiruteqrue conquiruteqreu
conquirutequre conquirutequer conquiruteqeur conquiruteqeru conquiruteuqre conquiruteuqer conquiruteurqe conquiruteureq
conquiruteuerq conquiruteueqr conquiruteequr conquiruteeqru conquiruteeuqr conquiruteeurq conquiruteeruq conquiruteerqu
conquirutreque conquirutreqeu conquirutreuqe conquirutreueq conquirutreeuq conquirutreequ conquirutrqeue conquirutrqeeu
conquirutrquee conquirutrquee conquirutrqeue conquirutrqeeu conquirutruqee conquirutruqee conquirutrueqe conquirutrueeq
conquirutrueeq conquirutrueqe conquirutreque conquirutreqeu conquirutreuqe conquirutreueq conquirutreeuq conquirutreequ
conquirutqreue conquirutqreeu conquirutqruee conquirutqruee conquirutqreue conquirutqreeu conquirutqerue conquirutqereu
conquirutqeure conquirutqeuer conquirutqeeur conquirutqeeru conquirutquere conquirutqueer conquirutquree conquirutquree
conquirutquere conquirutqueer conquirutqeeur conquirutqeeru conquirutqeuer conquirutqeure conquirutqerue conquirutqereu
conquiruturqee conquiruturqee conquirutureqe conquirutureeq conquirutureeq conquirutureqe conquirutuqree conquirutuqree
conquirutuqere conquirutuqeer conquirutuqeer conquirutuqere conquirutueqre conquirutueqer conquirutuerqe conquirutuereq
conquirutueerq conquirutueeqr conquirutueqer conquirutueqre conquirutueeqr conquirutueerq conquirutuereq conquirutuerqe
conquiruterque conquiruterqeu conquiruteruqe conquiruterueq conquirutereuq conquiruterequ conquiruteqrue conquiruteqreu
conquirutequre conquirutequer conquiruteqeur conquiruteqeru conquiruteuqre conquiruteuqer conquiruteurqe conquiruteureq
conquiruteuerq conquiruteueqr conquiruteequr conquiruteeqru conquiruteeuqr conquiruteeurq conquiruteeruq conquiruteerqu
conquiruetrque conquiruetrqeu conquiruetruqe conquiruetrueq conquiruetreuq conquiruetrequ conquiruetqrue conquiruetqreu
conquiruetqure conquiruetquer conquiruetqeur conquiruetqeru conquiruetuqre conquiruetuqer conquirueturqe conquiruetureq
conquiruetuerq conquiruetueqr conquiruetequr conquirueteqru conquirueteuqr conquirueteurq conquirueteruq conquirueterqu
conquiruertque conquiruertqeu conquiruertuqe conquiruertueq conquiruerteuq conquiruertequ conquiruerqtue conquiruerqteu
conquiruerqute conquiruerquet conquiruerqeut conquiruerqetu conquirueruqte conquirueruqet conquiruerutqe conquirueruteq
conquirueruetq conquiruerueqt conquiruerequt conquiruereqtu conquiruereuqt conquiruereutq conquirueretuq conquirueretqu
conquirueqrtue conquirueqrteu conquirueqrute conquirueqruet conquirueqreut conquirueqretu conquirueqtrue conquirueqtreu
conquirueqture conquirueqtuer conquirueqteur conquirueqteru conquiruequtre conquiruequter conquiruequrte conquiruequret
conquiruequert conquiruequetr conquirueqetur conquirueqetru conquirueqeutr conquirueqeurt conquirueqerut conquirueqertu
conquirueurqte conquirueurqet conquirueurtqe conquirueurteq conquirueuretq conquirueureqt conquirueuqrte conquirueuqret
conquirueuqtre conquirueuqter conquirueuqetr conquirueuqert conquirueutqre conquirueutqer conquirueutrqe conquirueutreq
conquirueuterq conquirueuteqr conquirueueqtr conquirueueqrt conquirueuetqr conquirueuetrq conquirueuertq conquirueuerqt
conquirueerqut conquirueerqtu conquirueeruqt conquirueerutq conquirueertuq conquirueertqu conquirueeqrut conquirueeqrtu
conquirueequrt conquirueequtr conquirueeqtur conquirueeqtru conquirueeuqrt conquirueeuqtr conquirueeurqt conquirueeurtq
conquirueeutrq conquirueeutqr conquirueetqur conquirueetqru conquirueetuqr conquirueeturq conquirueetruq conquirueetrqu
conquiruretque conquiruretqeu conquiruretuqe conquiruretueq conquirureteuq conquiruretequ conquirureqtue conquirureqteu
conquirurequte conquirurequet conquirureqeut conquirureqetu conquirureuqte conquirureuqet conquirureutqe conquirureuteq
conquirureuetq conquirureueqt conquirureequt conquirureeqtu conquirureeuqt conquirureeutq conquirureetuq conquirureetqu
conquirurteque conquirurteqeu conquirurteuqe conquirurteueq conquirurteeuq conquirurteequ conquirurtqeue conquirurtqeeu
conquirurtquee conquirurtquee conquirurtqeue conquirurtqeeu conquirurtuqee conquirurtuqee conquirurtueqe conquirurtueeq
conquirurtueeq conquirurtueqe conquirurteque conquirurteqeu conquirurteuqe conquirurteueq conquirurteeuq conquirurteequ
conquirurqteue conquirurqteeu conquirurqtuee conquirurqtuee conquirurqteue conquirurqteeu conquirurqetue conquirurqeteu
conquirurqeute conquirurqeuet conquirurqeeut conquirurqeetu conquirurquete conquirurqueet conquirurqutee conquirurqutee
conquirurquete conquirurqueet conquirurqeeut conquirurqeetu conquirurqeuet conquirurqeute conquirurqetue conquirurqeteu
conquirurutqee conquirurutqee conquiruruteqe conquiruruteeq conquiruruteeq conquiruruteqe conquiruruqtee conquiruruqtee
conquiruruqete conquiruruqeet conquiruruqeet conquiruruqete conquirurueqte conquirurueqet conquiruruetqe conquirurueteq
conquirurueetq conquirurueeqt conquirurueqet conquirurueqte conquirurueeqt conquirurueetq conquirurueteq conquiruruetqe
conquiruretque conquiruretqeu conquiruretuqe conquiruretueq conquirureteuq conquiruretequ conquirureqtue conquirureqteu
conquirurequte conquirurequet conquirureqeut conquirureqetu conquirureuqte conquirureuqet conquirureutqe conquirureuteq
conquirureuetq conquirureueqt conquirureequt conquirureeqtu conquirureeuqt conquirureeutq conquirureetuq conquirureetqu
conquiruqertue conquiruqerteu conquiruqerute conquiruqeruet conquiruqereut conquiruqeretu conquiruqetrue conquiruqetreu
conquiruqeture conquiruqetuer conquiruqeteur conquiruqeteru conquiruqeutre conquiruqeuter conquiruqeurte conquiruqeuret
conquiruqeuert conquiruqeuetr conquiruqeetur conquiruqeetru conquiruqeeutr conquiruqeeurt conquiruqeerut conquiruqeertu
conquiruqretue conquiruqreteu conquiruqreute conquiruqreuet conquiruqreeut conquiruqreetu conquiruqrteue conquiruqrteeu
conquiruqrtuee conquiruqrtuee conquiruqrteue conquiruqrteeu conquiruqrutee conquiruqrutee conquiruqruete conquiruqrueet
conquiruqrueet conquiruqruete conquiruqretue conquiruqreteu conquiruqreute conquiruqreuet conquiruqreeut conquiruqreetu
conquiruqtreue conquiruqtreeu conquiruqtruee conquiruqtruee conquiruqtreue conquiruqtreeu conquiruqterue conquiruqtereu
conquiruqteure conquiruqteuer conquiruqteeur conquiruqteeru conquiruqtuere conquiruqtueer conquiruqturee conquiruqturee
conquiruqtuere conquiruqtueer conquiruqteeur conquiruqteeru conquiruqteuer conquiruqteure conquiruqterue conquiruqtereu
conquiruqurtee conquiruqurtee conquiruqurete conquiruqureet conquiruqureet conquiruqurete conquiruqutree conquiruqutree
conquiruqutere conquiruquteer conquiruquteer conquiruqutere conquiruquetre conquiruqueter conquiruquerte conquiruqueret
conquiruqueert conquiruqueetr conquiruqueter conquiruquetre conquiruqueetr conquiruqueert conquiruqueret conquiruquerte
