easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

exceperit

beguard

memet

saens

lipskin

jurczak

anthro

sufferbus

microporous

sayuri

nebel

obuersabatur

castlemaine

rhizogenetic

gillentine

heterolecithal

exspectatamque

courteous


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: colemusque
cipher variations:
dpmfnvtrvf eqngowuswg frohpxvtxh gspiqywuyi htqjrzxvzj
iurksaywak jvsltbzxbl kwtmucaycm lxunvdbzdn myvowecaeo
nzwpxfdbfp oaxqygecgq pbyrzhfdhr qczsaigeis rdatbjhfjt
sebuckigku tfcvdljhlv ugdwemkimw vhexfnljnx wifygomkoy
xjgzhpnlpz ykhaiqomqa zlibjrpnrb amjcksqosc bnkdltrptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: colemusque
Cipher: xlovnfhjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: colemusque
Cipher: AAABA ABBAB ABABA AABAA ABABB BAABB BAAAB ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: colemusque
cipher variations:
dpmfnvtrvfhrinljdxjnltevjxndxvpvadhlxjldtxwlfzhpzlxzstdnrvntfdkjzplhpjjfgrxdvndr
nhczvrftrzrjyhtfpzfhvluprtzftpznqxphjlhxeqngowuswgisjomkeykomufwkyoeywqwbeimykme
uyxmgaiqamyatueoswougelkaqmiqkkghsyewoesoidawsgusaskziugqagiwmvqsuaguqaoryqikmiy
frohpxvtxhjtkpnlfzlpnvgxlzpfzxrxcfjnzlnfvzynhbjrbnzbuvfptxpvhfmlbrnjrllhitzfxpft
pjebxthvtbtlajvhrbhjxnwrtvbhvrbpszrjlnjzgspiqywuyikulqomgamqowhymaqgaysydgkoamog
wazoickscoacvwgquyqwignmcsoksmmijuagyqguqkfcyuiwucumbkwiscikyoxsuwciwscqtaskmoka
htqjrzxvzjlvmrpnhbnrpxiznbrhbztzehlpbnphxbapjdltdpbdwxhrvzrxjhondtpltnnjkvbhzrhv
rlgdzvjxvdvnclxjtdjlzpytvxdjxtdrubtlnplbiurksaywakmwnsqoicosqyjaocsicauafimqcoqi
ycbqkemueqcexyiswasykipoeuqmuooklwciasiwsmheawkywewodmykuekmaqzuwyekyuesvcumoqmc
jvsltbzxblnxotrpjdptrzkbpdtjdbvbgjnrdprjzdcrlfnvfrdfyzjtxbtzljqpfvrnvpplmxdjbtjx
tnifbxlzxfxpenzlvflnbravxzflzvftwdvnprndkwtmucaycmoypusqkequsalcqeukecwchkoseqsk
aedsmgowgsegzakuycuamkrqgwsowqqmnyekcukyuojgcymaygyqfoamwgmocsbwyagmawguxewoqsoe
lxunvdbzdnpzqvtrlfrvtbmdrfvlfdxdilptfrtlbfetnhpxhtfhablvzdvbnlsrhxtpxrrnozfldvlz
vpkhdznbzhzrgpbnxhnpdtcxzbhnbxhvyfxprtpfmyvowecaeoqarwusmgswucnesgwmgeyejmqugsum
cgfuoiqyiugibcmwaewcomtsiyuqyssopagmewmawqlieaocaiashqcoyioqeudyaciocyiwzgyqsuqg
nzwpxfdbfprbsxvtnhtxvdofthxnhfzfknrvhtvndhgvpjrzjvhjcdnxbfxdpnutjzvrzttpqbhnfxnb
xrmjfbpdbjbtirdpzjprfvezbdjpdzjxahzrtvrhoaxqygecgqsctywuoiuywepguiyoigagloswiuwo
eihwqksakwikdeoycgyeqovukawsauuqrciogyocysnkgcqeckcujseqakqsgwfacekqeakybiasuwsi
pbyrzhfdhrtduzxvpjvzxfqhvjzpjhbhmptxjvxpfjixrltblxjlefpzdhzfrpwvlbxtbvvrsdjphzpd
ztolhdrfdldvktfrblrthxgbdflrfblzcjbtvxtjqczsaigeisuevaywqkwaygriwkaqkicinquykwyq
gkjysmucmykmfgqaeiagsqxwmcyucwwstekqiaqeaupmiesgemewlugscmsuiyhcegmsgcmadkcuwyuk
rdatbjhfjtvfwbzxrlxbzhsjxlbrljdjorvzlxzrhlkztnvdnzlnghrbfjbhtryxndzvdxxtuflrjbrf
bvqnjfthfnfxmvhtdntvjzidfhnthdnbeldvxzvlsebuckigkuwgxcaysmycaitkymcsmkekpswamyas
imlauoweoamohiscgkciuszyoeaweyyuvgmskcsgcwrokguigogynwiueouwkajegiouieocfmewyawm
tfcvdljhlvxhydbztnzdbjulzndtnlflqtxbnzbtjnmbvpxfpbnpijtdhldjvtazpfbxfzzvwhntldth
dxsplhvjhphzoxjvfpvxlbkfhjpvjfpdgnfxzbxnugdwemkimwyizecauoaeckvmaoeuomgmruycoacu
koncwqygqcoqjkueimekwubaqgcygaawxioumeuieytqmiwkiqiapykwgqwymclgikqwkgqehogyacyo
vhexfnljnxzjafdbvpbfdlwnbpfvpnhnsvzdpbdvlpodxrzhrdprklvfjnflxvcbrhdzhbbxyjpvnfvj
fzurnjxljrjbqzlxhrxzndmhjlrxlhrfiphzbdzpwifygomkoyakbgecwqcgemxocqgwqoiotwaeqcew
mqpeysaiseqslmwgkogmywdcsieaiccyzkqwogwkgavsokymkskcramyisyaoenikmsymisgjqiaceaq
xjgzhpnlpzblchfdxrdhfnypdrhxrpjpuxbfrdfxnrqfztbjtfrtmnxhlphnzxedtjfbjddzalrxphxl
hbwtplznltldsbnzjtzbpfojlntznjthkrjbdfbrykhaiqomqacmdigeyseigozqesiysqkqvycgsegy
osrgauckugsunoyimqioayfeukgckeeabmsyqiymicxuqmaomumetcoakuacqgpkmouaokuilskcegcs
zlibjrpnrbdnejhfztfjhparftjztrlrwzdhtfhzptshbvdlvhtvopzjnrjpbzgfvlhdlffbcntzrjzn
jdyvrnbpnvnfudpblvbdrhqlnpvbplvjmtldfhdtamjcksqosceofkigaugkiqbsgukausmsxaeiugia
quticwemwiuwpqakoskqcahgwmiemggcdouaskaokezwsocqowogveqcmwcesirmoqwcqmwknumegieu
bnkdltrptdfpgljhbvhljrcthvlbvtntybfjvhjbrvujdxfnxjvxqrblptlrdbihxnjfnhhdepvbtlbp
lfaxtpdrpxphwfrdnxdftjsnprxdrnxlovnfhjfvcolemusquegqhmkicwimksduiwmcwuouzcgkwikc
swvkeygoykwyrscmqumsecjiyokgoiiefqwcumcqmgbyuqesqyqixgseoyeguktoqsyesoympwogikgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: colemusque
Cipher: pbyrzhfdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: colemusque
Cipher: 31431351235434145451

