easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

ponyboy

unweelness

pyrolusite

sikel

unsmeared

longaevo

compends

borowska

cobwebbery

scoreboards

offcasts

superabat

nonpunctuation

intersessional

macrochiroptera

euphenic

imperaveratque

grossest


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: commeatumque
cipher variations:
dpnnfbuvnrvf eqoogcvwoswg frpphdwxptxh gsqqiexyquyi htrrjfyzrvzj
iusskgzaswak jvttlhabtxbl kwuumibcuycm lxvvnjcdvzdn mywwokdewaeo
nzxxplefxbfp oayyqmfgycgq pbzzrnghzdhr qcaasohiaeis rdbbtpijbfjt
seccuqjkcgku tfddvrkldhlv ugeewslmeimw vhffxtmnfjnx wiggyunogkoy
xjhhzvophlpz ykiiawpqimqa zljjbxqrjnrb amkkcyrskosc bnlldzstlptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: commeatumque
Cipher: xlnnvzgfnjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: commeatumque
Cipher: AAABA ABBAB ABABB ABABB AABAA AAAAA BAABA BAABB ABABB ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: commeatumque
cipher variations:
dpnnfbuvnrvfhrllnbgjlxjnltjjvbsxjdxvpvhhdbelhjldtxfflbqzfpzlxzddtbcndvntfdzzjbapzhpjjfxxrbmdxndr
nhvvzbyrvtrzrjtthbkftzfhvlrrpbwtrftpznppxbihplhxeqoogcvwoswgismmochkmykomukkwctykeywqwiiecfmikme
uyggmcragqamyaeeucdoewougeaakcbqaiqkkgyyscneyoesoiwwaczswusaskuuiclguagiwmssqcxusguqaoqqycjiqmiy
frpphdwxptxhjtnnpdilnzlpnvllxduzlfzxrxjjfdgnjlnfvzhhndsbhrbnzbffvdepfxpvhfbbldcrbjrllhzztdofzpft
pjxxbdatxvtbtlvvjdmhvbhjxnttrdyvthvrbprrzdkjrnjzgsqqiexyquyikuooqejmoamqowmmyevamgaysykkgehokmog
waiioetciscoacggwefqgyqwigccmedscksmmiaauepgaqguqkyycebuywucumwwkeniwcikyouusezwuiwscqssaelksoka
htrrjfyzrvzjlvpprfknpbnrpxnnzfwbnhbztzllhfiplnphxbjjpfudjtdpbdhhxfgrhzrxjhddnfetdltnnjbbvfqhbrhv
rlzzdfcvzxvdvnxxlfojxdjlzpvvtfaxvjxtdrttbfmltplbiusskgzaswakmwqqsgloqcosqyooagxcoicauammigjqmoqi
yckkqgvekueqceiiyghsiasykieeogfuemuookccwgricsiwsmaaegdwaywewoyymgpkyekmaqwwugbywkyuesuucgnmuqmc
jvttlhabtxblnxrrthmprdptrzppbhydpjdbvbnnjhkrnprjzdllrhwflvfrdfjjzhitjbtzljffphgvfnvpplddxhsjdtjx
tnbbfhexbzxfxpzznhqlzflnbrxxvhczxlzvftvvdhonvrndkwuumibcuycmoyssuinqsequsaqqcizeqkecwcookilsoqsk
aemmsixgmwgsegkkaijukcuamkggqihwgowqqmeeyitkeukyuoccgifycaygyqaaoirmagmocsyywidaymawguwweipowsoe
lxvvnjcdvzdnpzttvjortfrvtbrrdjafrlfdxdppljmtprtlbfnntjyhnxhtfhllbjkvldvbnlhhrjixhpxrrnffzjulfvlz
vpddhjgzdbzhzrbbpjsnbhnpdtzzxjebznbxhvxxfjqpxtpfmywwokdewaeoqauuwkpsugswucssekbgsmgeyeqqmknuqsum
cgooukzioyiugimmcklwmewcomiiskjyiqyssoggakvmgwmawqeeikhaecaiasccqktocioqeuaaykfcaocyiwyygkrqyuqg
nzxxplefxbfprbvvxlqtvhtxvdttflchtnhfzfrrnlovrtvndhppvlajpzjvhjnndlmxnfxdpnjjtlkzjrzttphhblwnhxnb
xrffjlibfdbjbtddrlupdjprfvbbzlgdbpdzjxzzhlsrzvrhoayyqmfgycgqscwwymruwiuyweuugmdiuoigagssompwsuwo
eiqqwmbkqakwikooemnyogyeqokkumlaksauuqiicmxoiyocysggkmjcgeckcueesmvqekqsgwccamhecqeakyaaimtsawsi
pbzzrnghzdhrtdxxznsvxjvzxfvvhnejvpjhbhttpnqxtvxpfjrrxnclrblxjlppfnozphzfrpllvnmbltbvvrjjdnypjzpd
zthhlnkdhfdldvfftnwrflrthxddbnifdrfblzbbjnutbxtjqcaasohiaeisueyyaotwykwaygwwiofkwqkiciuuqoryuwyq
gkssyodmscmykmqqgopaqiagsqmmwoncmucwwskkeozqkaqeauiimoleigemewgguoxsgmsuiyeecojgesgcmacckovucyuk
rdbbtpijbfjtvfzzbpuxzlxbzhxxjpglxrljdjvvrpszvxzrhlttzpentdnzlnrrhpqbrjbhtrnnxpodnvdxxtllfparlbrf
bvjjnpmfjhfnfxhhvpythntvjzffdpkhfthdnbddlpwvdzvlseccuqjkcgkuwgaacqvyamycaiyykqhmysmkekwwsqtawyas
imuuaqfoueoamossiqrcskciusooyqpeoweyyummgqbsmcsgcwkkoqngkigogyiiwqzuiouwkaggeqliguieoceemqxweawm
tfddvrkldhlvxhbbdrwzbnzdbjzzlrinztnlflxxtrubxzbtjnvvbrgpvfpbnpttjrsdtldjvtppzrqfpxfzzvnnhrctndth
dxllprohljhphzjjxravjpvxlbhhfrmjhvjfpdffnryxfbxnugeewslmeimwyiccesxacoaeckaamsjoauomgmyyusvcyacu
kowwcshqwgqcoquuksteumekwuqqasrgqygaawooisduoeuieymmqspimkiqiakkysbwkqwymciigsnkiwkgqeggoszygcyo
vhffxtmnfjnxzjddftybdpbfdlbbntkpbvpnhnzzvtwdzbdvlpxxdtirxhrdprvvltufvnflxvrrbtshrzhbbxppjtevpfvj
fznnrtqjnljrjbllztcxlrxzndjjhtoljxlhrfhhptazhdzpwiggyunogkoyakeeguzceqcgemccoulqcwqoioaawuxeacew
mqyyeujsyiseqswwmuvgwogmywsscutisaiccyqqkufwqgwkgaoosurkomkskcmmaudymsyaoekkiupmkymisgiiqubaieaq
xjhhzvophlpzblffhvadfrdhfnddpvmrdxrpjpbbxvyfbdfxnrzzfvktzjtfrtxxnvwhxphnzxttdvujtbjddzrrlvgxrhxl
hbpptvslpnltldnnbvezntzbpflljvqnlznjthjjrvcbjfbrykiiawpqimqacmggiwbegseigoeeqwnseysqkqccywzgcegy
osaagwluakugsuyyowxiyqioayuuewvkuckeeassmwhysiymicqquwtmqomumeoocwfaouacqgmmkwromaokuikkswdckgcs
zljjbxqrjnrbdnhhjxcfhtfjhpffrxotfztrlrddzxahdfhzptbbhxmvblvhtvzzpxyjzrjpbzvvfxwlvdlffbttnxiztjzn
jdrrvxunrpnvnfppdxgbpvbdrhnnlxspnbplvjlltxedlhdtamkkcyrskosceoiikydgiugkiqggsypugausmseeaybiegia
qucciynwcmwiuwaaqyzkaskqcawwgyxmwemggcuuoyjaukaokesswyvosqowogqqeyhcqwcesioomytqocqmwkmmuyfemieu
bnlldzstlptdfpjjlzehjvhljrhhtzqvhbvtntffbzcjfhjbrvddjzoxdnxjvxbbrzalbtlrdbxxhzynxfnhhdvvpzkbvlbp
lfttxzwptrpxphrrfzidrxdftjppnzurpdrnxlnnvzgfnjfvcommeatumquegqkkmafikwimksiiuarwicwuouggcadkgikc
sweekapyeoykwyccsabmcumsecyyiazoygoiiewwqalcwmcqmguuyaxqusqyqissgajesyegukqqoavsqesoymoowahgokgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: commeatumque
Cipher: pbzzrnghzdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: commeatumque
Cipher: 314323235111445423145451

Extended Methods:
Method #1

Plaintext: commeatumque
method variations:
htrrkfyzrvzknywwpldewaepsdbbuqikbfkuxiggzvopglpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
c o m m e a t u m q u e 
3 4 2 2 5 1 4 5 2 1 5 5 
1 3 3 3 1 1 4 4 3 4 4 1 
They are then read out in rows:
342251452155133311443441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: commeatumque
Cipher: sgeybzlnatsd

Read more ...
Method #3

Plaintext: commeatumque
method variations:
qhhxaqyicyyl hhxaqyicyylq hxaqyicyylqh
xaqyicyylqhh aqyicyylqhhx qyicyylqhhxa
yicyylqhhxaq icyylqhhxaqy cyylqhhxaqyi
yylqhhxaqyic ylqhhxaqyicy lqhhxaqyicyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: commeatumque