conquiruqertue conquiruqerteu conquiruqerute conquiruqeruet conquiruqereut conquiruqeretu conquiruqetrue conquiruqetreu
conquiruqeture conquiruqetuer conquiruqeteur conquiruqeteru conquiruqeutre conquiruqeuter conquiruqeurte conquiruqeuret
conquiruqeuert conquiruqeuetr conquiruqeetur conquiruqeetru conquiruqeeutr conquiruqeeurt conquiruqeerut conquiruqeertu
conquiruuerqte conquiruuerqet conquiruuertqe conquiruuerteq conquiruueretq conquiruuereqt conquiruueqrte conquiruueqret
conquiruueqtre conquiruueqter conquiruueqetr conquiruueqert conquiruuetqre conquiruuetqer conquiruuetrqe conquiruuetreq
conquiruueterq conquiruueteqr conquiruueeqtr conquiruueeqrt conquiruueetqr conquiruueetrq conquiruueertq conquiruueerqt
conquiruureqte conquiruureqet conquiruuretqe conquiruureteq conquiruureetq conquiruureeqt conquiruurqete conquiruurqeet
conquiruurqtee conquiruurqtee conquiruurqete conquiruurqeet conquiruurtqee conquiruurtqee conquiruurteqe conquiruurteeq
conquiruurteeq conquiruurteqe conquiruureqte conquiruureqet conquiruuretqe conquiruureteq conquiruureetq conquiruureeqt
conquiruuqrete conquiruuqreet conquiruuqrtee conquiruuqrtee conquiruuqrete conquiruuqreet conquiruuqerte conquiruuqeret
conquiruuqetre conquiruuqeter conquiruuqeetr conquiruuqeert conquiruuqtere conquiruuqteer conquiruuqtree conquiruuqtree
conquiruuqtere conquiruuqteer conquiruuqeetr conquiruuqeert conquiruuqeter conquiruuqetre conquiruuqerte conquiruuqeret
conquiruutrqee conquiruutrqee conquiruutreqe conquiruutreeq conquiruutreeq conquiruutreqe conquiruutqree conquiruutqree
conquiruutqere conquiruutqeer conquiruutqeer conquiruutqere conquiruuteqre conquiruuteqer conquiruuterqe conquiruutereq
conquiruuteerq conquiruuteeqr conquiruuteqer conquiruuteqre conquiruuteeqr conquiruuteerq conquiruutereq conquiruuterqe
conquiruuerqte conquiruuerqet conquiruuertqe conquiruuerteq conquiruueretq conquiruuereqt conquiruueqrte conquiruueqret
conquiruueqtre conquiruueqter conquiruueqetr conquiruueqert conquiruuetqre conquiruuetqer conquiruuetrqe conquiruuetreq
conquiruueterq conquiruueteqr conquiruueeqtr conquiruueeqrt conquiruueetqr conquiruueetrq conquiruueertq conquiruueerqt
conquirueerqut conquirueerqtu conquirueeruqt conquirueerutq conquirueertuq conquirueertqu conquirueeqrut conquirueeqrtu
conquirueequrt conquirueequtr conquirueeqtur conquirueeqtru conquirueeuqrt conquirueeuqtr conquirueeurqt conquirueeurtq
conquirueeutrq conquirueeutqr conquirueetqur conquirueetqru conquirueetuqr conquirueeturq conquirueetruq conquirueetrqu
conquiruerequt conquiruereqtu conquiruereuqt conquiruereutq conquirueretuq conquirueretqu conquiruerqeut conquiruerqetu
conquiruerquet conquiruerqute conquiruerqtue conquiruerqteu conquirueruqet conquirueruqte conquiruerueqt conquirueruetq
conquirueruteq conquiruerutqe conquiruertque conquiruertqeu conquiruertuqe conquiruertueq conquiruerteuq conquiruertequ
conquirueqreut conquirueqretu conquirueqruet conquirueqrute conquirueqrtue conquirueqrteu conquirueqerut conquirueqertu
conquirueqeurt conquirueqeutr conquirueqetur conquirueqetru conquiruequert conquiruequetr conquiruequret conquiruequrte
conquiruequtre conquiruequter conquirueqteur conquirueqteru conquirueqtuer conquirueqture conquirueqtrue conquirueqtreu
conquirueurqet conquirueurqte conquirueureqt conquirueuretq conquirueurteq conquirueurtqe conquirueuqret conquirueuqrte
conquirueuqert conquirueuqetr conquirueuqter conquirueuqtre conquirueueqrt conquirueueqtr conquirueuerqt conquirueuertq
conquirueuetrq conquirueuetqr conquirueutqer conquirueutqre conquirueuteqr conquirueuterq conquirueutreq conquirueutrqe
conquiruetrque conquiruetrqeu conquiruetruqe conquiruetrueq conquiruetreuq conquiruetrequ conquiruetqrue conquiruetqreu
conquiruetqure conquiruetquer conquiruetqeur conquiruetqeru conquiruetuqre conquiruetuqer conquirueturqe conquiruetureq
conquiruetuerq conquiruetueqr conquiruetequr conquirueteqru conquirueteuqr conquirueteurq conquirueteruq conquirueterqu
conquirrtueque conquirrtueqeu conquirrtueuqe conquirrtueueq conquirrtueeuq conquirrtueequ conquirrtuqeue conquirrtuqeeu
conquirrtuquee conquirrtuquee conquirrtuqeue conquirrtuqeeu conquirrtuuqee conquirrtuuqee conquirrtuueqe conquirrtuueeq
conquirrtuueeq conquirrtuueqe conquirrtueque conquirrtueqeu conquirrtueuqe conquirrtueueq conquirrtueeuq conquirrtueequ
conquirrteuque conquirrteuqeu conquirrteuuqe conquirrteuueq conquirrteueuq conquirrteuequ conquirrtequue conquirrtequeu
conquirrtequue conquirrtequeu conquirrteqeuu conquirrteqeuu conquirrteuque conquirrteuqeu conquirrteuuqe conquirrteuueq
conquirrteueuq conquirrteuequ conquirrteequu conquirrteequu conquirrteeuqu conquirrteeuuq conquirrteeuuq conquirrteeuqu
conquirrtqeuue conquirrtqeueu conquirrtqeuue conquirrtqeueu conquirrtqeeuu conquirrtqeeuu conquirrtqueue conquirrtqueeu
conquirrtquuee conquirrtquuee conquirrtqueue conquirrtqueeu conquirrtquuee conquirrtquuee conquirrtqueue conquirrtqueeu
conquirrtqueeu conquirrtqueue conquirrtqeuue conquirrtqeueu conquirrtqeuue conquirrtqeueu conquirrtqeeuu conquirrtqeeuu
conquirrtueque conquirrtueqeu conquirrtueuqe conquirrtueueq conquirrtueeuq conquirrtueequ conquirrtuqeue conquirrtuqeeu
conquirrtuquee conquirrtuquee conquirrtuqeue conquirrtuqeeu conquirrtuuqee conquirrtuuqee conquirrtuueqe conquirrtuueeq
conquirrtuueeq conquirrtuueqe conquirrtueque conquirrtueqeu conquirrtueuqe conquirrtueueq conquirrtueeuq conquirrtueequ
conquirrteequu conquirrteequu conquirrteeuqu conquirrteeuuq conquirrteeuuq conquirrteeuqu conquirrteqeuu conquirrteqeuu
conquirrtequeu conquirrtequue conquirrtequue conquirrtequeu conquirrteuqeu conquirrteuque conquirrteuequ conquirrteueuq
conquirrteuueq conquirrteuuqe conquirrteuque conquirrteuqeu conquirrteuuqe conquirrteuueq conquirrteueuq conquirrteuequ
conquirruteque conquirruteqeu conquirruteuqe conquirruteueq conquirruteeuq conquirruteequ conquirrutqeue conquirrutqeeu
conquirrutquee conquirrutquee conquirrutqeue conquirrutqeeu conquirrutuqee conquirrutuqee conquirrutueqe conquirrutueeq
conquirrutueeq conquirrutueqe conquirruteque conquirruteqeu conquirruteuqe conquirruteueq conquirruteeuq conquirruteequ
conquirruetque conquirruetqeu conquirruetuqe conquirruetueq conquirrueteuq conquirruetequ conquirrueqtue conquirrueqteu
conquirruequte conquirruequet conquirrueqeut conquirrueqetu conquirrueuqte conquirrueuqet conquirrueutqe conquirrueuteq
conquirrueuetq conquirrueueqt conquirrueequt conquirrueeqtu conquirrueeuqt conquirrueeutq conquirrueetuq conquirrueetqu
conquirruqetue conquirruqeteu conquirruqeute conquirruqeuet conquirruqeeut conquirruqeetu conquirruqteue conquirruqteeu
conquirruqtuee conquirruqtuee conquirruqteue conquirruqteeu conquirruqutee conquirruqutee conquirruquete conquirruqueet
conquirruqueet conquirruquete conquirruqetue conquirruqeteu conquirruqeute conquirruqeuet conquirruqeeut conquirruqeetu
conquirruueqte conquirruueqet conquirruuetqe conquirruueteq conquirruueetq conquirruueeqt conquirruuqete conquirruuqeet
conquirruuqtee conquirruuqtee conquirruuqete conquirruuqeet conquirruutqee conquirruutqee conquirruuteqe conquirruuteeq
conquirruuteeq conquirruuteqe conquirruueqte conquirruueqet conquirruuetqe conquirruueteq conquirruueetq conquirruueeqt
conquirrueequt conquirrueeqtu conquirrueeuqt conquirrueeutq conquirrueetuq conquirrueetqu conquirrueqeut conquirrueqetu
conquirruequet conquirruequte conquirrueqtue conquirrueqteu conquirrueuqet conquirrueuqte conquirrueueqt conquirrueuetq
conquirrueuteq conquirrueutqe conquirruetque conquirruetqeu conquirruetuqe conquirruetueq conquirrueteuq conquirruetequ
conquirreutque conquirreutqeu conquirreutuqe conquirreutueq conquirreuteuq conquirreutequ conquirreuqtue conquirreuqteu
conquirreuqute conquirreuquet conquirreuqeut conquirreuqetu conquirreuuqte conquirreuuqet conquirreuutqe conquirreuuteq
conquirreuuetq conquirreuueqt conquirreuequt conquirreueqtu conquirreueuqt conquirreueutq conquirreuetuq conquirreuetqu
conquirretuque conquirretuqeu conquirretuuqe conquirretuueq conquirretueuq conquirretuequ conquirretquue conquirretqueu
conquirretquue conquirretqueu conquirretqeuu conquirretqeuu conquirretuque conquirretuqeu conquirretuuqe conquirretuueq
conquirretueuq conquirretuequ conquirretequu conquirretequu conquirreteuqu conquirreteuuq conquirreteuuq conquirreteuqu
conquirreqtuue conquirreqtueu conquirreqtuue conquirreqtueu conquirreqteuu conquirreqteuu conquirrequtue conquirrequteu
conquirrequute conquirrequuet conquirrequeut conquirrequetu conquirrequute conquirrequuet conquirrequtue conquirrequteu
conquirrequetu conquirrequeut conquirreqeuut conquirreqeutu conquirreqeuut conquirreqeutu conquirreqetuu conquirreqetuu
conquirreutque conquirreutqeu conquirreutuqe conquirreutueq conquirreuteuq conquirreutequ conquirreuqtue conquirreuqteu
conquirreuqute conquirreuquet conquirreuqeut conquirreuqetu conquirreuuqte conquirreuuqet conquirreuutqe conquirreuuteq
conquirreuuetq conquirreuueqt conquirreuequt conquirreueqtu conquirreueuqt conquirreueutq conquirreuetuq conquirreuetqu
conquirreetquu conquirreetquu conquirreetuqu conquirreetuuq conquirreetuuq conquirreetuqu conquirreeqtuu conquirreeqtuu
conquirreequtu conquirreequut conquirreequut conquirreequtu conquirreeuqtu conquirreeuqut conquirreeutqu conquirreeutuq
conquirreeuutq conquirreeuuqt conquirreeuqut conquirreeuqtu conquirreeuuqt conquirreeuutq conquirreeutuq conquirreeutqu
conquirrquetue conquirrqueteu conquirrqueute conquirrqueuet conquirrqueeut conquirrqueetu conquirrquteue conquirrquteeu
conquirrqutuee conquirrqutuee conquirrquteue conquirrquteeu conquirrquutee conquirrquutee conquirrquuete conquirrquueet
conquirrquueet conquirrquuete conquirrquetue conquirrqueteu conquirrqueute conquirrqueuet conquirrqueeut conquirrqueetu
conquirrqeutue conquirrqeuteu conquirrqeuute conquirrqeuuet conquirrqeueut conquirrqeuetu conquirrqetuue conquirrqetueu
conquirrqetuue conquirrqetueu conquirrqeteuu conquirrqeteuu conquirrqeutue conquirrqeuteu conquirrqeuute conquirrqeuuet
conquirrqeueut conquirrqeuetu conquirrqeetuu conquirrqeetuu conquirrqeeutu conquirrqeeuut conquirrqeeuut conquirrqeeutu
conquirrqteuue conquirrqteueu conquirrqteuue conquirrqteueu conquirrqteeuu conquirrqteeuu conquirrqtueue conquirrqtueeu
conquirrqtuuee conquirrqtuuee conquirrqtueue conquirrqtueeu conquirrqtuuee conquirrqtuuee conquirrqtueue conquirrqtueeu
conquirrqtueeu conquirrqtueue conquirrqteuue conquirrqteueu conquirrqteuue conquirrqteueu conquirrqteeuu conquirrqteeuu
conquirrquetue conquirrqueteu conquirrqueute conquirrqueuet conquirrqueeut conquirrqueetu conquirrquteue conquirrquteeu
conquirrqutuee conquirrqutuee conquirrquteue conquirrquteeu conquirrquutee conquirrquutee conquirrquuete conquirrquueet
conquirrquueet conquirrquuete conquirrquetue conquirrqueteu conquirrqueute conquirrqueuet conquirrqueeut conquirrqueetu
conquirrqeetuu conquirrqeetuu conquirrqeeutu conquirrqeeuut conquirrqeeuut conquirrqeeutu conquirrqeteuu conquirrqeteuu
conquirrqetueu conquirrqetuue conquirrqetuue conquirrqetueu conquirrqeuteu conquirrqeutue conquirrqeuetu conquirrqeueut
conquirrqeuuet conquirrqeuute conquirrqeutue conquirrqeuteu conquirrqeuute conquirrqeuuet conquirrqeueut conquirrqeuetu
conquirruueqte conquirruueqet conquirruuetqe conquirruueteq conquirruueetq conquirruueeqt conquirruuqete conquirruuqeet
conquirruuqtee conquirruuqtee conquirruuqete conquirruuqeet conquirruutqee conquirruutqee conquirruuteqe conquirruuteeq
conquirruuteeq conquirruuteqe conquirruueqte conquirruueqet conquirruuetqe conquirruueteq conquirruueetq conquirruueeqt
conquirrueuqte conquirrueuqet conquirrueutqe conquirrueuteq conquirrueuetq conquirrueueqt conquirruequte conquirruequet
conquirrueqtue conquirrueqteu conquirrueqetu conquirrueqeut conquirruetque conquirruetqeu conquirruetuqe conquirruetueq
conquirrueteuq conquirruetequ conquirrueeqtu conquirrueequt conquirrueetqu conquirrueetuq conquirrueeutq conquirrueeuqt
conquirruqeute conquirruqeuet conquirruqetue conquirruqeteu conquirruqeetu conquirruqeeut conquirruquete conquirruqueet
conquirruqutee conquirruqutee conquirruquete conquirruqueet conquirruqtuee conquirruqtuee conquirruqteue conquirruqteeu
conquirruqteeu conquirruqteue conquirruqeute conquirruqeuet conquirruqetue conquirruqeteu conquirruqeetu conquirruqeeut
conquirruteque conquirruteqeu conquirruteuqe conquirruteueq conquirruteeuq conquirruteequ conquirrutqeue conquirrutqeeu
conquirrutquee conquirrutquee conquirrutqeue conquirrutqeeu conquirrutuqee conquirrutuqee conquirrutueqe conquirrutueeq
conquirrutueeq conquirrutueqe conquirruteque conquirruteqeu conquirruteuqe conquirruteueq conquirruteeuq conquirruteequ
conquirrueeqtu conquirrueequt conquirrueetqu conquirrueetuq conquirrueeutq conquirrueeuqt conquirrueqetu conquirrueqeut
conquirrueqteu conquirrueqtue conquirruequte conquirruequet conquirruetqeu conquirruetque conquirruetequ conquirrueteuq
conquirruetueq conquirruetuqe conquirrueuqte conquirrueuqet conquirrueutqe conquirrueuteq conquirrueuetq conquirrueueqt
conquirreuequt conquirreueqtu conquirreueuqt conquirreueutq conquirreuetuq conquirreuetqu conquirreuqeut conquirreuqetu
conquirreuquet conquirreuqute conquirreuqtue conquirreuqteu conquirreuuqet conquirreuuqte conquirreuueqt conquirreuuetq
conquirreuuteq conquirreuutqe conquirreutque conquirreutqeu conquirreutuqe conquirreutueq conquirreuteuq conquirreutequ
conquirreeuqut conquirreeuqtu conquirreeuuqt conquirreeuutq conquirreeutuq conquirreeutqu conquirreequut conquirreequtu