first 5040 cipher variations(475687488 total)
commeatumque commeatumqeu commeatumuqe commeatumueq commeatumeuq commeatumequ commeatuqmue commeatuqmeu commeatuqume
commeatuquem commeatuqeum commeatuqemu commeatuuqme commeatuuqem commeatuumqe commeatuumeq commeatuuemq commeatuueqm
commeatuequm commeatueqmu commeatueuqm commeatueumq commeatuemuq commeatuemqu commeatmuque commeatmuqeu commeatmuuqe
commeatmuueq commeatmueuq commeatmuequ commeatmquue commeatmqueu commeatmquue commeatmqueu commeatmqeuu commeatmqeuu
commeatmuque commeatmuqeu commeatmuuqe commeatmuueq commeatmueuq commeatmuequ commeatmequu commeatmequu commeatmeuqu
commeatmeuuq commeatmeuuq commeatmeuqu commeatqmuue commeatqmueu commeatqmuue commeatqmueu commeatqmeuu commeatqmeuu
commeatqumue commeatqumeu commeatquume commeatquuem commeatqueum commeatquemu commeatquume commeatquuem commeatqumue
commeatqumeu commeatquemu commeatqueum commeatqeuum commeatqeumu commeatqeuum commeatqeumu commeatqemuu commeatqemuu
commeatumque commeatumqeu commeatumuqe commeatumueq commeatumeuq commeatumequ commeatuqmue commeatuqmeu commeatuqume
commeatuquem commeatuqeum commeatuqemu commeatuuqme commeatuuqem commeatuumqe commeatuumeq commeatuuemq commeatuueqm
commeatuequm commeatueqmu commeatueuqm commeatueumq commeatuemuq commeatuemqu commeatemquu commeatemquu commeatemuqu
commeatemuuq commeatemuuq commeatemuqu commeateqmuu commeateqmuu commeatequmu commeatequum commeatequum commeatequmu
commeateuqmu commeateuqum commeateumqu commeateumuq commeateuumq commeateuuqm commeateuqum commeateuqmu commeateuuqm
commeateuumq commeateumuq commeateumqu commeautmque commeautmqeu commeautmuqe commeautmueq commeautmeuq commeautmequ
commeautqmue commeautqmeu commeautqume commeautquem commeautqeum commeautqemu commeautuqme commeautuqem commeautumqe
commeautumeq commeautuemq commeautueqm commeautequm commeauteqmu commeauteuqm commeauteumq commeautemuq commeautemqu
commeaumtque commeaumtqeu commeaumtuqe commeaumtueq commeaumteuq commeaumtequ commeaumqtue commeaumqteu commeaumqute
commeaumquet commeaumqeut commeaumqetu commeaumuqte commeaumuqet commeaumutqe commeaumuteq commeaumuetq commeaumueqt
commeaumequt commeaumeqtu commeaumeuqt commeaumeutq commeaumetuq commeaumetqu commeauqmtue commeauqmteu commeauqmute
commeauqmuet commeauqmeut commeauqmetu commeauqtmue commeauqtmeu commeauqtume commeauqtuem commeauqteum commeauqtemu
commeauqutme commeauqutem commeauqumte commeauqumet commeauquemt commeauquetm commeauqetum commeauqetmu commeauqeutm
commeauqeumt commeauqemut commeauqemtu commeauumqte commeauumqet commeauumtqe commeauumteq commeauumetq commeauumeqt
commeauuqmte commeauuqmet commeauuqtme commeauuqtem commeauuqetm commeauuqemt commeauutqme commeauutqem commeauutmqe
commeauutmeq commeauutemq commeauuteqm commeauueqtm commeauueqmt commeauuetqm commeauuetmq commeauuemtq commeauuemqt
commeauemqut commeauemqtu commeauemuqt commeauemutq commeauemtuq commeauemtqu commeaueqmut commeaueqmtu commeauequmt
commeauequtm commeaueqtum commeaueqtmu commeaueuqmt commeaueuqtm commeaueumqt commeaueumtq commeaueutmq commeaueutqm
commeauetqum commeauetqmu commeauetuqm commeauetumq commeauetmuq commeauetmqu commeamutque commeamutqeu commeamutuqe
commeamutueq commeamuteuq commeamutequ commeamuqtue commeamuqteu commeamuqute commeamuquet commeamuqeut commeamuqetu
commeamuuqte commeamuuqet commeamuutqe commeamuuteq commeamuuetq commeamuueqt commeamuequt commeamueqtu commeamueuqt
commeamueutq commeamuetuq commeamuetqu commeamtuque commeamtuqeu commeamtuuqe commeamtuueq commeamtueuq commeamtuequ
commeamtquue commeamtqueu commeamtquue commeamtqueu commeamtqeuu commeamtqeuu commeamtuque commeamtuqeu commeamtuuqe
commeamtuueq commeamtueuq commeamtuequ commeamtequu commeamtequu commeamteuqu commeamteuuq commeamteuuq commeamteuqu
commeamqtuue commeamqtueu commeamqtuue commeamqtueu commeamqteuu commeamqteuu commeamqutue commeamquteu commeamquute
commeamquuet commeamqueut commeamquetu commeamquute commeamquuet commeamqutue commeamquteu commeamquetu commeamqueut
commeamqeuut commeamqeutu commeamqeuut commeamqeutu commeamqetuu commeamqetuu commeamutque commeamutqeu commeamutuqe
commeamutueq commeamuteuq commeamutequ commeamuqtue commeamuqteu commeamuqute commeamuquet commeamuqeut commeamuqetu
commeamuuqte commeamuuqet commeamuutqe commeamuuteq commeamuuetq commeamuueqt commeamuequt commeamueqtu commeamueuqt
commeamueutq commeamuetuq commeamuetqu commeametquu commeametquu commeametuqu commeametuuq commeametuuq commeametuqu
commeameqtuu commeameqtuu commeamequtu commeamequut commeamequut commeamequtu commeameuqtu commeameuqut commeameutqu
commeameutuq commeameuutq commeameuuqt commeameuqut commeameuqtu commeameuuqt commeameuutq commeameutuq commeameutqu
commeaqumtue commeaqumteu commeaqumute commeaqumuet commeaqumeut commeaqumetu commeaqutmue commeaqutmeu commeaqutume
commeaqutuem commeaquteum commeaqutemu commeaquutme commeaquutem commeaquumte commeaquumet commeaquuemt commeaquuetm
commeaquetum commeaquetmu commeaqueutm commeaqueumt commeaquemut commeaquemtu commeaqmutue commeaqmuteu commeaqmuute
commeaqmuuet commeaqmueut commeaqmuetu commeaqmtuue commeaqmtueu commeaqmtuue commeaqmtueu commeaqmteuu commeaqmteuu
commeaqmutue commeaqmuteu commeaqmuute commeaqmuuet commeaqmueut commeaqmuetu commeaqmetuu commeaqmetuu commeaqmeutu
commeaqmeuut commeaqmeuut commeaqmeutu commeaqtmuue commeaqtmueu commeaqtmuue commeaqtmueu commeaqtmeuu commeaqtmeuu
commeaqtumue commeaqtumeu commeaqtuume commeaqtuuem commeaqtueum commeaqtuemu commeaqtuume commeaqtuuem commeaqtumue
commeaqtumeu commeaqtuemu commeaqtueum commeaqteuum commeaqteumu commeaqteuum commeaqteumu commeaqtemuu commeaqtemuu
commeaqumtue commeaqumteu commeaqumute commeaqumuet commeaqumeut commeaqumetu commeaqutmue commeaqutmeu commeaqutume
commeaqutuem commeaquteum commeaqutemu commeaquutme commeaquutem commeaquumte commeaquumet commeaquuemt commeaquuetm
commeaquetum commeaquetmu commeaqueutm commeaqueumt commeaquemut commeaquemtu commeaqemtuu commeaqemtuu commeaqemutu
commeaqemuut commeaqemuut commeaqemutu commeaqetmuu commeaqetmuu commeaqetumu commeaqetuum commeaqetuum commeaqetumu
commeaqeutmu commeaqeutum commeaqeumtu commeaqeumut commeaqeuumt commeaqeuutm commeaqeutum commeaqeutmu commeaqeuutm
commeaqeuumt commeaqeumut commeaqeumtu commeauumqte commeauumqet commeauumtqe commeauumteq commeauumetq commeauumeqt
commeauuqmte commeauuqmet commeauuqtme commeauuqtem commeauuqetm commeauuqemt commeauutqme commeauutqem commeauutmqe
commeauutmeq commeauutemq commeauuteqm commeauueqtm commeauueqmt commeauuetqm commeauuetmq commeauuemtq commeauuemqt
commeaumuqte commeaumuqet commeaumutqe commeaumuteq commeaumuetq commeaumueqt commeaumqute commeaumquet commeaumqtue
commeaumqteu commeaumqetu commeaumqeut commeaumtque commeaumtqeu commeaumtuqe commeaumtueq commeaumteuq commeaumtequ
commeaumeqtu commeaumequt commeaumetqu commeaumetuq commeaumeutq commeaumeuqt commeauqmute commeauqmuet commeauqmtue
commeauqmteu commeauqmetu commeauqmeut commeauqumte commeauqumet commeauqutme commeauqutem commeauquetm commeauquemt
commeauqtume commeauqtuem commeauqtmue commeauqtmeu commeauqtemu commeauqteum commeauqeutm commeauqeumt commeauqetum
commeauqetmu commeauqemtu commeauqemut commeautmque commeautmqeu commeautmuqe commeautmueq commeautmeuq commeautmequ
commeautqmue commeautqmeu commeautqume commeautquem commeautqeum commeautqemu commeautuqme commeautuqem commeautumqe
commeautumeq commeautuemq commeautueqm commeautequm commeauteqmu commeauteuqm commeauteumq commeautemuq commeautemqu
commeauemqtu commeauemqut commeauemtqu commeauemtuq commeauemutq commeauemuqt commeaueqmtu commeaueqmut commeaueqtmu
commeaueqtum commeauequtm commeauequmt commeauetqmu commeauetqum commeauetmqu commeauetmuq commeauetumq commeauetuqm
commeaueuqtm commeaueuqmt commeaueutqm commeaueutmq commeaueumtq commeaueumqt commeaeumqut commeaeumqtu commeaeumuqt
commeaeumutq commeaeumtuq commeaeumtqu commeaeuqmut commeaeuqmtu commeaeuqumt commeaeuqutm commeaeuqtum commeaeuqtmu
commeaeuuqmt commeaeuuqtm commeaeuumqt commeaeuumtq commeaeuutmq commeaeuutqm commeaeutqum commeaeutqmu commeaeutuqm
commeaeutumq commeaeutmuq commeaeutmqu commeaemuqut commeaemuqtu commeaemuuqt commeaemuutq commeaemutuq commeaemutqu
commeaemquut commeaemqutu commeaemquut commeaemqutu commeaemqtuu commeaemqtuu commeaemuqut commeaemuqtu commeaemuuqt
commeaemuutq commeaemutuq commeaemutqu commeaemtquu commeaemtquu commeaemtuqu commeaemtuuq commeaemtuuq commeaemtuqu
commeaeqmuut commeaeqmutu commeaeqmuut commeaeqmutu commeaeqmtuu commeaeqmtuu commeaequmut commeaequmtu commeaequumt
commeaequutm commeaequtum commeaequtmu commeaequumt commeaequutm commeaequmut commeaequmtu commeaequtmu commeaequtum
commeaeqtuum commeaeqtumu commeaeqtuum commeaeqtumu commeaeqtmuu commeaeqtmuu commeaeumqut commeaeumqtu commeaeumuqt
commeaeumutq commeaeumtuq commeaeumtqu commeaeuqmut commeaeuqmtu commeaeuqumt commeaeuqutm commeaeuqtum commeaeuqtmu
commeaeuuqmt commeaeuuqtm commeaeuumqt commeaeuumtq commeaeuutmq commeaeuutqm commeaeutqum commeaeutqmu commeaeutuqm
commeaeutumq commeaeutmuq commeaeutmqu commeaetmquu commeaetmquu commeaetmuqu commeaetmuuq commeaetmuuq commeaetmuqu
commeaetqmuu commeaetqmuu commeaetqumu commeaetquum commeaetquum commeaetqumu commeaetuqmu commeaetuqum commeaetumqu
commeaetumuq commeaetuumq commeaetuuqm commeaetuqum commeaetuqmu commeaetuuqm commeaetuumq commeaetumuq commeaetumqu
commetaumque commetaumqeu commetaumuqe commetaumueq commetaumeuq commetaumequ commetauqmue commetauqmeu commetauqume
commetauquem commetauqeum commetauqemu commetauuqme commetauuqem commetauumqe commetauumeq commetauuemq commetauueqm
commetauequm commetaueqmu commetaueuqm commetaueumq commetauemuq commetauemqu commetamuque commetamuqeu commetamuuqe
commetamuueq commetamueuq commetamuequ commetamquue commetamqueu commetamquue commetamqueu commetamqeuu commetamqeuu
commetamuque commetamuqeu commetamuuqe commetamuueq commetamueuq commetamuequ commetamequu commetamequu commetameuqu
commetameuuq commetameuuq commetameuqu commetaqmuue commetaqmueu commetaqmuue commetaqmueu commetaqmeuu commetaqmeuu
commetaqumue commetaqumeu commetaquume commetaquuem commetaqueum commetaquemu commetaquume commetaquuem commetaqumue
commetaqumeu commetaquemu commetaqueum commetaqeuum commetaqeumu commetaqeuum commetaqeumu commetaqemuu commetaqemuu
commetaumque commetaumqeu commetaumuqe commetaumueq commetaumeuq commetaumequ commetauqmue commetauqmeu commetauqume
commetauquem commetauqeum commetauqemu commetauuqme commetauuqem commetauumqe commetauumeq commetauuemq commetauueqm
commetauequm commetaueqmu commetaueuqm commetaueumq commetauemuq commetauemqu commetaemquu commetaemquu commetaemuqu
commetaemuuq commetaemuuq commetaemuqu commetaeqmuu commetaeqmuu commetaequmu commetaequum commetaequum commetaequmu
commetaeuqmu commetaeuqum commetaeumqu commetaeumuq commetaeuumq commetaeuuqm commetaeuqum commetaeuqmu commetaeuuqm
commetaeuumq commetaeumuq commetaeumqu commetuamque commetuamqeu commetuamuqe commetuamueq commetuameuq commetuamequ
commetuaqmue commetuaqmeu commetuaqume commetuaquem commetuaqeum commetuaqemu commetuauqme commetuauqem commetuaumqe
commetuaumeq commetuauemq commetuaueqm commetuaequm commetuaeqmu commetuaeuqm commetuaeumq commetuaemuq commetuaemqu
commetumaque commetumaqeu commetumauqe commetumaueq commetumaeuq commetumaequ commetumqaue commetumqaeu commetumquae
commetumquea commetumqeua commetumqeau commetumuqae commetumuqea commetumuaqe commetumuaeq commetumueaq commetumueqa
commetumequa commetumeqau commetumeuqa commetumeuaq commetumeauq commetumeaqu commetuqmaue commetuqmaeu commetuqmuae
commetuqmuea commetuqmeua commetuqmeau commetuqamue commetuqameu commetuqaume commetuqauem commetuqaeum commetuqaemu
commetuquame commetuquaem commetuqumae commetuqumea commetuquema commetuqueam commetuqeaum commetuqeamu commetuqeuam
commetuqeuma commetuqemua commetuqemau commetuumqae commetuumqea commetuumaqe commetuumaeq commetuumeaq commetuumeqa
commetuuqmae commetuuqmea commetuuqame commetuuqaem commetuuqeam commetuuqema commetuuaqme commetuuaqem commetuuamqe
commetuuameq commetuuaemq commetuuaeqm commetuueqam commetuueqma commetuueaqm commetuueamq commetuuemaq commetuuemqa
commetuemqua commetuemqau commetuemuqa commetuemuaq commetuemauq commetuemaqu commetueqmua commetueqmau commetuequma
commetuequam commetueqaum commetueqamu commetueuqma commetueuqam commetueumqa commetueumaq commetueuamq commetueuaqm
commetueaqum commetueaqmu commetueauqm commetueaumq commetueamuq commetueamqu commetmuaque commetmuaqeu commetmuauqe
commetmuaueq commetmuaeuq commetmuaequ commetmuqaue commetmuqaeu commetmuquae commetmuquea commetmuqeua commetmuqeau
commetmuuqae commetmuuqea commetmuuaqe commetmuuaeq commetmuueaq commetmuueqa commetmuequa commetmueqau commetmueuqa
commetmueuaq commetmueauq commetmueaqu commetmauque commetmauqeu commetmauuqe commetmauueq commetmaueuq commetmauequ
commetmaquue commetmaqueu commetmaquue commetmaqueu commetmaqeuu commetmaqeuu commetmauque commetmauqeu commetmauuqe
commetmauueq commetmaueuq commetmauequ commetmaequu commetmaequu commetmaeuqu commetmaeuuq commetmaeuuq commetmaeuqu
commetmqauue commetmqaueu commetmqauue commetmqaueu commetmqaeuu commetmqaeuu commetmquaue commetmquaeu commetmquuae
commetmquuea commetmqueua commetmqueau commetmquuae commetmquuea commetmquaue commetmquaeu commetmqueau commetmqueua
commetmqeuua commetmqeuau commetmqeuua commetmqeuau commetmqeauu commetmqeauu commetmuaque commetmuaqeu commetmuauqe
commetmuaueq commetmuaeuq commetmuaequ commetmuqaue commetmuqaeu commetmuquae commetmuquea commetmuqeua commetmuqeau
commetmuuqae commetmuuqea commetmuuaqe commetmuuaeq commetmuueaq commetmuueqa commetmuequa commetmueqau commetmueuqa
commetmueuaq commetmueauq commetmueaqu commetmeaquu commetmeaquu commetmeauqu commetmeauuq commetmeauuq commetmeauqu
commetmeqauu commetmeqauu commetmequau commetmequua commetmequua commetmequau commetmeuqau commetmeuqua commetmeuaqu
commetmeuauq commetmeuuaq commetmeuuqa commetmeuqua commetmeuqau commetmeuuqa commetmeuuaq commetmeuauq commetmeuaqu
commetqumaue commetqumaeu commetqumuae commetqumuea commetqumeua commetqumeau commetquamue commetquameu commetquaume
commetquauem commetquaeum commetquaemu commetquuame commetquuaem commetquumae commetquumea commetquuema commetquueam
commetqueaum commetqueamu commetqueuam commetqueuma commetquemua commetquemau commetqmuaue commetqmuaeu commetqmuuae
commetqmuuea commetqmueua commetqmueau commetqmauue commetqmaueu commetqmauue commetqmaueu commetqmaeuu commetqmaeuu
commetqmuaue commetqmuaeu commetqmuuae commetqmuuea commetqmueua commetqmueau commetqmeauu commetqmeauu commetqmeuau
commetqmeuua commetqmeuua commetqmeuau commetqamuue commetqamueu commetqamuue commetqamueu commetqameuu commetqameuu
commetqaumue commetqaumeu commetqauume commetqauuem commetqaueum commetqauemu commetqauume commetqauuem commetqaumue
commetqaumeu commetqauemu commetqaueum commetqaeuum commetqaeumu commetqaeuum commetqaeumu commetqaemuu commetqaemuu
commetqumaue commetqumaeu commetqumuae commetqumuea commetqumeua commetqumeau commetquamue commetquameu commetquaume
commetquauem commetquaeum commetquaemu commetquuame commetquuaem commetquumae commetquumea commetquuema commetquueam
commetqueaum commetqueamu commetqueuam commetqueuma commetquemua commetquemau commetqemauu commetqemauu commetqemuau
commetqemuua commetqemuua commetqemuau commetqeamuu commetqeamuu commetqeaumu commetqeauum commetqeauum commetqeaumu
commetqeuamu commetqeuaum commetqeumau commetqeumua commetqeuuma commetqeuuam commetqeuaum commetqeuamu commetqeuuam
commetqeuuma commetqeumua commetqeumau commetuumqae commetuumqea commetuumaqe commetuumaeq commetuumeaq commetuumeqa
commetuuqmae commetuuqmea commetuuqame commetuuqaem commetuuqeam commetuuqema commetuuaqme commetuuaqem commetuuamqe
commetuuameq commetuuaemq commetuuaeqm commetuueqam commetuueqma commetuueaqm commetuueamq commetuuemaq commetuuemqa
commetumuqae commetumuqea commetumuaqe commetumuaeq commetumueaq commetumueqa commetumquae commetumquea commetumqaue
commetumqaeu commetumqeau commetumqeua commetumaque commetumaqeu commetumauqe commetumaueq commetumaeuq commetumaequ
commetumeqau commetumequa commetumeaqu commetumeauq commetumeuaq commetumeuqa commetuqmuae commetuqmuea commetuqmaue
commetuqmaeu commetuqmeau commetuqmeua commetuqumae commetuqumea commetuquame commetuquaem commetuqueam commetuquema
commetuqaume commetuqauem commetuqamue commetuqameu commetuqaemu commetuqaeum commetuqeuam commetuqeuma commetuqeaum
commetuqeamu commetuqemau commetuqemua commetuamque commetuamqeu commetuamuqe commetuamueq commetuameuq commetuamequ
commetuaqmue commetuaqmeu commetuaqume commetuaquem commetuaqeum commetuaqemu commetuauqme commetuauqem commetuaumqe
commetuaumeq commetuauemq commetuaueqm commetuaequm commetuaeqmu commetuaeuqm commetuaeumq commetuaemuq commetuaemqu
commetuemqau commetuemqua commetuemaqu commetuemauq commetuemuaq commetuemuqa commetueqmau commetueqmua commetueqamu
commetueqaum commetuequam commetuequma commetueaqmu commetueaqum commetueamqu commetueamuq commetueaumq commetueauqm
commetueuqam commetueuqma commetueuaqm commetueuamq commetueumaq commetueumqa commeteumqua commeteumqau commeteumuqa
commeteumuaq commeteumauq commeteumaqu commeteuqmua commeteuqmau commeteuquma commeteuquam commeteuqaum commeteuqamu
commeteuuqma commeteuuqam commeteuumqa commeteuumaq commeteuuamq commeteuuaqm commeteuaqum commeteuaqmu commeteuauqm
commeteuaumq commeteuamuq commeteuamqu commetemuqua commetemuqau commetemuuqa commetemuuaq commetemuauq commetemuaqu
commetemquua commetemquau commetemquua commetemquau commetemqauu commetemqauu commetemuqua commetemuqau commetemuuqa
commetemuuaq commetemuauq commetemuaqu commetemaquu commetemaquu commetemauqu commetemauuq commetemauuq commetemauqu
commeteqmuua commeteqmuau commeteqmuua commeteqmuau commeteqmauu commeteqmauu commetequmua commetequmau commetequuma
commetequuam commetequaum commetequamu commetequuma commetequuam commetequmua commetequmau commetequamu commetequaum
commeteqauum commeteqaumu commeteqauum commeteqaumu commeteqamuu commeteqamuu commeteumqua commeteumqau commeteumuqa
commeteumuaq commeteumauq commeteumaqu commeteuqmua commeteuqmau commeteuquma commeteuquam commeteuqaum commeteuqamu
commeteuuqma commeteuuqam commeteuumqa commeteuumaq commeteuuamq commeteuuaqm commeteuaqum commeteuaqmu commeteuauqm
commeteuaumq commeteuamuq commeteuamqu commeteamquu commeteamquu commeteamuqu commeteamuuq commeteamuuq commeteamuqu
commeteaqmuu commeteaqmuu commeteaqumu commeteaquum commeteaquum commeteaqumu commeteauqmu commeteauqum commeteaumqu
commeteaumuq commeteauumq commeteauuqm commeteauqum commeteauqmu commeteauuqm commeteauumq commeteaumuq commeteaumqu