conquirreequut conquirreequtu conquirreeqtuu conquirreeqtuu conquirreeuqut conquirreeuqtu conquirreeuuqt conquirreeuutq
conquirreeutuq conquirreeutqu conquirreetquu conquirreetquu conquirreetuqu conquirreetuuq conquirreetuuq conquirreetuqu
conquirreqeuut conquirreqeutu conquirreqeuut conquirreqeutu conquirreqetuu conquirreqetuu conquirrequeut conquirrequetu
conquirrequuet conquirrequute conquirrequtue conquirrequteu conquirrequuet conquirrequute conquirrequeut conquirrequetu
conquirrequteu conquirrequtue conquirreqtuue conquirreqtueu conquirreqtuue conquirreqtueu conquirreqteuu conquirreqteuu
conquirreuequt conquirreueqtu conquirreueuqt conquirreueutq conquirreuetuq conquirreuetqu conquirreuqeut conquirreuqetu
conquirreuquet conquirreuqute conquirreuqtue conquirreuqteu conquirreuuqet conquirreuuqte conquirreuueqt conquirreuuetq
conquirreuuteq conquirreuutqe conquirreutque conquirreutqeu conquirreutuqe conquirreutueq conquirreuteuq conquirreutequ
conquirretequu conquirretequu conquirreteuqu conquirreteuuq conquirreteuuq conquirreteuqu conquirretqeuu conquirretqeuu
conquirretqueu conquirretquue conquirretquue conquirretqueu conquirretuqeu conquirretuque conquirretuequ conquirretueuq
conquirretuueq conquirretuuqe conquirretuque conquirretuqeu conquirretuuqe conquirretuueq conquirretueuq conquirretuequ
conquirqtureue conquirqtureeu conquirqturuee conquirqturuee conquirqtureue conquirqtureeu conquirqtuerue conquirqtuereu
conquirqtueure conquirqtueuer conquirqtueeur conquirqtueeru conquirqtuuere conquirqtuueer conquirqtuuree conquirqtuuree
conquirqtuuere conquirqtuueer conquirqtueeur conquirqtueeru conquirqtueuer conquirqtueure conquirqtuerue conquirqtuereu
conquirqtrueue conquirqtrueeu conquirqtruuee conquirqtruuee conquirqtrueue conquirqtrueeu conquirqtreuue conquirqtreueu
conquirqtreuue conquirqtreueu conquirqtreeuu conquirqtreeuu conquirqtrueue conquirqtrueeu conquirqtruuee conquirqtruuee
conquirqtrueue conquirqtrueeu conquirqtreeuu conquirqtreeuu conquirqtreueu conquirqtreuue conquirqtreuue conquirqtreueu
conquirqteruue conquirqterueu conquirqteruue conquirqterueu conquirqtereuu conquirqtereuu conquirqteurue conquirqteureu
conquirqteuure conquirqteuuer conquirqteueur conquirqteueru conquirqteuure conquirqteuuer conquirqteurue conquirqteureu
conquirqteueru conquirqteueur conquirqteeuur conquirqteeuru conquirqteeuur conquirqteeuru conquirqteeruu conquirqteeruu
conquirqtureue conquirqtureeu conquirqturuee conquirqturuee conquirqtureue conquirqtureeu conquirqtuerue conquirqtuereu
conquirqtueure conquirqtueuer conquirqtueeur conquirqtueeru conquirqtuuere conquirqtuueer conquirqtuuree conquirqtuuree
conquirqtuuere conquirqtuueer conquirqtueeur conquirqtueeru conquirqtueuer conquirqtueure conquirqtuerue conquirqtuereu
conquirqtereuu conquirqtereuu conquirqterueu conquirqteruue conquirqteruue conquirqterueu conquirqteeruu conquirqteeruu
conquirqteeuru conquirqteeuur conquirqteeuur conquirqteeuru conquirqteueru conquirqteueur conquirqteureu conquirqteurue
conquirqteuure conquirqteuuer conquirqteueur conquirqteueru conquirqteuuer conquirqteuure conquirqteurue conquirqteureu
conquirqutreue conquirqutreeu conquirqutruee conquirqutruee conquirqutreue conquirqutreeu conquirquterue conquirqutereu
conquirquteure conquirquteuer conquirquteeur conquirquteeru conquirqutuere conquirqutueer conquirquturee conquirquturee
conquirqutuere conquirqutueer conquirquteeur conquirquteeru conquirquteuer conquirquteure conquirquterue conquirqutereu
conquirqurteue conquirqurteeu conquirqurtuee conquirqurtuee conquirqurteue conquirqurteeu conquirquretue conquirqureteu
conquirqureute conquirqureuet conquirqureeut conquirqureetu conquirquruete conquirqurueet conquirqurutee conquirqurutee
conquirquruete conquirqurueet conquirqureeut conquirqureetu conquirqureuet conquirqureute conquirquretue conquirqureteu
conquirquertue conquirquerteu conquirquerute conquirqueruet conquirquereut conquirqueretu conquirquetrue conquirquetreu
conquirqueture conquirquetuer conquirqueteur conquirqueteru conquirqueutre conquirqueuter conquirqueurte conquirqueuret
conquirqueuert conquirqueuetr conquirqueetur conquirqueetru conquirqueeutr conquirqueeurt conquirqueerut conquirqueertu
conquirquurete conquirquureet conquirquurtee conquirquurtee conquirquurete conquirquureet conquirquuerte conquirquueret
conquirquuetre conquirquueter conquirquueetr conquirquueert conquirquutere conquirquuteer conquirquutree conquirquutree
conquirquutere conquirquuteer conquirquueetr conquirquueert conquirquueter conquirquuetre conquirquuerte conquirquueret
conquirquereut conquirqueretu conquirqueruet conquirquerute conquirquertue conquirquerteu conquirqueerut conquirqueertu
conquirqueeurt conquirqueeutr conquirqueetur conquirqueetru conquirqueuert conquirqueuetr conquirqueuret conquirqueurte
conquirqueutre conquirqueuter conquirqueteur conquirqueteru conquirquetuer conquirqueture conquirquetrue conquirquetreu
conquirqruteue conquirqruteeu conquirqrutuee conquirqrutuee conquirqruteue conquirqruteeu conquirqruetue conquirqrueteu
conquirqrueute conquirqrueuet conquirqrueeut conquirqrueetu conquirqruuete conquirqruueet conquirqruutee conquirqruutee
conquirqruuete conquirqruueet conquirqrueeut conquirqrueetu conquirqrueuet conquirqrueute conquirqruetue conquirqrueteu
conquirqrtueue conquirqrtueeu conquirqrtuuee conquirqrtuuee conquirqrtueue conquirqrtueeu conquirqrteuue conquirqrteueu
conquirqrteuue conquirqrteueu conquirqrteeuu conquirqrteeuu conquirqrtueue conquirqrtueeu conquirqrtuuee conquirqrtuuee
conquirqrtueue conquirqrtueeu conquirqrteeuu conquirqrteeuu conquirqrteueu conquirqrteuue conquirqrteuue conquirqrteueu
conquirqretuue conquirqretueu conquirqretuue conquirqretueu conquirqreteuu conquirqreteuu conquirqreutue conquirqreuteu
conquirqreuute conquirqreuuet conquirqreueut conquirqreuetu conquirqreuute conquirqreuuet conquirqreutue conquirqreuteu
conquirqreuetu conquirqreueut conquirqreeuut conquirqreeutu conquirqreeuut conquirqreeutu conquirqreetuu conquirqreetuu
conquirqruteue conquirqruteeu conquirqrutuee conquirqrutuee conquirqruteue conquirqruteeu conquirqruetue conquirqrueteu
conquirqrueute conquirqrueuet conquirqrueeut conquirqrueetu conquirqruuete conquirqruueet conquirqruutee conquirqruutee
conquirqruuete conquirqruueet conquirqrueeut conquirqrueetu conquirqrueuet conquirqrueute conquirqruetue conquirqrueteu
conquirqreteuu conquirqreteuu conquirqretueu conquirqretuue conquirqretuue conquirqretueu conquirqreetuu conquirqreetuu
conquirqreeutu conquirqreeuut conquirqreeuut conquirqreeutu conquirqreuetu conquirqreueut conquirqreuteu conquirqreutue
conquirqreuute conquirqreuuet conquirqreueut conquirqreuetu conquirqreuuet conquirqreuute conquirqreutue conquirqreuteu
conquirqeurtue conquirqeurteu conquirqeurute conquirqeuruet conquirqeureut conquirqeuretu conquirqeutrue conquirqeutreu