commeutamque commeutamqeu commeutamuqe commeutamueq commeutameuq commeutamequ commeutaqmue commeutaqmeu commeutaqume
commeutaquem commeutaqeum commeutaqemu commeutauqme commeutauqem commeutaumqe commeutaumeq commeutauemq commeutaueqm
commeutaequm commeutaeqmu commeutaeuqm commeutaeumq commeutaemuq commeutaemqu commeutmaque commeutmaqeu commeutmauqe
commeutmaueq commeutmaeuq commeutmaequ commeutmqaue commeutmqaeu commeutmquae commeutmquea commeutmqeua commeutmqeau
commeutmuqae commeutmuqea commeutmuaqe commeutmuaeq commeutmueaq commeutmueqa commeutmequa commeutmeqau commeutmeuqa
commeutmeuaq commeutmeauq commeutmeaqu commeutqmaue commeutqmaeu commeutqmuae commeutqmuea commeutqmeua commeutqmeau
commeutqamue commeutqameu commeutqaume commeutqauem commeutqaeum commeutqaemu commeutquame commeutquaem commeutqumae
commeutqumea commeutquema commeutqueam commeutqeaum commeutqeamu commeutqeuam commeutqeuma commeutqemua commeutqemau
commeutumqae commeutumqea commeutumaqe commeutumaeq commeutumeaq commeutumeqa commeutuqmae commeutuqmea commeutuqame
commeutuqaem commeutuqeam commeutuqema commeutuaqme commeutuaqem commeutuamqe commeutuameq commeutuaemq commeutuaeqm
commeutueqam commeutueqma commeutueaqm commeutueamq commeutuemaq commeutuemqa commeutemqua commeutemqau commeutemuqa
commeutemuaq commeutemauq commeutemaqu commeuteqmua commeuteqmau commeutequma commeutequam commeuteqaum commeuteqamu
commeuteuqma commeuteuqam commeuteumqa commeuteumaq commeuteuamq commeuteuaqm commeuteaqum commeuteaqmu commeuteauqm
commeuteaumq commeuteamuq commeuteamqu commeuatmque commeuatmqeu commeuatmuqe commeuatmueq commeuatmeuq commeuatmequ
commeuatqmue commeuatqmeu commeuatqume commeuatquem commeuatqeum commeuatqemu commeuatuqme commeuatuqem commeuatumqe
commeuatumeq commeuatuemq commeuatueqm commeuatequm commeuateqmu commeuateuqm commeuateumq commeuatemuq commeuatemqu
commeuamtque commeuamtqeu commeuamtuqe commeuamtueq commeuamteuq commeuamtequ commeuamqtue commeuamqteu commeuamqute
commeuamquet commeuamqeut commeuamqetu commeuamuqte commeuamuqet commeuamutqe commeuamuteq commeuamuetq commeuamueqt
commeuamequt commeuameqtu commeuameuqt commeuameutq commeuametuq commeuametqu commeuaqmtue commeuaqmteu commeuaqmute
commeuaqmuet commeuaqmeut commeuaqmetu commeuaqtmue commeuaqtmeu commeuaqtume commeuaqtuem commeuaqteum commeuaqtemu
commeuaqutme commeuaqutem commeuaqumte commeuaqumet commeuaquemt commeuaquetm commeuaqetum commeuaqetmu commeuaqeutm
commeuaqeumt commeuaqemut commeuaqemtu commeuaumqte commeuaumqet commeuaumtqe commeuaumteq commeuaumetq commeuaumeqt
commeuauqmte commeuauqmet commeuauqtme commeuauqtem commeuauqetm commeuauqemt commeuautqme commeuautqem commeuautmqe
commeuautmeq commeuautemq commeuauteqm commeuaueqtm commeuaueqmt commeuauetqm commeuauetmq commeuauemtq commeuauemqt
commeuaemqut commeuaemqtu commeuaemuqt commeuaemutq commeuaemtuq commeuaemtqu commeuaeqmut commeuaeqmtu commeuaequmt
commeuaequtm commeuaeqtum commeuaeqtmu commeuaeuqmt commeuaeuqtm commeuaeumqt commeuaeumtq commeuaeutmq commeuaeutqm
commeuaetqum commeuaetqmu commeuaetuqm commeuaetumq commeuaetmuq commeuaetmqu commeumatque commeumatqeu commeumatuqe
commeumatueq commeumateuq commeumatequ commeumaqtue commeumaqteu commeumaqute commeumaquet commeumaqeut commeumaqetu
commeumauqte commeumauqet commeumautqe commeumauteq commeumauetq commeumaueqt commeumaequt commeumaeqtu commeumaeuqt
commeumaeutq commeumaetuq commeumaetqu commeumtaque commeumtaqeu commeumtauqe commeumtaueq commeumtaeuq commeumtaequ
commeumtqaue commeumtqaeu commeumtquae commeumtquea commeumtqeua commeumtqeau commeumtuqae commeumtuqea commeumtuaqe
commeumtuaeq commeumtueaq commeumtueqa commeumtequa commeumteqau commeumteuqa commeumteuaq commeumteauq commeumteaqu
commeumqtaue commeumqtaeu commeumqtuae commeumqtuea commeumqteua commeumqteau commeumqatue commeumqateu commeumqaute
commeumqauet commeumqaeut commeumqaetu commeumquate commeumquaet commeumqutae commeumqutea commeumqueta commeumqueat
commeumqeaut commeumqeatu commeumqeuat commeumqeuta commeumqetua commeumqetau commeumutqae commeumutqea commeumutaqe
commeumutaeq commeumuteaq commeumuteqa commeumuqtae commeumuqtea commeumuqate commeumuqaet commeumuqeat commeumuqeta
commeumuaqte commeumuaqet commeumuatqe commeumuateq commeumuaetq commeumuaeqt commeumueqat commeumueqta commeumueaqt
commeumueatq commeumuetaq commeumuetqa commeumetqua commeumetqau commeumetuqa commeumetuaq commeumetauq commeumetaqu
commeumeqtua commeumeqtau commeumequta commeumequat commeumeqaut commeumeqatu commeumeuqta commeumeuqat commeumeutqa
commeumeutaq commeumeuatq commeumeuaqt commeumeaqut commeumeaqtu commeumeauqt commeumeautq commeumeatuq commeumeatqu
commeuqamtue commeuqamteu commeuqamute commeuqamuet commeuqameut commeuqametu commeuqatmue commeuqatmeu commeuqatume
commeuqatuem commeuqateum commeuqatemu commeuqautme commeuqautem commeuqaumte commeuqaumet commeuqauemt commeuqauetm
commeuqaetum commeuqaetmu commeuqaeutm commeuqaeumt commeuqaemut commeuqaemtu commeuqmatue commeuqmateu commeuqmaute
commeuqmauet commeuqmaeut commeuqmaetu commeuqmtaue commeuqmtaeu commeuqmtuae commeuqmtuea commeuqmteua commeuqmteau
commeuqmutae commeuqmutea commeuqmuate commeuqmuaet commeuqmueat commeuqmueta commeuqmetua commeuqmetau commeuqmeuta
commeuqmeuat commeuqmeaut commeuqmeatu commeuqtmaue commeuqtmaeu commeuqtmuae commeuqtmuea commeuqtmeua commeuqtmeau
commeuqtamue commeuqtameu commeuqtaume commeuqtauem commeuqtaeum commeuqtaemu commeuqtuame commeuqtuaem commeuqtumae
commeuqtumea commeuqtuema commeuqtueam commeuqteaum commeuqteamu commeuqteuam commeuqteuma commeuqtemua commeuqtemau
commeuqumtae commeuqumtea commeuqumate commeuqumaet commeuqumeat commeuqumeta commeuqutmae commeuqutmea commeuqutame
commeuqutaem commeuquteam commeuqutema commeuquatme commeuquatem commeuquamte commeuquamet commeuquaemt commeuquaetm
commeuquetam commeuquetma commeuqueatm commeuqueamt commeuquemat commeuquemta commeuqemtua commeuqemtau commeuqemuta
commeuqemuat commeuqemaut commeuqematu commeuqetmua commeuqetmau commeuqetuma commeuqetuam commeuqetaum commeuqetamu
commeuqeutma commeuqeutam commeuqeumta commeuqeumat commeuqeuamt commeuqeuatm commeuqeatum commeuqeatmu commeuqeautm
commeuqeaumt commeuqeamut commeuqeamtu commeuuamqte commeuuamqet commeuuamtqe commeuuamteq commeuuametq commeuuameqt
commeuuaqmte commeuuaqmet commeuuaqtme commeuuaqtem commeuuaqetm commeuuaqemt commeuuatqme commeuuatqem commeuuatmqe
commeuuatmeq commeuuatemq commeuuateqm commeuuaeqtm commeuuaeqmt commeuuaetqm commeuuaetmq commeuuaemtq commeuuaemqt
commeuumaqte commeuumaqet commeuumatqe commeuumateq commeuumaetq commeuumaeqt commeuumqate commeuumqaet commeuumqtae
commeuumqtea commeuumqeta commeuumqeat commeuumtqae commeuumtqea commeuumtaqe commeuumtaeq commeuumteaq commeuumteqa
commeuumeqta commeuumeqat commeuumetqa commeuumetaq commeuumeatq commeuumeaqt commeuuqmate commeuuqmaet commeuuqmtae
commeuuqmtea commeuuqmeta commeuuqmeat commeuuqamte commeuuqamet commeuuqatme commeuuqatem commeuuqaetm commeuuqaemt
commeuuqtame commeuuqtaem commeuuqtmae commeuuqtmea commeuuqtema commeuuqteam commeuuqeatm commeuuqeamt commeuuqetam
commeuuqetma commeuuqemta commeuuqemat commeuutmqae commeuutmqea commeuutmaqe commeuutmaeq commeuutmeaq commeuutmeqa
commeuutqmae commeuutqmea commeuutqame commeuutqaem commeuutqeam commeuutqema commeuutaqme commeuutaqem commeuutamqe
commeuutameq commeuutaemq commeuutaeqm commeuuteqam commeuuteqma commeuuteaqm commeuuteamq commeuutemaq commeuutemqa
commeuuemqta commeuuemqat commeuuemtqa commeuuemtaq commeuuematq commeuuemaqt commeuueqmta commeuueqmat commeuueqtma
commeuueqtam commeuueqatm commeuueqamt commeuuetqma commeuuetqam commeuuetmqa commeuuetmaq commeuuetamq commeuuetaqm
commeuueaqtm commeuueaqmt commeuueatqm commeuueatmq commeuueamtq commeuueamqt commeueamqut commeueamqtu commeueamuqt
commeueamutq commeueamtuq commeueamtqu commeueaqmut commeueaqmtu commeueaqumt commeueaqutm commeueaqtum commeueaqtmu
commeueauqmt commeueauqtm commeueaumqt commeueaumtq commeueautmq commeueautqm commeueatqum commeueatqmu commeueatuqm
commeueatumq commeueatmuq commeueatmqu commeuemaqut commeuemaqtu commeuemauqt commeuemautq commeuematuq commeuematqu
commeuemqaut commeuemqatu commeuemquat commeuemquta commeuemqtua commeuemqtau commeuemuqat commeuemuqta commeuemuaqt
commeuemuatq commeuemutaq commeuemutqa commeuemtqua commeuemtqau commeuemtuqa commeuemtuaq commeuemtauq commeuemtaqu
commeueqmaut commeueqmatu commeueqmuat commeueqmuta commeueqmtua commeueqmtau commeueqamut commeueqamtu commeueqaumt
commeueqautm commeueqatum commeueqatmu commeuequamt commeuequatm commeuequmat commeuequmta commeuequtma commeuequtam
commeueqtaum commeueqtamu commeueqtuam commeueqtuma commeueqtmua commeueqtmau commeueumqat commeueumqta commeueumaqt
commeueumatq commeueumtaq commeueumtqa commeueuqmat commeueuqmta commeueuqamt commeueuqatm commeueuqtam commeueuqtma
commeueuaqmt commeueuaqtm commeueuamqt commeueuamtq commeueuatmq commeueuatqm commeueutqam commeueutqma commeueutaqm
commeueutamq commeueutmaq commeueutmqa commeuetmqua commeuetmqau commeuetmuqa commeuetmuaq commeuetmauq commeuetmaqu
commeuetqmua commeuetqmau commeuetquma commeuetquam commeuetqaum commeuetqamu commeuetuqma commeuetuqam commeuetumqa
commeuetumaq commeuetuamq commeuetuaqm commeuetaqum commeuetaqmu commeuetauqm commeuetaumq commeuetamuq commeuetamqu
commemtuaque commemtuaqeu commemtuauqe commemtuaueq commemtuaeuq commemtuaequ commemtuqaue commemtuqaeu commemtuquae
commemtuquea commemtuqeua commemtuqeau commemtuuqae commemtuuqea commemtuuaqe commemtuuaeq commemtuueaq commemtuueqa
commemtuequa commemtueqau commemtueuqa commemtueuaq commemtueauq commemtueaqu commemtauque commemtauqeu commemtauuqe
commemtauueq commemtaueuq commemtauequ commemtaquue commemtaqueu commemtaquue commemtaqueu commemtaqeuu commemtaqeuu
commemtauque commemtauqeu commemtauuqe commemtauueq commemtaueuq commemtauequ commemtaequu commemtaequu commemtaeuqu
commemtaeuuq commemtaeuuq commemtaeuqu commemtqauue commemtqaueu commemtqauue commemtqaueu commemtqaeuu commemtqaeuu
commemtquaue commemtquaeu commemtquuae commemtquuea commemtqueua commemtqueau commemtquuae commemtquuea commemtquaue
commemtquaeu commemtqueau commemtqueua commemtqeuua commemtqeuau commemtqeuua commemtqeuau commemtqeauu commemtqeauu
commemtuaque commemtuaqeu commemtuauqe commemtuaueq commemtuaeuq commemtuaequ commemtuqaue commemtuqaeu commemtuquae
commemtuquea commemtuqeua commemtuqeau commemtuuqae commemtuuqea commemtuuaqe commemtuuaeq commemtuueaq commemtuueqa
commemtuequa commemtueqau commemtueuqa commemtueuaq commemtueauq commemtueaqu commemteaquu commemteaquu commemteauqu
commemteauuq commemteauuq commemteauqu commemteqauu commemteqauu commemtequau commemtequua commemtequua commemtequau
commemteuqau commemteuqua commemteuaqu commemteuauq commemteuuaq commemteuuqa commemteuqua commemteuqau commemteuuqa
commemteuuaq commemteuauq commemteuaqu commemutaque commemutaqeu commemutauqe commemutaueq commemutaeuq commemutaequ
commemutqaue commemutqaeu commemutquae commemutquea commemutqeua commemutqeau commemutuqae commemutuqea commemutuaqe
commemutuaeq commemutueaq commemutueqa commemutequa commemuteqau commemuteuqa commemuteuaq commemuteauq commemuteaqu
commemuatque commemuatqeu commemuatuqe commemuatueq commemuateuq commemuatequ commemuaqtue commemuaqteu commemuaqute
commemuaquet commemuaqeut commemuaqetu commemuauqte commemuauqet commemuautqe commemuauteq commemuauetq commemuaueqt
commemuaequt commemuaeqtu commemuaeuqt commemuaeutq commemuaetuq commemuaetqu commemuqatue commemuqateu commemuqaute
commemuqauet commemuqaeut commemuqaetu commemuqtaue commemuqtaeu commemuqtuae commemuqtuea commemuqteua commemuqteau
commemuqutae commemuqutea commemuquate commemuquaet commemuqueat commemuqueta commemuqetua commemuqetau commemuqeuta
commemuqeuat commemuqeaut commemuqeatu commemuuaqte commemuuaqet commemuuatqe commemuuateq commemuuaetq commemuuaeqt
commemuuqate commemuuqaet commemuuqtae commemuuqtea commemuuqeta commemuuqeat commemuutqae commemuutqea commemuutaqe
commemuutaeq commemuuteaq commemuuteqa commemuueqta commemuueqat commemuuetqa commemuuetaq commemuueatq commemuueaqt
commemueaqut commemueaqtu commemueauqt commemueautq commemueatuq commemueatqu commemueqaut commemueqatu commemuequat
commemuequta commemueqtua commemueqtau commemueuqat commemueuqta commemueuaqt commemueuatq commemueutaq commemueutqa
commemuetqua commemuetqau commemuetuqa commemuetuaq commemuetauq commemuetaqu commemautque commemautqeu commemautuqe
commemautueq commemauteuq commemautequ commemauqtue commemauqteu commemauqute commemauquet commemauqeut commemauqetu
commemauuqte commemauuqet commemauutqe commemauuteq commemauuetq commemauueqt commemauequt commemaueqtu commemaueuqt
commemaueutq commemauetuq commemauetqu commematuque commematuqeu commematuuqe commematuueq commematueuq commematuequ
commematquue commematqueu commematquue commematqueu commematqeuu commematqeuu commematuque commematuqeu commematuuqe
commematuueq commematueuq commematuequ commematequu commematequu commemateuqu commemateuuq commemateuuq commemateuqu
commemaqtuue commemaqtueu commemaqtuue commemaqtueu commemaqteuu commemaqteuu commemaqutue commemaquteu commemaquute
commemaquuet commemaqueut commemaquetu commemaquute commemaquuet commemaqutue commemaquteu commemaquetu commemaqueut
commemaqeuut commemaqeutu commemaqeuut commemaqeutu commemaqetuu commemaqetuu commemautque commemautqeu commemautuqe
commemautueq commemauteuq commemautequ commemauqtue commemauqteu commemauqute commemauquet commemauqeut commemauqetu
commemauuqte commemauuqet commemauutqe commemauuteq commemauuetq commemauueqt commemauequt commemaueqtu commemaueuqt
commemaueutq commemauetuq commemauetqu commemaetquu commemaetquu commemaetuqu commemaetuuq commemaetuuq commemaetuqu
commemaeqtuu commemaeqtuu commemaequtu commemaequut commemaequut commemaequtu commemaeuqtu commemaeuqut commemaeutqu
commemaeutuq commemaeuutq commemaeuuqt commemaeuqut commemaeuqtu commemaeuuqt commemaeuutq commemaeutuq commemaeutqu
commemquatue commemquateu commemquaute commemquauet commemquaeut commemquaetu commemqutaue commemqutaeu commemqutuae
commemqutuea commemquteua commemquteau commemquutae commemquutea commemquuate commemquuaet commemquueat commemquueta
commemquetua commemquetau commemqueuta commemqueuat commemqueaut commemqueatu commemqautue commemqauteu commemqauute
commemqauuet commemqaueut commemqauetu commemqatuue commemqatueu commemqatuue commemqatueu commemqateuu commemqateuu
commemqautue commemqauteu commemqauute commemqauuet commemqaueut commemqauetu commemqaetuu commemqaetuu commemqaeutu
commemqaeuut commemqaeuut commemqaeutu commemqtauue commemqtaueu commemqtauue commemqtaueu commemqtaeuu commemqtaeuu
commemqtuaue commemqtuaeu commemqtuuae commemqtuuea commemqtueua commemqtueau commemqtuuae commemqtuuea commemqtuaue
commemqtuaeu commemqtueau commemqtueua commemqteuua commemqteuau commemqteuua commemqteuau commemqteauu commemqteauu
commemquatue commemquateu commemquaute commemquauet commemquaeut commemquaetu commemqutaue commemqutaeu commemqutuae
commemqutuea commemquteua commemquteau commemquutae commemquutea commemquuate commemquuaet commemquueat commemquueta
commemquetua commemquetau commemqueuta commemqueuat commemqueaut commemqueatu commemqeatuu commemqeatuu commemqeautu
commemqeauut commemqeauut commemqeautu commemqetauu commemqetauu commemqetuau commemqetuua commemqetuua commemqetuau
commemqeutau commemqeutua commemqeuatu commemqeuaut commemqeuuat commemqeuuta commemqeutua commemqeutau commemqeuuta
commemqeuuat commemqeuaut commemqeuatu commemuuaqte commemuuaqet commemuuatqe commemuuateq commemuuaetq commemuuaeqt
commemuuqate commemuuqaet commemuuqtae commemuuqtea commemuuqeta commemuuqeat commemuutqae commemuutqea commemuutaqe
commemuutaeq commemuuteaq commemuuteqa commemuueqta commemuueqat commemuuetqa commemuuetaq commemuueatq commemuueaqt
commemuauqte commemuauqet commemuautqe commemuauteq commemuauetq commemuaueqt commemuaqute commemuaquet commemuaqtue
commemuaqteu commemuaqetu commemuaqeut commemuatque commemuatqeu commemuatuqe commemuatueq commemuateuq commemuatequ
commemuaeqtu commemuaequt commemuaetqu commemuaetuq commemuaeutq commemuaeuqt commemuqaute commemuqauet commemuqatue
commemuqateu commemuqaetu commemuqaeut commemuquate commemuquaet commemuqutae commemuqutea commemuqueta commemuqueat
commemuqtuae commemuqtuea commemuqtaue commemuqtaeu commemuqteau commemuqteua commemuqeuta commemuqeuat commemuqetua
commemuqetau commemuqeatu commemuqeaut commemutaque commemutaqeu commemutauqe commemutaueq commemutaeuq commemutaequ
commemutqaue commemutqaeu commemutquae commemutquea commemutqeua commemutqeau commemutuqae commemutuqea commemutuaqe
commemutuaeq commemutueaq commemutueqa commemutequa commemuteqau commemuteuqa commemuteuaq commemuteauq commemuteaqu
commemueaqtu commemueaqut commemueatqu commemueatuq commemueautq commemueauqt commemueqatu commemueqaut commemueqtau
commemueqtua commemuequta commemuequat commemuetqau commemuetqua commemuetaqu commemuetauq commemuetuaq commemuetuqa
commemueuqta commemueuqat commemueutqa commemueutaq commemueuatq commemueuaqt commemeuaqut commemeuaqtu commemeuauqt
commemeuautq commemeuatuq commemeuatqu commemeuqaut commemeuqatu commemeuquat commemeuquta commemeuqtua commemeuqtau
commemeuuqat commemeuuqta commemeuuaqt commemeuuatq commemeuutaq commemeuutqa commemeutqua commemeutqau commemeutuqa
commemeutuaq commemeutauq commemeutaqu commemeauqut commemeauqtu commemeauuqt commemeauutq commemeautuq commemeautqu
commemeaquut commemeaqutu commemeaquut commemeaqutu commemeaqtuu commemeaqtuu commemeauqut commemeauqtu commemeauuqt
commemeauutq commemeautuq commemeautqu commemeatquu commemeatquu commemeatuqu commemeatuuq commemeatuuq commemeatuqu
commemeqauut commemeqautu commemeqauut commemeqautu commemeqatuu commemeqatuu commemequaut commemequatu commemequuat
commemequuta commemequtua commemequtau commemequuat commemequuta commemequaut commemequatu commemequtau commemequtua
commemeqtuua commemeqtuau commemeqtuua commemeqtuau commemeqtauu commemeqtauu commemeuaqut commemeuaqtu commemeuauqt
commemeuautq commemeuatuq commemeuatqu commemeuqaut commemeuqatu commemeuquat commemeuquta commemeuqtua commemeuqtau
commemeuuqat commemeuuqta commemeuuaqt commemeuuatq commemeuutaq commemeuutqa commemeutqua commemeutqau commemeutuqa
commemeutuaq commemeutauq commemeutaqu commemetaquu commemetaquu commemetauqu commemetauuq commemetauuq commemetauqu
commemetqauu commemetqauu commemetquau commemetquua commemetquua commemetquau commemetuqau commemetuqua commemetuaqu
commemetuauq commemetuuaq commemetuuqa commemetuqua commemetuqau commemetuuqa commemetuuaq commemetuauq commemetuaqu