conquirqeuture conquirqeutuer conquirqeuteur conquirqeuteru conquirqeuutre conquirqeuuter conquirqeuurte conquirqeuuret
conquirqeuuert conquirqeuuetr conquirqeuetur conquirqeuetru conquirqeueutr conquirqeueurt conquirqeuerut conquirqeuertu
conquirqerutue conquirqeruteu conquirqeruute conquirqeruuet conquirqerueut conquirqeruetu conquirqertuue conquirqertueu
conquirqertuue conquirqertueu conquirqerteuu conquirqerteuu conquirqerutue conquirqeruteu conquirqeruute conquirqeruuet
conquirqerueut conquirqeruetu conquirqeretuu conquirqeretuu conquirqereutu conquirqereuut conquirqereuut conquirqereutu
conquirqetruue conquirqetrueu conquirqetruue conquirqetrueu conquirqetreuu conquirqetreuu conquirqeturue conquirqetureu
conquirqetuure conquirqetuuer conquirqetueur conquirqetueru conquirqetuure conquirqetuuer conquirqeturue conquirqetureu
conquirqetueru conquirqetueur conquirqeteuur conquirqeteuru conquirqeteuur conquirqeteuru conquirqeteruu conquirqeteruu
conquirqeurtue conquirqeurteu conquirqeurute conquirqeuruet conquirqeureut conquirqeuretu conquirqeutrue conquirqeutreu
conquirqeuture conquirqeutuer conquirqeuteur conquirqeuteru conquirqeuutre conquirqeuuter conquirqeuurte conquirqeuuret
conquirqeuuert conquirqeuuetr conquirqeuetur conquirqeuetru conquirqeueutr conquirqeueurt conquirqeuerut conquirqeuertu
conquirqeertuu conquirqeertuu conquirqeerutu conquirqeeruut conquirqeeruut conquirqeerutu conquirqeetruu conquirqeetruu
conquirqeeturu conquirqeetuur conquirqeetuur conquirqeeturu conquirqeeutru conquirqeeutur conquirqeeurtu conquirqeeurut
conquirqeeuurt conquirqeeuutr conquirqeeutur conquirqeeutru conquirqeeuutr conquirqeeuurt conquirqeeurut conquirqeeurtu
conquirquurete conquirquureet conquirquurtee conquirquurtee conquirquurete conquirquureet conquirquuerte conquirquueret
conquirquuetre conquirquueter conquirquueetr conquirquueert conquirquutere conquirquuteer conquirquutree conquirquutree
conquirquutere conquirquuteer conquirquueetr conquirquueert conquirquueter conquirquuetre conquirquuerte conquirquueret
conquirquruete conquirqurueet conquirqurutee conquirqurutee conquirquruete conquirqurueet conquirqureute conquirqureuet
conquirquretue conquirqureteu conquirqureetu conquirqureeut conquirqurteue conquirqurteeu conquirqurtuee conquirqurtuee
conquirqurteue conquirqurteeu conquirqureetu conquirqureeut conquirqureteu conquirquretue conquirqureute conquirqureuet
conquirquerute conquirqueruet conquirquertue conquirquerteu conquirqueretu conquirquereut conquirqueurte conquirqueuret
conquirqueutre conquirqueuter conquirqueuetr conquirqueuert conquirqueture conquirquetuer conquirquetrue conquirquetreu
conquirqueteru conquirqueteur conquirqueeutr conquirqueeurt conquirqueetur conquirqueetru conquirqueertu conquirqueerut
conquirqutreue conquirqutreeu conquirqutruee conquirqutruee conquirqutreue conquirqutreeu conquirquterue conquirqutereu
conquirquteure conquirquteuer conquirquteeur conquirquteeru conquirqutuere conquirqutueer conquirquturee conquirquturee
conquirqutuere conquirqutueer conquirquteeur conquirquteeru conquirquteuer conquirquteure conquirquterue conquirqutereu
conquirqueretu conquirquereut conquirquerteu conquirquertue conquirquerute conquirqueruet conquirqueertu conquirqueerut
conquirqueetru conquirqueetur conquirqueeutr conquirqueeurt conquirqueteru conquirqueteur conquirquetreu conquirquetrue
conquirqueture conquirquetuer conquirqueuetr conquirqueuert conquirqueuter conquirqueutre conquirqueurte conquirqueuret
conquirqeureut conquirqeuretu conquirqeuruet conquirqeurute conquirqeurtue conquirqeurteu conquirqeuerut conquirqeuertu
conquirqeueurt conquirqeueutr conquirqeuetur conquirqeuetru conquirqeuuert conquirqeuuetr conquirqeuuret conquirqeuurte
conquirqeuutre conquirqeuuter conquirqeuteur conquirqeuteru conquirqeutuer conquirqeuture conquirqeutrue conquirqeutreu
conquirqerueut conquirqeruetu conquirqeruuet conquirqeruute conquirqerutue conquirqeruteu conquirqereuut conquirqereutu
conquirqereuut conquirqereutu conquirqeretuu conquirqeretuu conquirqerueut conquirqeruetu conquirqeruuet conquirqeruute
conquirqerutue conquirqeruteu conquirqerteuu conquirqerteuu conquirqertueu conquirqertuue conquirqertuue conquirqertueu
conquirqeeruut conquirqeerutu conquirqeeruut conquirqeerutu conquirqeertuu conquirqeertuu conquirqeeurut conquirqeeurtu
conquirqeeuurt conquirqeeuutr conquirqeeutur conquirqeeutru conquirqeeuurt conquirqeeuutr conquirqeeurut conquirqeeurtu
conquirqeeutru conquirqeeutur conquirqeetuur conquirqeeturu conquirqeetuur conquirqeeturu conquirqeetruu conquirqeetruu
conquirqeureut conquirqeuretu conquirqeuruet conquirqeurute conquirqeurtue conquirqeurteu conquirqeuerut conquirqeuertu
conquirqeueurt conquirqeueutr conquirqeuetur conquirqeuetru conquirqeuuert conquirqeuuetr conquirqeuuret conquirqeuurte
conquirqeuutre conquirqeuuter conquirqeuteur conquirqeuteru conquirqeutuer conquirqeuture conquirqeutrue conquirqeutreu
conquirqetreuu conquirqetreuu conquirqetrueu conquirqetruue conquirqetruue conquirqetrueu conquirqeteruu conquirqeteruu
conquirqeteuru conquirqeteuur conquirqeteuur conquirqeteuru conquirqetueru conquirqetueur conquirqetureu conquirqeturue
conquirqetuure conquirqetuuer conquirqetueur conquirqetueru conquirqetuuer conquirqetuure conquirqeturue conquirqetureu
conquiruturqee conquiruturqee conquirutureqe conquirutureeq conquirutureeq conquirutureqe conquirutuqree conquirutuqree
conquirutuqere conquirutuqeer conquirutuqeer conquirutuqere conquirutueqre conquirutueqer conquirutuerqe conquirutuereq
conquirutueerq conquirutueeqr conquirutueqer conquirutueqre conquirutueeqr conquirutueerq conquirutuereq conquirutuerqe
conquirutruqee conquirutruqee conquirutrueqe conquirutrueeq conquirutrueeq conquirutrueqe conquirutrquee conquirutrquee
conquirutrqeue conquirutrqeeu conquirutrqeeu conquirutrqeue conquirutreque conquirutreqeu conquirutreuqe conquirutreueq
conquirutreeuq conquirutreequ conquirutreqeu conquirutreque conquirutreequ conquirutreeuq conquirutreueq conquirutreuqe
conquirutqruee conquirutqruee conquirutqreue conquirutqreeu conquirutqreeu conquirutqreue conquirutquree conquirutquree
conquirutquere conquirutqueer conquirutqueer conquirutquere conquirutqeure conquirutqeuer conquirutqerue conquirutqereu
conquirutqeeru conquirutqeeur conquirutqeuer conquirutqeure conquirutqeeur conquirutqeeru conquirutqereu conquirutqerue
conquiruterque conquiruterqeu conquiruteruqe conquiruterueq conquirutereuq conquiruterequ conquiruteqrue conquiruteqreu
conquirutequre conquirutequer conquiruteqeur conquiruteqeru conquiruteuqre conquiruteuqer conquiruteurqe conquiruteureq
conquiruteuerq conquiruteueqr conquiruteequr conquiruteeqru conquiruteeuqr conquiruteeurq conquiruteeruq conquiruteerqu
conquiruterqeu conquiruterque conquiruterequ conquirutereuq conquiruterueq conquiruteruqe conquiruteqreu conquiruteqrue
conquiruteqeru conquiruteqeur conquirutequer conquirutequre conquiruteeqru conquiruteequr conquiruteerqu conquiruteeruq
conquiruteeurq conquiruteeuqr conquiruteuqer conquiruteuqre conquiruteueqr conquiruteuerq conquiruteureq conquiruteurqe
conquiruutrqee conquiruutrqee conquiruutreqe conquiruutreeq conquiruutreeq conquiruutreqe conquiruutqree conquiruutqree
conquiruutqere conquiruutqeer conquiruutqeer conquiruutqere conquiruuteqre conquiruuteqer conquiruuterqe conquiruutereq
conquiruuteerq conquiruuteeqr conquiruuteqer conquiruuteqre conquiruuteeqr conquiruuteerq conquiruutereq conquiruuterqe
conquiruurtqee conquiruurtqee conquiruurteqe conquiruurteeq conquiruurteeq conquiruurteqe conquiruurqtee conquiruurqtee
conquiruurqete conquiruurqeet conquiruurqeet conquiruurqete conquiruureqte conquiruureqet conquiruuretqe conquiruureteq
conquiruureetq conquiruureeqt conquiruureqet conquiruureqte conquiruureeqt conquiruureetq conquiruureteq conquiruuretqe
conquiruuqrtee conquiruuqrtee conquiruuqrete conquiruuqreet conquiruuqreet conquiruuqrete conquiruuqtree conquiruuqtree
conquiruuqtere conquiruuqteer conquiruuqteer conquiruuqtere conquiruuqetre conquiruuqeter conquiruuqerte conquiruuqeret
conquiruuqeert conquiruuqeetr conquiruuqeter conquiruuqetre conquiruuqeetr conquiruuqeert conquiruuqeret conquiruuqerte
conquiruuerqte conquiruuerqet conquiruuertqe conquiruuerteq conquiruueretq conquiruuereqt conquiruueqrte conquiruueqret
conquiruueqtre conquiruueqter conquiruueqetr conquiruueqert conquiruuetqre conquiruuetqer conquiruuetrqe conquiruuetreq
conquiruueterq conquiruueteqr conquiruueeqtr conquiruueeqrt conquiruueetqr conquiruueetrq conquiruueertq conquiruueerqt
conquiruuerqet conquiruuerqte conquiruuereqt conquiruueretq conquiruuerteq conquiruuertqe conquiruueqret conquiruueqrte
conquiruueqert conquiruueqetr conquiruueqter conquiruueqtre conquiruueeqrt conquiruueeqtr conquiruueerqt conquiruueertq
conquiruueetrq conquiruueetqr conquiruuetqer conquiruuetqre conquiruueteqr conquiruueterq conquiruuetreq conquiruuetrqe
conquirurutqee conquirurutqee conquiruruteqe conquiruruteeq conquiruruteeq conquiruruteqe conquiruruqtee conquiruruqtee
conquiruruqete conquiruruqeet conquiruruqeet conquiruruqete conquirurueqte conquirurueqet conquiruruetqe conquirurueteq
conquirurueetq conquirurueeqt conquirurueqet conquirurueqte conquirurueeqt conquirurueetq conquirurueteq conquiruruetqe
conquirurtuqee conquirurtuqee conquirurtueqe conquirurtueeq conquirurtueeq conquirurtueqe conquirurtquee conquirurtquee
conquirurtqeue conquirurtqeeu conquirurtqeeu conquirurtqeue conquirurteque conquirurteqeu conquirurteuqe conquirurteueq
conquirurteeuq conquirurteequ conquirurteqeu conquirurteque conquirurteequ conquirurteeuq conquirurteueq conquirurteuqe
conquirurqtuee conquirurqtuee conquirurqteue conquirurqteeu conquirurqteeu conquirurqteue conquirurqutee conquirurqutee
conquirurquete conquirurqueet conquirurqueet conquirurquete conquirurqeute conquirurqeuet conquirurqetue conquirurqeteu
conquirurqeetu conquirurqeeut conquirurqeuet conquirurqeute conquirurqeeut conquirurqeetu conquirurqeteu conquirurqetue
conquiruretque conquiruretqeu conquiruretuqe conquiruretueq conquirureteuq conquiruretequ conquirureqtue conquirureqteu
conquirurequte conquirurequet conquirureqeut conquirureqetu conquirureuqte conquirureuqet conquirureutqe conquirureuteq
conquirureuetq conquirureueqt conquirureequt conquirureeqtu conquirureeuqt conquirureeutq conquirureetuq conquirureetqu
conquiruretqeu conquiruretque conquiruretequ conquirureteuq conquiruretueq conquiruretuqe conquirureqteu conquirureqtue
conquirureqetu conquirureqeut conquirurequet conquirurequte conquirureeqtu conquirureequt conquirureetqu conquirureetuq
conquirureeutq conquirureeuqt conquirureuqet conquirureuqte conquirureueqt conquirureuetq conquirureuteq conquirureutqe
conquiruqurtee conquiruqurtee conquiruqurete conquiruqureet conquiruqureet conquiruqurete conquiruqutree conquiruqutree
conquiruqutere conquiruquteer conquiruquteer conquiruqutere conquiruquetre conquiruqueter conquiruquerte conquiruqueret
conquiruqueert conquiruqueetr conquiruqueter conquiruquetre conquiruqueetr conquiruqueert conquiruqueret conquiruquerte
conquiruqrutee conquiruqrutee conquiruqruete conquiruqrueet conquiruqrueet conquiruqruete conquiruqrtuee conquiruqrtuee
conquiruqrteue conquiruqrteeu conquiruqrteeu conquiruqrteue conquiruqretue conquiruqreteu conquiruqreute conquiruqreuet
conquiruqreeut conquiruqreetu conquiruqreteu conquiruqretue conquiruqreetu conquiruqreeut conquiruqreuet conquiruqreute
conquiruqtruee conquiruqtruee conquiruqtreue conquiruqtreeu conquiruqtreeu conquiruqtreue conquiruqturee conquiruqturee
conquiruqtuere conquiruqtueer conquiruqtueer conquiruqtuere conquiruqteure conquiruqteuer conquiruqterue conquiruqtereu
conquiruqteeru conquiruqteeur conquiruqteuer conquiruqteure conquiruqteeur conquiruqteeru conquiruqtereu conquiruqterue
conquiruqertue conquiruqerteu conquiruqerute conquiruqeruet conquiruqereut conquiruqeretu conquiruqetrue conquiruqetreu
conquiruqeture conquiruqetuer conquiruqeteur conquiruqeteru conquiruqeutre conquiruqeuter conquiruqeurte conquiruqeuret
conquiruqeuert conquiruqeuetr conquiruqeetur conquiruqeetru conquiruqeeutr conquiruqeeurt conquiruqeerut conquiruqeertu
conquiruqerteu conquiruqertue conquiruqeretu conquiruqereut conquiruqeruet conquiruqerute conquiruqetreu conquiruqetrue
conquiruqeteru conquiruqeteur conquiruqetuer conquiruqeture conquiruqeetru conquiruqeetur conquiruqeertu conquiruqeerut
conquiruqeeurt conquiruqeeutr conquiruqeuter conquiruqeutre conquiruqeuetr conquiruqeuert conquiruqeuret conquiruqeurte
conquirueurqte conquirueurqet conquirueurtqe conquirueurteq conquirueuretq conquirueureqt conquirueuqrte conquirueuqret
conquirueuqtre conquirueuqter conquirueuqetr conquirueuqert conquirueutqre conquirueutqer conquirueutrqe conquirueutreq
conquirueuterq conquirueuteqr conquirueueqtr conquirueueqrt conquirueuetqr conquirueuetrq conquirueuertq conquirueuerqt
conquirueruqte conquirueruqet conquiruerutqe conquirueruteq conquirueruetq conquiruerueqt conquiruerqute conquiruerquet
conquiruerqtue conquiruerqteu conquiruerqetu conquiruerqeut conquiruertque conquiruertqeu conquiruertuqe conquiruertueq
conquiruerteuq conquiruertequ conquiruereqtu conquiruerequt conquirueretqu conquirueretuq conquiruereutq conquiruereuqt
conquirueqrute conquirueqruet conquirueqrtue conquirueqrteu conquirueqretu conquirueqreut conquiruequrte conquiruequret
conquiruequtre conquiruequter conquiruequetr conquiruequert conquirueqture conquirueqtuer conquirueqtrue conquirueqtreu