commeqtumaue commeqtumaeu commeqtumuae commeqtumuea commeqtumeua commeqtumeau commeqtuamue commeqtuameu commeqtuaume
commeqtuauem commeqtuaeum commeqtuaemu commeqtuuame commeqtuuaem commeqtuumae commeqtuumea commeqtuuema commeqtuueam
commeqtueaum commeqtueamu commeqtueuam commeqtueuma commeqtuemua commeqtuemau commeqtmuaue commeqtmuaeu commeqtmuuae
commeqtmuuea commeqtmueua commeqtmueau commeqtmauue commeqtmaueu commeqtmauue commeqtmaueu commeqtmaeuu commeqtmaeuu
commeqtmuaue commeqtmuaeu commeqtmuuae commeqtmuuea commeqtmueua commeqtmueau commeqtmeauu commeqtmeauu commeqtmeuau
commeqtmeuua commeqtmeuua commeqtmeuau commeqtamuue commeqtamueu commeqtamuue commeqtamueu commeqtameuu commeqtameuu
commeqtaumue commeqtaumeu commeqtauume commeqtauuem commeqtaueum commeqtauemu commeqtauume commeqtauuem commeqtaumue
commeqtaumeu commeqtauemu commeqtaueum commeqtaeuum commeqtaeumu commeqtaeuum commeqtaeumu commeqtaemuu commeqtaemuu
commeqtumaue commeqtumaeu commeqtumuae commeqtumuea commeqtumeua commeqtumeau commeqtuamue commeqtuameu commeqtuaume
commeqtuauem commeqtuaeum commeqtuaemu commeqtuuame commeqtuuaem commeqtuumae commeqtuumea commeqtuuema commeqtuueam
commeqtueaum commeqtueamu commeqtueuam commeqtueuma commeqtuemua commeqtuemau commeqtemauu commeqtemauu commeqtemuau
commeqtemuua commeqtemuua commeqtemuau commeqteamuu commeqteamuu commeqteaumu commeqteauum commeqteauum commeqteaumu
commeqteuamu commeqteuaum commeqteumau commeqteumua commeqteuuma commeqteuuam commeqteuaum commeqteuamu commeqteuuam
commeqteuuma commeqteumua commeqteumau commequtmaue commequtmaeu commequtmuae commequtmuea commequtmeua commequtmeau
commequtamue commequtameu commequtaume commequtauem commequtaeum commequtaemu commequtuame commequtuaem commequtumae
commequtumea commequtuema commequtueam commequteaum commequteamu commequteuam commequteuma commequtemua commequtemau
commequmtaue commequmtaeu commequmtuae commequmtuea commequmteua commequmteau commequmatue commequmateu commequmaute
commequmauet commequmaeut commequmaetu commequmuate commequmuaet commequmutae commequmutea commequmueta commequmueat
commequmeaut commequmeatu commequmeuat commequmeuta commequmetua commequmetau commequamtue commequamteu commequamute
commequamuet commequameut commequametu commequatmue commequatmeu commequatume commequatuem commequateum commequatemu
commequautme commequautem commequaumte commequaumet commequauemt commequauetm commequaetum commequaetmu commequaeutm
commequaeumt commequaemut commequaemtu commequumate commequumaet commequumtae commequumtea commequumeta commequumeat
commequuamte commequuamet commequuatme commequuatem commequuaetm commequuaemt commequutame commequutaem commequutmae
commequutmea commequutema commequuteam commequueatm commequueamt commequuetam commequuetma commequuemta commequuemat
commequemaut commequematu commequemuat commequemuta commequemtua commequemtau commequeamut commequeamtu commequeaumt
commequeautm commequeatum commequeatmu commequeuamt commequeuatm commequeumat commequeumta commequeutma commequeutam
commequetaum commequetamu commequetuam commequetuma commequetmua commequetmau commeqmutaue commeqmutaeu commeqmutuae
commeqmutuea commeqmuteua commeqmuteau commeqmuatue commeqmuateu commeqmuaute commeqmuauet commeqmuaeut commeqmuaetu
commeqmuuate commeqmuuaet commeqmuutae commeqmuutea commeqmuueta commeqmuueat commeqmueaut commeqmueatu commeqmueuat
commeqmueuta commeqmuetua commeqmuetau commeqmtuaue commeqmtuaeu commeqmtuuae commeqmtuuea commeqmtueua commeqmtueau
commeqmtauue commeqmtaueu commeqmtauue commeqmtaueu commeqmtaeuu commeqmtaeuu commeqmtuaue commeqmtuaeu commeqmtuuae
commeqmtuuea commeqmtueua commeqmtueau commeqmteauu commeqmteauu commeqmteuau commeqmteuua commeqmteuua commeqmteuau
commeqmatuue commeqmatueu commeqmatuue commeqmatueu commeqmateuu commeqmateuu commeqmautue commeqmauteu commeqmauute
commeqmauuet commeqmaueut commeqmauetu commeqmauute commeqmauuet commeqmautue commeqmauteu commeqmauetu commeqmaueut
commeqmaeuut commeqmaeutu commeqmaeuut commeqmaeutu commeqmaetuu commeqmaetuu commeqmutaue commeqmutaeu commeqmutuae
commeqmutuea commeqmuteua commeqmuteau commeqmuatue commeqmuateu commeqmuaute commeqmuauet commeqmuaeut commeqmuaetu
commeqmuuate commeqmuuaet commeqmuutae commeqmuutea commeqmuueta commeqmuueat commeqmueaut commeqmueatu commeqmueuat
commeqmueuta commeqmuetua commeqmuetau commeqmetauu commeqmetauu commeqmetuau commeqmetuua commeqmetuua commeqmetuau
commeqmeatuu commeqmeatuu commeqmeautu commeqmeauut commeqmeauut commeqmeautu commeqmeuatu commeqmeuaut commeqmeutau
commeqmeutua commeqmeuuta commeqmeuuat commeqmeuaut commeqmeuatu commeqmeuuat commeqmeuuta commeqmeutua commeqmeutau
commeqaumtue commeqaumteu commeqaumute commeqaumuet commeqaumeut commeqaumetu commeqautmue commeqautmeu commeqautume
commeqautuem commeqauteum commeqautemu commeqauutme commeqauutem commeqauumte commeqauumet commeqauuemt commeqauuetm
commeqauetum commeqauetmu commeqaueutm commeqaueumt commeqauemut commeqauemtu commeqamutue commeqamuteu commeqamuute
commeqamuuet commeqamueut commeqamuetu commeqamtuue commeqamtueu commeqamtuue commeqamtueu commeqamteuu commeqamteuu
commeqamutue commeqamuteu commeqamuute commeqamuuet commeqamueut commeqamuetu commeqametuu commeqametuu commeqameutu
commeqameuut commeqameuut commeqameutu commeqatmuue commeqatmueu commeqatmuue commeqatmueu commeqatmeuu commeqatmeuu
commeqatumue commeqatumeu commeqatuume commeqatuuem commeqatueum commeqatuemu commeqatuume commeqatuuem commeqatumue
commeqatumeu commeqatuemu commeqatueum commeqateuum commeqateumu commeqateuum commeqateumu commeqatemuu commeqatemuu
commeqaumtue commeqaumteu commeqaumute commeqaumuet commeqaumeut commeqaumetu commeqautmue commeqautmeu commeqautume
commeqautuem commeqauteum commeqautemu commeqauutme commeqauutem commeqauumte commeqauumet commeqauuemt commeqauuetm
commeqauetum commeqauetmu commeqaueutm commeqaueumt commeqauemut commeqauemtu commeqaemtuu commeqaemtuu commeqaemutu
commeqaemuut commeqaemuut commeqaemutu commeqaetmuu commeqaetmuu commeqaetumu commeqaetuum commeqaetuum commeqaetumu
commeqaeutmu commeqaeutum commeqaeumtu commeqaeumut commeqaeuumt commeqaeuutm commeqaeutum commeqaeutmu commeqaeuutm
commeqaeuumt commeqaeumut commeqaeumtu commequumate commequumaet commequumtae commequumtea commequumeta commequumeat
commequuamte commequuamet commequuatme commequuatem commequuaetm commequuaemt commequutame commequutaem commequutmae
commequutmea commequutema commequuteam commequueatm commequueamt commequuetam commequuetma commequuemta commequuemat
commequmuate commequmuaet commequmutae commequmutea commequmueta commequmueat commequmaute commequmauet commequmatue
commequmateu commequmaetu commequmaeut commequmtaue commequmtaeu commequmtuae commequmtuea commequmteua commequmteau
commequmeatu commequmeaut commequmetau commequmetua commequmeuta commequmeuat commequamute commequamuet commequamtue
commequamteu commequametu commequameut commequaumte commequaumet commequautme commequautem commequauetm commequauemt
commequatume commequatuem commequatmue commequatmeu commequatemu commequateum commequaeutm commequaeumt commequaetum
commequaetmu commequaemtu commequaemut commequtmaue commequtmaeu commequtmuae commequtmuea commequtmeua commequtmeau
commequtamue commequtameu commequtaume commequtauem commequtaeum commequtaemu commequtuame commequtuaem commequtumae
commequtumea commequtuema commequtueam commequteaum commequteamu commequteuam commequteuma commequtemua commequtemau
commequematu commequemaut commequemtau commequemtua commequemuta commequemuat commequeamtu commequeamut commequeatmu
commequeatum commequeautm commequeaumt commequetamu commequetaum commequetmau commequetmua commequetuma commequetuam
commequeuatm commequeuamt commequeutam commequeutma commequeumta commequeumat commeqeumaut commeqeumatu commeqeumuat
commeqeumuta commeqeumtua commeqeumtau commeqeuamut commeqeuamtu commeqeuaumt commeqeuautm commeqeuatum commeqeuatmu
commeqeuuamt commeqeuuatm commeqeuumat commeqeuumta commeqeuutma commeqeuutam commeqeutaum commeqeutamu commeqeutuam
commeqeutuma commeqeutmua commeqeutmau commeqemuaut commeqemuatu commeqemuuat commeqemuuta commeqemutua commeqemutau
commeqemauut commeqemautu commeqemauut commeqemautu commeqematuu commeqematuu commeqemuaut commeqemuatu commeqemuuat
commeqemuuta commeqemutua commeqemutau commeqemtauu commeqemtauu commeqemtuau commeqemtuua commeqemtuua commeqemtuau
commeqeamuut commeqeamutu commeqeamuut commeqeamutu commeqeamtuu commeqeamtuu commeqeaumut commeqeaumtu commeqeauumt
commeqeauutm commeqeautum commeqeautmu commeqeauumt commeqeauutm commeqeaumut commeqeaumtu commeqeautmu commeqeautum
commeqeatuum commeqeatumu commeqeatuum commeqeatumu commeqeatmuu commeqeatmuu commeqeumaut commeqeumatu commeqeumuat
commeqeumuta commeqeumtua commeqeumtau commeqeuamut commeqeuamtu commeqeuaumt commeqeuautm commeqeuatum commeqeuatmu
commeqeuuamt commeqeuuatm commeqeuumat commeqeuumta commeqeuutma commeqeuutam commeqeutaum commeqeutamu commeqeutuam
commeqeutuma commeqeutmua commeqeutmau commeqetmauu commeqetmauu commeqetmuau commeqetmuua commeqetmuua commeqetmuau
commeqetamuu commeqetamuu commeqetaumu commeqetauum commeqetauum commeqetaumu commeqetuamu commeqetuaum commeqetumau
commeqetumua commeqetuuma commeqetuuam commeqetuaum commeqetuamu commeqetuuam commeqetuuma commeqetumua commeqetumau