conquirueqteru conquirueqteur conquirueqeutr conquirueqeurt conquirueqetur conquirueqetru conquirueqertu conquirueqerut
conquiruetrque conquiruetrqeu conquiruetruqe conquiruetrueq conquiruetreuq conquiruetrequ conquiruetqrue conquiruetqreu
conquiruetqure conquiruetquer conquiruetqeur conquiruetqeru conquiruetuqre conquiruetuqer conquirueturqe conquiruetureq
conquiruetuerq conquiruetueqr conquiruetequr conquirueteqru conquirueteuqr conquirueteurq conquirueteruq conquirueterqu
conquirueerqtu conquirueerqut conquirueertqu conquirueertuq conquirueerutq conquirueeruqt conquirueeqrtu conquirueeqrut
conquirueeqtru conquirueeqtur conquirueequtr conquirueequrt conquirueetqru conquirueetqur conquirueetrqu conquirueetruq
conquirueeturq conquirueetuqr conquirueeuqtr conquirueeuqrt conquirueeutqr conquirueeutrq conquirueeurtq conquirueeurqt
conquirueurqet conquirueurqte conquirueureqt conquirueuretq conquirueurteq conquirueurtqe conquirueuqret conquirueuqrte
conquirueuqert conquirueuqetr conquirueuqter conquirueuqtre conquirueueqrt conquirueueqtr conquirueuerqt conquirueuertq
conquirueuetrq conquirueuetqr conquirueutqer conquirueutqre conquirueuteqr conquirueuterq conquirueutreq conquirueutrqe
conquirueruqet conquirueruqte conquiruerueqt conquirueruetq conquirueruteq conquiruerutqe conquiruerquet conquiruerqute
conquiruerqeut conquiruerqetu conquiruerqteu conquiruerqtue conquiruerequt conquiruereqtu conquiruereuqt conquiruereutq
conquirueretuq conquirueretqu conquiruertqeu conquiruertque conquiruertequ conquiruerteuq conquiruertueq conquiruertuqe
conquirueqruet conquirueqrute conquirueqreut conquirueqretu conquirueqrteu conquirueqrtue conquiruequret conquiruequrte
conquiruequert conquiruequetr conquiruequter conquiruequtre conquirueqeurt conquirueqeutr conquirueqerut conquirueqertu
conquirueqetru conquirueqetur conquirueqtuer conquirueqture conquirueqteur conquirueqteru conquirueqtreu conquirueqtrue
conquirueerqut conquirueerqtu conquirueeruqt conquirueerutq conquirueertuq conquirueertqu conquirueeqrut conquirueeqrtu
conquirueequrt conquirueequtr conquirueeqtur conquirueeqtru conquirueeuqrt conquirueeuqtr conquirueeurqt conquirueeurtq
conquirueeutrq conquirueeutqr conquirueetqur conquirueetqru conquirueetuqr conquirueeturq conquirueetruq conquirueetrqu
conquiruetrqeu conquiruetrque conquiruetrequ conquiruetreuq conquiruetrueq conquiruetruqe conquiruetqreu conquiruetqrue
conquiruetqeru conquiruetqeur conquiruetquer conquiruetqure conquirueteqru conquiruetequr conquirueterqu conquirueteruq
conquirueteurq conquirueteuqr conquiruetuqer conquiruetuqre conquiruetueqr conquiruetuerq conquiruetureq conquirueturqe
conquireturque conquireturqeu conquireturuqe conquireturueq conquiretureuq conquireturequ conquiretuqrue conquiretuqreu
conquiretuqure conquiretuquer conquiretuqeur conquiretuqeru conquiretuuqre conquiretuuqer conquiretuurqe conquiretuureq
conquiretuuerq conquiretuueqr conquiretuequr conquiretueqru conquiretueuqr conquiretueurq conquiretueruq conquiretuerqu
conquiretruque conquiretruqeu conquiretruuqe conquiretruueq conquiretrueuq conquiretruequ conquiretrquue conquiretrqueu
conquiretrquue conquiretrqueu conquiretrqeuu conquiretrqeuu conquiretruque conquiretruqeu conquiretruuqe conquiretruueq
conquiretrueuq conquiretruequ conquiretrequu conquiretrequu conquiretreuqu conquiretreuuq conquiretreuuq conquiretreuqu
conquiretqruue conquiretqrueu conquiretqruue conquiretqrueu conquiretqreuu conquiretqreuu conquiretqurue conquiretqureu
conquiretquure conquiretquuer conquiretqueur conquiretqueru conquiretquure conquiretquuer conquiretqurue conquiretqureu
conquiretqueru conquiretqueur conquiretqeuur conquiretqeuru conquiretqeuur conquiretqeuru conquiretqeruu conquiretqeruu
conquireturque conquireturqeu conquireturuqe conquireturueq conquiretureuq conquireturequ conquiretuqrue conquiretuqreu
conquiretuqure conquiretuquer conquiretuqeur conquiretuqeru conquiretuuqre conquiretuuqer conquiretuurqe conquiretuureq
conquiretuuerq conquiretuueqr conquiretuequr conquiretueqru conquiretueuqr conquiretueurq conquiretueruq conquiretuerqu
conquireterquu conquireterquu conquireteruqu conquireteruuq conquireteruuq conquireteruqu conquireteqruu conquireteqruu
conquiretequru conquiretequur conquiretequur conquiretequru conquireteuqru conquireteuqur conquireteurqu conquireteuruq
conquireteuurq conquireteuuqr conquireteuqur conquireteuqru conquireteuuqr conquireteuurq conquireteuruq conquireteurqu
conquireutrque conquireutrqeu conquireutruqe conquireutrueq conquireutreuq conquireutrequ conquireutqrue conquireutqreu
conquireutqure conquireutquer conquireutqeur conquireutqeru conquireutuqre conquireutuqer conquireuturqe conquireutureq
conquireutuerq conquireutueqr conquireutequr conquireuteqru conquireuteuqr conquireuteurq conquireuteruq conquireuterqu
conquireurtque conquireurtqeu conquireurtuqe conquireurtueq conquireurteuq conquireurtequ conquireurqtue conquireurqteu
conquireurqute conquireurquet conquireurqeut conquireurqetu conquireuruqte conquireuruqet conquireurutqe conquireuruteq
conquireuruetq conquireurueqt conquireurequt conquireureqtu conquireureuqt conquireureutq conquireuretuq conquireuretqu
conquireuqrtue conquireuqrteu conquireuqrute conquireuqruet conquireuqreut conquireuqretu conquireuqtrue conquireuqtreu
conquireuqture conquireuqtuer conquireuqteur conquireuqteru conquireuqutre conquireuquter conquireuqurte conquireuquret
conquireuquert conquireuquetr conquireuqetur conquireuqetru conquireuqeutr conquireuqeurt conquireuqerut conquireuqertu
conquireuurqte conquireuurqet conquireuurtqe conquireuurteq conquireuuretq conquireuureqt conquireuuqrte conquireuuqret
conquireuuqtre conquireuuqter conquireuuqetr conquireuuqert conquireuutqre conquireuutqer conquireuutrqe conquireuutreq
conquireuuterq conquireuuteqr conquireuueqtr conquireuueqrt conquireuuetqr conquireuuetrq conquireuuertq conquireuuerqt
conquireuerqut conquireuerqtu conquireueruqt conquireuerutq conquireuertuq conquireuertqu conquireueqrut conquireueqrtu
conquireuequrt conquireuequtr conquireueqtur conquireueqtru conquireueuqrt conquireueuqtr conquireueurqt conquireueurtq
conquireueutrq conquireueutqr conquireuetqur conquireuetqru conquireuetuqr conquireueturq conquireuetruq conquireuetrqu
conquirerutque conquirerutqeu conquirerutuqe conquirerutueq conquireruteuq conquirerutequ conquireruqtue conquireruqteu
conquireruqute conquireruquet conquireruqeut conquireruqetu conquireruuqte conquireruuqet conquireruutqe conquireruuteq
conquireruuetq conquireruueqt conquireruequt conquirerueqtu conquirerueuqt conquirerueutq conquireruetuq conquireruetqu
conquirertuque conquirertuqeu conquirertuuqe conquirertuueq conquirertueuq conquirertuequ conquirertquue conquirertqueu
conquirertquue conquirertqueu conquirertqeuu conquirertqeuu conquirertuque conquirertuqeu conquirertuuqe conquirertuueq
conquirertueuq conquirertuequ conquirertequu conquirertequu conquirerteuqu conquirerteuuq conquirerteuuq conquirerteuqu
conquirerqtuue conquirerqtueu conquirerqtuue conquirerqtueu conquirerqteuu conquirerqteuu conquirerqutue conquirerquteu
conquirerquute conquirerquuet conquirerqueut conquirerquetu conquirerquute conquirerquuet conquirerqutue conquirerquteu
conquirerquetu conquirerqueut conquirerqeuut conquirerqeutu conquirerqeuut conquirerqeutu conquirerqetuu conquirerqetuu
conquirerutque conquirerutqeu conquirerutuqe conquirerutueq conquireruteuq conquirerutequ conquireruqtue conquireruqteu
conquireruqute conquireruquet conquireruqeut conquireruqetu conquireruuqte conquireruuqet conquireruutqe conquireruuteq
conquireruuetq conquireruueqt conquireruequt conquirerueqtu conquirerueuqt conquirerueutq conquireruetuq conquireruetqu
conquireretquu conquireretquu conquireretuqu conquireretuuq conquireretuuq conquireretuqu conquirereqtuu conquirereqtuu
conquirerequtu conquirerequut conquirerequut conquirerequtu conquirereuqtu conquirereuqut conquirereutqu conquirereutuq
conquirereuutq conquirereuuqt conquirereuqut conquirereuqtu conquirereuuqt conquirereuutq conquirereutuq conquirereutqu
conquirequrtue conquirequrteu conquirequrute conquirequruet conquirequreut conquirequretu conquirequtrue conquirequtreu
conquirequture conquirequtuer conquirequteur conquirequteru conquirequutre conquirequuter conquirequurte conquirequuret
conquirequuert conquirequuetr conquirequetur conquirequetru conquirequeutr conquirequeurt conquirequerut conquirequertu
conquireqrutue conquireqruteu conquireqruute conquireqruuet conquireqrueut conquireqruetu conquireqrtuue conquireqrtueu
conquireqrtuue conquireqrtueu conquireqrteuu conquireqrteuu conquireqrutue conquireqruteu conquireqruute conquireqruuet
conquireqrueut conquireqruetu conquireqretuu conquireqretuu conquireqreutu conquireqreuut conquireqreuut conquireqreutu
conquireqtruue conquireqtrueu conquireqtruue conquireqtrueu conquireqtreuu conquireqtreuu conquireqturue conquireqtureu
conquireqtuure conquireqtuuer conquireqtueur conquireqtueru conquireqtuure conquireqtuuer conquireqturue conquireqtureu
conquireqtueru conquireqtueur conquireqteuur conquireqteuru conquireqteuur conquireqteuru conquireqteruu conquireqteruu
conquirequrtue conquirequrteu conquirequrute conquirequruet conquirequreut conquirequretu conquirequtrue conquirequtreu
conquirequture conquirequtuer conquirequteur conquirequteru conquirequutre conquirequuter conquirequurte conquirequuret
conquirequuert conquirequuetr conquirequetur conquirequetru conquirequeutr conquirequeurt conquirequerut conquirequertu
conquireqertuu conquireqertuu conquireqerutu conquireqeruut conquireqeruut conquireqerutu conquireqetruu conquireqetruu
conquireqeturu conquireqetuur conquireqetuur conquireqeturu conquireqeutru conquireqeutur conquireqeurtu conquireqeurut
conquireqeuurt conquireqeuutr conquireqeutur conquireqeutru conquireqeuutr conquireqeuurt conquireqeurut conquireqeurtu
conquireuurqte conquireuurqet conquireuurtqe conquireuurteq conquireuuretq conquireuureqt conquireuuqrte conquireuuqret
conquireuuqtre conquireuuqter conquireuuqetr conquireuuqert conquireuutqre conquireuutqer conquireuutrqe conquireuutreq
conquireuuterq conquireuuteqr conquireuueqtr conquireuueqrt conquireuuetqr conquireuuetrq conquireuuertq conquireuuerqt
conquireuruqte conquireuruqet conquireurutqe conquireuruteq conquireuruetq conquireurueqt conquireurqute conquireurquet
conquireurqtue conquireurqteu conquireurqetu conquireurqeut conquireurtque conquireurtqeu conquireurtuqe conquireurtueq
conquireurteuq conquireurtequ conquireureqtu conquireurequt conquireuretqu conquireuretuq conquireureutq conquireureuqt
conquireuqrute conquireuqruet conquireuqrtue conquireuqrteu conquireuqretu conquireuqreut conquireuqurte conquireuquret
conquireuqutre conquireuquter conquireuquetr conquireuquert conquireuqture conquireuqtuer conquireuqtrue conquireuqtreu
conquireuqteru conquireuqteur conquireuqeutr conquireuqeurt conquireuqetur conquireuqetru conquireuqertu conquireuqerut
conquireutrque conquireutrqeu conquireutruqe conquireutrueq conquireutreuq conquireutrequ conquireutqrue conquireutqreu
conquireutqure conquireutquer conquireutqeur conquireutqeru conquireutuqre conquireutuqer conquireuturqe conquireutureq
conquireutuerq conquireutueqr conquireutequr conquireuteqru conquireuteuqr conquireuteurq conquireuteruq conquireuterqu
conquireuerqtu conquireuerqut conquireuertqu conquireuertuq conquireuerutq conquireueruqt conquireueqrtu conquireueqrut
conquireueqtru conquireueqtur conquireuequtr conquireuequrt conquireuetqru conquireuetqur conquireuetrqu conquireuetruq
conquireueturq conquireuetuqr conquireueuqtr conquireueuqrt conquireueutqr conquireueutrq conquireueurtq conquireueurqt
conquireeurqut conquireeurqtu conquireeuruqt conquireeurutq conquireeurtuq conquireeurtqu conquireeuqrut conquireeuqrtu
conquireeuqurt conquireeuqutr conquireeuqtur conquireeuqtru conquireeuuqrt conquireeuuqtr conquireeuurqt conquireeuurtq
conquireeuutrq conquireeuutqr conquireeutqur conquireeutqru conquireeutuqr conquireeuturq conquireeutruq conquireeutrqu
conquireeruqut conquireeruqtu conquireeruuqt conquireeruutq conquireerutuq conquireerutqu conquireerquut conquireerqutu
conquireerquut conquireerqutu conquireerqtuu conquireerqtuu conquireeruqut conquireeruqtu conquireeruuqt conquireeruutq
conquireerutuq conquireerutqu conquireertquu conquireertquu conquireertuqu conquireertuuq conquireertuuq conquireertuqu
conquireeqruut conquireeqrutu conquireeqruut conquireeqrutu conquireeqrtuu conquireeqrtuu conquireequrut conquireequrtu
conquireequurt conquireequutr conquireequtur conquireequtru conquireequurt conquireequutr conquireequrut conquireequrtu
conquireequtru conquireequtur conquireeqtuur conquireeqturu conquireeqtuur conquireeqturu conquireeqtruu conquireeqtruu
conquireeurqut conquireeurqtu conquireeuruqt conquireeurutq conquireeurtuq conquireeurtqu conquireeuqrut conquireeuqrtu
conquireeuqurt conquireeuqutr conquireeuqtur conquireeuqtru conquireeuuqrt conquireeuuqtr conquireeuurqt conquireeuurtq
conquireeuutrq conquireeuutqr conquireeutqur conquireeutqru conquireeutuqr conquireeuturq conquireeutruq conquireeutrqu
conquireetrquu conquireetrquu conquireetruqu conquireetruuq conquireetruuq conquireetruqu conquireetqruu conquireetqruu
conquireetquru conquireetquur conquireetquur conquireetquru conquireetuqru conquireetuqur conquireeturqu conquireeturuq
conquireetuurq conquireetuuqr conquireetuqur conquireetuqru conquireetuuqr conquireetuurq conquireeturuq conquireeturqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us