commeutumqae commeutumqea commeutumaqe commeutumaeq commeutumeaq commeutumeqa commeutuqmae commeutuqmea commeutuqame
commeutuqaem commeutuqeam commeutuqema commeutuaqme commeutuaqem commeutuamqe commeutuameq commeutuaemq commeutuaeqm
commeutueqam commeutueqma commeutueaqm commeutueamq commeutuemaq commeutuemqa commeutmuqae commeutmuqea commeutmuaqe
commeutmuaeq commeutmueaq commeutmueqa commeutmquae commeutmquea commeutmqaue commeutmqaeu commeutmqeau commeutmqeua
commeutmaque commeutmaqeu commeutmauqe commeutmaueq commeutmaeuq commeutmaequ commeutmeqau commeutmequa commeutmeaqu
commeutmeauq commeutmeuaq commeutmeuqa commeutqmuae commeutqmuea commeutqmaue commeutqmaeu commeutqmeau commeutqmeua
commeutqumae commeutqumea commeutquame commeutquaem commeutqueam commeutquema commeutqaume commeutqauem commeutqamue
commeutqameu commeutqaemu commeutqaeum commeutqeuam commeutqeuma commeutqeaum commeutqeamu commeutqemau commeutqemua
commeutamque commeutamqeu commeutamuqe commeutamueq commeutameuq commeutamequ commeutaqmue commeutaqmeu commeutaqume
commeutaquem commeutaqeum commeutaqemu commeutauqme commeutauqem commeutaumqe commeutaumeq commeutauemq commeutaueqm
commeutaequm commeutaeqmu commeutaeuqm commeutaeumq commeutaemuq commeutaemqu commeutemqau commeutemqua commeutemaqu
commeutemauq commeutemuaq commeutemuqa commeuteqmau commeuteqmua commeuteqamu commeuteqaum commeutequam commeutequma
commeuteaqmu commeuteaqum commeuteamqu commeuteamuq commeuteaumq commeuteauqm commeuteuqam commeuteuqma commeuteuaqm
commeuteuamq commeuteumaq commeuteumqa commeuutmqae commeuutmqea commeuutmaqe commeuutmaeq commeuutmeaq commeuutmeqa
commeuutqmae commeuutqmea commeuutqame commeuutqaem commeuutqeam commeuutqema commeuutaqme commeuutaqem commeuutamqe
commeuutameq commeuutaemq commeuutaeqm commeuuteqam commeuuteqma commeuuteaqm commeuuteamq commeuutemaq commeuutemqa
commeuumtqae commeuumtqea commeuumtaqe commeuumtaeq commeuumteaq commeuumteqa commeuumqtae commeuumqtea commeuumqate
commeuumqaet commeuumqeat commeuumqeta commeuumaqte commeuumaqet commeuumatqe commeuumateq commeuumaetq commeuumaeqt
commeuumeqat commeuumeqta commeuumeaqt commeuumeatq commeuumetaq commeuumetqa commeuuqmtae commeuuqmtea commeuuqmate
commeuuqmaet commeuuqmeat commeuuqmeta commeuuqtmae commeuuqtmea commeuuqtame commeuuqtaem commeuuqteam commeuuqtema
commeuuqatme commeuuqatem commeuuqamte commeuuqamet commeuuqaemt commeuuqaetm commeuuqetam commeuuqetma commeuuqeatm
commeuuqeamt commeuuqemat commeuuqemta commeuuamqte commeuuamqet commeuuamtqe commeuuamteq commeuuametq commeuuameqt
commeuuaqmte commeuuaqmet commeuuaqtme commeuuaqtem commeuuaqetm commeuuaqemt commeuuatqme commeuuatqem commeuuatmqe
commeuuatmeq commeuuatemq commeuuateqm commeuuaeqtm commeuuaeqmt commeuuaetqm commeuuaetmq commeuuaemtq commeuuaemqt
commeuuemqat commeuuemqta commeuuemaqt commeuuematq commeuuemtaq commeuuemtqa commeuueqmat commeuueqmta commeuueqamt
commeuueqatm commeuueqtam commeuueqtma commeuueaqmt commeuueaqtm commeuueamqt commeuueamtq commeuueatmq commeuueatqm
commeuuetqam commeuuetqma commeuuetaqm commeuuetamq commeuuetmaq commeuuetmqa commeumutqae commeumutqea commeumutaqe
commeumutaeq commeumuteaq commeumuteqa commeumuqtae commeumuqtea commeumuqate commeumuqaet commeumuqeat commeumuqeta
commeumuaqte commeumuaqet commeumuatqe commeumuateq commeumuaetq commeumuaeqt commeumueqat commeumueqta commeumueaqt
commeumueatq commeumuetaq commeumuetqa commeumtuqae commeumtuqea commeumtuaqe commeumtuaeq commeumtueaq commeumtueqa
commeumtquae commeumtquea commeumtqaue commeumtqaeu commeumtqeau commeumtqeua commeumtaque commeumtaqeu commeumtauqe
commeumtaueq commeumtaeuq commeumtaequ commeumteqau commeumtequa commeumteaqu commeumteauq commeumteuaq commeumteuqa
commeumqtuae commeumqtuea commeumqtaue commeumqtaeu commeumqteau commeumqteua commeumqutae commeumqutea commeumquate
commeumquaet commeumqueat commeumqueta commeumqaute commeumqauet commeumqatue commeumqateu commeumqaetu commeumqaeut
commeumqeuat commeumqeuta commeumqeaut commeumqeatu commeumqetau commeumqetua commeumatque commeumatqeu commeumatuqe
commeumatueq commeumateuq commeumatequ commeumaqtue commeumaqteu commeumaqute commeumaquet commeumaqeut commeumaqetu
commeumauqte commeumauqet commeumautqe commeumauteq commeumauetq commeumaueqt commeumaequt commeumaeqtu commeumaeuqt
commeumaeutq commeumaetuq commeumaetqu commeumetqau commeumetqua commeumetaqu commeumetauq commeumetuaq commeumetuqa
commeumeqtau commeumeqtua commeumeqatu commeumeqaut commeumequat commeumequta commeumeaqtu commeumeaqut commeumeatqu
commeumeatuq commeumeautq commeumeauqt commeumeuqat commeumeuqta commeumeuaqt commeumeuatq commeumeutaq commeumeutqa
commeuqumtae commeuqumtea commeuqumate commeuqumaet commeuqumeat commeuqumeta commeuqutmae commeuqutmea commeuqutame
commeuqutaem commeuquteam commeuqutema commeuquatme commeuquatem commeuquamte commeuquamet commeuquaemt commeuquaetm
commeuquetam commeuquetma commeuqueatm commeuqueamt commeuquemat commeuquemta commeuqmutae commeuqmutea commeuqmuate
commeuqmuaet commeuqmueat commeuqmueta commeuqmtuae commeuqmtuea commeuqmtaue commeuqmtaeu commeuqmteau commeuqmteua
commeuqmatue commeuqmateu commeuqmaute commeuqmauet commeuqmaeut commeuqmaetu commeuqmetau commeuqmetua commeuqmeatu
commeuqmeaut commeuqmeuat commeuqmeuta commeuqtmuae commeuqtmuea commeuqtmaue commeuqtmaeu commeuqtmeau commeuqtmeua
commeuqtumae commeuqtumea commeuqtuame commeuqtuaem commeuqtueam commeuqtuema commeuqtaume commeuqtauem commeuqtamue
commeuqtameu commeuqtaemu commeuqtaeum commeuqteuam commeuqteuma commeuqteaum commeuqteamu commeuqtemau commeuqtemua
commeuqamtue commeuqamteu commeuqamute commeuqamuet commeuqameut commeuqametu commeuqatmue commeuqatmeu commeuqatume
commeuqatuem commeuqateum commeuqatemu commeuqautme commeuqautem commeuqaumte commeuqaumet commeuqauemt commeuqauetm
commeuqaetum commeuqaetmu commeuqaeutm commeuqaeumt commeuqaemut commeuqaemtu commeuqemtau commeuqemtua commeuqematu
commeuqemaut commeuqemuat commeuqemuta commeuqetmau commeuqetmua commeuqetamu commeuqetaum commeuqetuam commeuqetuma
commeuqeatmu commeuqeatum commeuqeamtu commeuqeamut commeuqeaumt commeuqeautm commeuqeutam commeuqeutma commeuqeuatm
commeuqeuamt commeuqeumat commeuqeumta commeuaumqte commeuaumqet commeuaumtqe commeuaumteq commeuaumetq commeuaumeqt
commeuauqmte commeuauqmet commeuauqtme commeuauqtem commeuauqetm commeuauqemt commeuautqme commeuautqem commeuautmqe
commeuautmeq commeuautemq commeuauteqm commeuaueqtm commeuaueqmt commeuauetqm commeuauetmq commeuauemtq commeuauemqt
commeuamuqte commeuamuqet commeuamutqe commeuamuteq commeuamuetq commeuamueqt commeuamqute commeuamquet commeuamqtue
commeuamqteu commeuamqetu commeuamqeut commeuamtque commeuamtqeu commeuamtuqe commeuamtueq commeuamteuq commeuamtequ
commeuameqtu commeuamequt commeuametqu commeuametuq commeuameutq commeuameuqt commeuaqmute commeuaqmuet commeuaqmtue
commeuaqmteu commeuaqmetu commeuaqmeut commeuaqumte commeuaqumet commeuaqutme commeuaqutem commeuaquetm commeuaquemt
commeuaqtume commeuaqtuem commeuaqtmue commeuaqtmeu commeuaqtemu commeuaqteum commeuaqeutm commeuaqeumt commeuaqetum
commeuaqetmu commeuaqemtu commeuaqemut commeuatmque commeuatmqeu commeuatmuqe commeuatmueq commeuatmeuq commeuatmequ
commeuatqmue commeuatqmeu commeuatqume commeuatquem commeuatqeum commeuatqemu commeuatuqme commeuatuqem commeuatumqe
commeuatumeq commeuatuemq commeuatueqm commeuatequm commeuateqmu commeuateuqm commeuateumq commeuatemuq commeuatemqu
commeuaemqtu commeuaemqut commeuaemtqu commeuaemtuq commeuaemutq commeuaemuqt commeuaeqmtu commeuaeqmut commeuaeqtmu
commeuaeqtum commeuaequtm commeuaequmt commeuaetqmu commeuaetqum commeuaetmqu commeuaetmuq commeuaetumq commeuaetuqm
commeuaeuqtm commeuaeuqmt commeuaeutqm commeuaeutmq commeuaeumtq commeuaeumqt commeueumqat commeueumqta commeueumaqt
commeueumatq commeueumtaq commeueumtqa commeueuqmat commeueuqmta commeueuqamt commeueuqatm commeueuqtam commeueuqtma
commeueuaqmt commeueuaqtm commeueuamqt commeueuamtq commeueuatmq commeueuatqm commeueutqam commeueutqma commeueutaqm
commeueutamq commeueutmaq commeueutmqa commeuemuqat commeuemuqta commeuemuaqt commeuemuatq commeuemutaq commeuemutqa
commeuemquat commeuemquta commeuemqaut commeuemqatu commeuemqtau commeuemqtua commeuemaqut commeuemaqtu commeuemauqt
commeuemautq commeuematuq commeuematqu commeuemtqau commeuemtqua commeuemtaqu commeuemtauq commeuemtuaq commeuemtuqa
commeueqmuat commeueqmuta commeueqmaut commeueqmatu commeueqmtau commeueqmtua commeuequmat commeuequmta commeuequamt
commeuequatm commeuequtam commeuequtma commeueqaumt commeueqautm commeueqamut commeueqamtu commeueqatmu commeueqatum
commeueqtuam commeueqtuma commeueqtaum commeueqtamu commeueqtmau commeueqtmua commeueamqut commeueamqtu commeueamuqt
commeueamutq commeueamtuq commeueamtqu commeueaqmut commeueaqmtu commeueaqumt commeueaqutm commeueaqtum commeueaqtmu
commeueauqmt commeueauqtm commeueaumqt commeueaumtq commeueautmq commeueautqm commeueatqum commeueatqmu commeueatuqm
commeueatumq commeueatmuq commeueatmqu commeuetmqau commeuetmqua commeuetmaqu commeuetmauq commeuetmuaq commeuetmuqa
commeuetqmau commeuetqmua commeuetqamu commeuetqaum commeuetquam commeuetquma commeuetaqmu commeuetaqum commeuetamqu
commeuetamuq commeuetaumq commeuetauqm commeuetuqam commeuetuqma commeuetuaqm commeuetuamq commeuetumaq commeuetumqa
commeetumqua commeetumqau commeetumuqa commeetumuaq commeetumauq commeetumaqu commeetuqmua commeetuqmau commeetuquma
commeetuquam commeetuqaum commeetuqamu commeetuuqma commeetuuqam commeetuumqa commeetuumaq commeetuuamq commeetuuaqm
commeetuaqum commeetuaqmu commeetuauqm commeetuaumq commeetuamuq commeetuamqu commeetmuqua commeetmuqau commeetmuuqa
commeetmuuaq commeetmuauq commeetmuaqu commeetmquua commeetmquau commeetmquua commeetmquau commeetmqauu commeetmqauu
commeetmuqua commeetmuqau commeetmuuqa commeetmuuaq commeetmuauq commeetmuaqu commeetmaquu commeetmaquu commeetmauqu
commeetmauuq commeetmauuq commeetmauqu commeetqmuua commeetqmuau commeetqmuua commeetqmuau commeetqmauu commeetqmauu
commeetqumua commeetqumau commeetquuma commeetquuam commeetquaum commeetquamu commeetquuma commeetquuam commeetqumua
commeetqumau commeetquamu commeetquaum commeetqauum commeetqaumu commeetqauum commeetqaumu commeetqamuu commeetqamuu
commeetumqua commeetumqau commeetumuqa commeetumuaq commeetumauq commeetumaqu commeetuqmua commeetuqmau commeetuquma
commeetuquam commeetuqaum commeetuqamu commeetuuqma commeetuuqam commeetuumqa commeetuumaq commeetuuamq commeetuuaqm
commeetuaqum commeetuaqmu commeetuauqm commeetuaumq commeetuamuq commeetuamqu commeetamquu commeetamquu commeetamuqu
commeetamuuq commeetamuuq commeetamuqu commeetaqmuu commeetaqmuu commeetaqumu commeetaquum commeetaquum commeetaqumu
commeetauqmu commeetauqum commeetaumqu commeetaumuq commeetauumq commeetauuqm commeetauqum commeetauqmu commeetauuqm
commeetauumq commeetaumuq commeetaumqu commeeutmqua commeeutmqau commeeutmuqa commeeutmuaq commeeutmauq commeeutmaqu
commeeutqmua commeeutqmau commeeutquma commeeutquam commeeutqaum commeeutqamu commeeutuqma commeeutuqam commeeutumqa
commeeutumaq commeeutuamq commeeutuaqm commeeutaqum commeeutaqmu commeeutauqm commeeutaumq commeeutamuq commeeutamqu
commeeumtqua commeeumtqau commeeumtuqa commeeumtuaq commeeumtauq commeeumtaqu commeeumqtua commeeumqtau commeeumquta
commeeumquat commeeumqaut commeeumqatu commeeumuqta commeeumuqat commeeumutqa commeeumutaq commeeumuatq commeeumuaqt
commeeumaqut commeeumaqtu commeeumauqt commeeumautq commeeumatuq commeeumatqu commeeuqmtua commeeuqmtau commeeuqmuta
commeeuqmuat commeeuqmaut commeeuqmatu commeeuqtmua commeeuqtmau commeeuqtuma commeeuqtuam commeeuqtaum commeeuqtamu
commeeuqutma commeeuqutam commeeuqumta commeeuqumat commeeuquamt commeeuquatm commeeuqatum commeeuqatmu commeeuqautm
commeeuqaumt commeeuqamut commeeuqamtu commeeuumqta commeeuumqat commeeuumtqa commeeuumtaq commeeuumatq commeeuumaqt
commeeuuqmta commeeuuqmat commeeuuqtma commeeuuqtam commeeuuqatm commeeuuqamt commeeuutqma commeeuutqam commeeuutmqa
commeeuutmaq commeeuutamq commeeuutaqm commeeuuaqtm commeeuuaqmt commeeuuatqm commeeuuatmq commeeuuamtq commeeuuamqt
commeeuamqut commeeuamqtu commeeuamuqt commeeuamutq commeeuamtuq commeeuamtqu commeeuaqmut commeeuaqmtu commeeuaqumt
commeeuaqutm commeeuaqtum commeeuaqtmu commeeuauqmt commeeuauqtm commeeuaumqt commeeuaumtq commeeuautmq commeeuautqm
commeeuatqum commeeuatqmu commeeuatuqm commeeuatumq commeeuatmuq commeeuatmqu commeemutqua commeemutqau commeemutuqa
commeemutuaq commeemutauq commeemutaqu commeemuqtua commeemuqtau commeemuquta commeemuquat commeemuqaut commeemuqatu
commeemuuqta commeemuuqat commeemuutqa commeemuutaq commeemuuatq commeemuuaqt commeemuaqut commeemuaqtu commeemuauqt
commeemuautq commeemuatuq commeemuatqu commeemtuqua commeemtuqau commeemtuuqa commeemtuuaq commeemtuauq commeemtuaqu
commeemtquua commeemtquau commeemtquua commeemtquau commeemtqauu commeemtqauu commeemtuqua commeemtuqau commeemtuuqa
commeemtuuaq commeemtuauq commeemtuaqu commeemtaquu commeemtaquu commeemtauqu commeemtauuq commeemtauuq commeemtauqu
commeemqtuua commeemqtuau commeemqtuua commeemqtuau commeemqtauu commeemqtauu commeemqutua commeemqutau commeemquuta
commeemquuat commeemquaut commeemquatu commeemquuta commeemquuat commeemqutua commeemqutau commeemquatu commeemquaut
commeemqauut commeemqautu commeemqauut commeemqautu commeemqatuu commeemqatuu commeemutqua commeemutqau commeemutuqa
commeemutuaq commeemutauq commeemutaqu commeemuqtua commeemuqtau commeemuquta commeemuquat commeemuqaut commeemuqatu
commeemuuqta commeemuuqat commeemuutqa commeemuutaq commeemuuatq commeemuuaqt commeemuaqut commeemuaqtu commeemuauqt
commeemuautq commeemuatuq commeemuatqu commeematquu commeematquu commeematuqu commeematuuq commeematuuq commeematuqu
commeemaqtuu commeemaqtuu commeemaqutu commeemaquut commeemaquut commeemaqutu commeemauqtu commeemauqut commeemautqu
commeemautuq commeemauutq commeemauuqt commeemauqut commeemauqtu commeemauuqt commeemauutq commeemautuq commeemautqu
commeequmtua commeequmtau commeequmuta commeequmuat commeequmaut commeequmatu commeequtmua commeequtmau commeequtuma
commeequtuam commeequtaum commeequtamu commeequutma commeequutam commeequumta commeequumat commeequuamt commeequuatm
commeequatum commeequatmu commeequautm commeequaumt commeequamut commeequamtu commeeqmutua commeeqmutau commeeqmuuta
commeeqmuuat commeeqmuaut commeeqmuatu commeeqmtuua commeeqmtuau commeeqmtuua commeeqmtuau commeeqmtauu commeeqmtauu
commeeqmutua commeeqmutau commeeqmuuta commeeqmuuat commeeqmuaut commeeqmuatu commeeqmatuu commeeqmatuu commeeqmautu
commeeqmauut commeeqmauut commeeqmautu commeeqtmuua commeeqtmuau commeeqtmuua commeeqtmuau commeeqtmauu commeeqtmauu
commeeqtumua commeeqtumau commeeqtuuma commeeqtuuam commeeqtuaum commeeqtuamu commeeqtuuma commeeqtuuam commeeqtumua
commeeqtumau commeeqtuamu commeeqtuaum commeeqtauum commeeqtaumu commeeqtauum commeeqtaumu commeeqtamuu commeeqtamuu
commeequmtua commeequmtau commeequmuta commeequmuat commeequmaut commeequmatu commeequtmua commeequtmau commeequtuma
commeequtuam commeequtaum commeequtamu commeequutma commeequutam commeequumta commeequumat commeequuamt commeequuatm
commeequatum commeequatmu commeequautm commeequaumt commeequamut commeequamtu commeeqamtuu commeeqamtuu commeeqamutu
commeeqamuut commeeqamuut commeeqamutu commeeqatmuu commeeqatmuu commeeqatumu commeeqatuum commeeqatuum commeeqatumu
commeeqautmu commeeqautum commeeqaumtu commeeqaumut commeeqauumt commeeqauutm commeeqautum commeeqautmu commeeqauutm
commeeqauumt commeeqaumut commeeqaumtu commeeuumqta commeeuumqat commeeuumtqa commeeuumtaq commeeuumatq commeeuumaqt
commeeuuqmta commeeuuqmat commeeuuqtma commeeuuqtam commeeuuqatm commeeuuqamt commeeuutqma commeeuutqam commeeuutmqa
commeeuutmaq commeeuutamq commeeuutaqm commeeuuaqtm commeeuuaqmt commeeuuatqm commeeuuatmq commeeuuamtq commeeuuamqt
commeeumuqta commeeumuqat commeeumutqa commeeumutaq commeeumuatq commeeumuaqt commeeumquta commeeumquat commeeumqtua
commeeumqtau commeeumqatu commeeumqaut commeeumtqua commeeumtqau commeeumtuqa commeeumtuaq commeeumtauq commeeumtaqu
commeeumaqtu commeeumaqut commeeumatqu commeeumatuq commeeumautq commeeumauqt commeeuqmuta commeeuqmuat commeeuqmtua
commeeuqmtau commeeuqmatu commeeuqmaut commeeuqumta commeeuqumat commeeuqutma commeeuqutam commeeuquatm commeeuquamt
commeeuqtuma commeeuqtuam commeeuqtmua commeeuqtmau commeeuqtamu commeeuqtaum commeeuqautm commeeuqaumt commeeuqatum
commeeuqatmu commeeuqamtu commeeuqamut commeeutmqua commeeutmqau commeeutmuqa commeeutmuaq commeeutmauq commeeutmaqu
commeeutqmua commeeutqmau commeeutquma commeeutquam commeeutqaum commeeutqamu commeeutuqma commeeutuqam commeeutumqa
commeeutumaq commeeutuamq commeeutuaqm commeeutaqum commeeutaqmu commeeutauqm commeeutaumq commeeutamuq commeeutamqu
commeeuamqtu commeeuamqut commeeuamtqu commeeuamtuq commeeuamutq commeeuamuqt commeeuaqmtu commeeuaqmut commeeuaqtmu
commeeuaqtum commeeuaqutm commeeuaqumt commeeuatqmu commeeuatqum commeeuatmqu commeeuatmuq commeeuatumq commeeuatuqm
commeeuauqtm commeeuauqmt commeeuautqm commeeuautmq commeeuaumtq commeeuaumqt commeeaumqut commeeaumqtu commeeaumuqt
commeeaumutq commeeaumtuq commeeaumtqu commeeauqmut commeeauqmtu commeeauqumt commeeauqutm commeeauqtum commeeauqtmu
commeeauuqmt commeeauuqtm commeeauumqt commeeauumtq commeeauutmq commeeauutqm commeeautqum commeeautqmu commeeautuqm
commeeautumq commeeautmuq commeeautmqu commeeamuqut commeeamuqtu commeeamuuqt commeeamuutq commeeamutuq commeeamutqu
commeeamquut commeeamqutu commeeamquut commeeamqutu commeeamqtuu commeeamqtuu commeeamuqut commeeamuqtu commeeamuuqt
commeeamuutq commeeamutuq commeeamutqu commeeamtquu commeeamtquu commeeamtuqu commeeamtuuq commeeamtuuq commeeamtuqu
commeeaqmuut commeeaqmutu commeeaqmuut commeeaqmutu commeeaqmtuu commeeaqmtuu commeeaqumut commeeaqumtu commeeaquumt
commeeaquutm commeeaqutum commeeaqutmu commeeaquumt commeeaquutm commeeaqumut commeeaqumtu commeeaqutmu commeeaqutum
commeeaqtuum commeeaqtumu commeeaqtuum commeeaqtumu commeeaqtmuu commeeaqtmuu commeeaumqut commeeaumqtu commeeaumuqt
commeeaumutq commeeaumtuq commeeaumtqu commeeauqmut commeeauqmtu commeeauqumt commeeauqutm commeeauqtum commeeauqtmu
commeeauuqmt commeeauuqtm commeeauumqt commeeauumtq commeeauutmq commeeauutqm commeeautqum commeeautqmu commeeautuqm
commeeautumq commeeautmuq commeeautmqu commeeatmquu commeeatmquu commeeatmuqu commeeatmuuq commeeatmuuq commeeatmuqu
commeeatqmuu commeeatqmuu commeeatqumu commeeatquum commeeatquum commeeatqumu commeeatuqmu commeeatuqum commeeatumqu
commeeatumuq commeeatuumq commeeatuuqm commeeatuqum commeeatuqmu commeeatuuqm commeeatuumq commeeatumuq commeeatumqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us