Extended Methods:
Method #1

Plaintext: colemusque
method variations:
htqkrzxvzknyvpwecaepsdaubkhfkuxifzgpnlpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
c o l e m u s q u e 
3 4 1 5 2 5 3 1 5 5 
1 3 3 1 3 4 4 4 4 1 
They are then read out in rows:
34152531551331344441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: colemusque
Cipher: svwczlcstd

Read more ...
Method #3

Plaintext: colemusque
method variations:
qcxfxodyyl cxfxodyylq xfxodyylqc
fxodyylqcx xodyylqcxf odyylqcxfx
dyylqcxfxo yylqcxfxod ylqcxfxody
lqcxfxodyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: colemusque

first 5040 cipher variations(3628800 total)
colemusque colemusqeu colemusuqe colemusueq colemuseuq colemusequ colemuqsue colemuqseu colemuquse colemuques colemuqeus
colemuqesu colemuuqse colemuuqes colemuusqe colemuuseq colemuuesq colemuueqs colemuequs colemueqsu colemueuqs colemueusq
colemuesuq colemuesqu colemsuque colemsuqeu colemsuuqe colemsuueq colemsueuq colemsuequ colemsquue colemsqueu colemsquue
colemsqueu colemsqeuu colemsqeuu colemsuque colemsuqeu colemsuuqe colemsuueq colemsueuq colemsuequ colemsequu colemsequu
colemseuqu colemseuuq colemseuuq colemseuqu colemqsuue colemqsueu colemqsuue colemqsueu colemqseuu colemqseuu colemqusue
colemquseu colemquuse colemquues colemqueus colemquesu colemquuse colemquues colemqusue colemquseu colemquesu colemqueus
colemqeuus colemqeusu colemqeuus colemqeusu colemqesuu colemqesuu colemusque colemusqeu colemusuqe colemusueq colemuseuq
colemusequ colemuqsue colemuqseu colemuquse colemuques colemuqeus colemuqesu colemuuqse colemuuqes colemuusqe colemuuseq
colemuuesq colemuueqs colemuequs colemueqsu colemueuqs colemueusq colemuesuq colemuesqu colemesquu colemesquu colemesuqu
colemesuuq colemesuuq colemesuqu colemeqsuu colemeqsuu colemequsu colemequus colemequus colemequsu colemeuqsu colemeuqus
colemeusqu colemeusuq colemeuusq colemeuuqs colemeuqus colemeuqsu colemeuuqs colemeuusq colemeusuq colemeusqu coleumsque
coleumsqeu coleumsuqe coleumsueq coleumseuq coleumsequ coleumqsue coleumqseu coleumquse coleumques coleumqeus coleumqesu
coleumuqse coleumuqes coleumusqe coleumuseq coleumuesq coleumueqs coleumequs coleumeqsu coleumeuqs coleumeusq coleumesuq
coleumesqu coleusmque coleusmqeu coleusmuqe coleusmueq coleusmeuq coleusmequ coleusqmue coleusqmeu coleusqume coleusquem
coleusqeum coleusqemu coleusuqme coleusuqem coleusumqe coleusumeq coleusuemq coleusueqm coleusequm coleuseqmu coleuseuqm
coleuseumq coleusemuq coleusemqu coleuqsmue coleuqsmeu coleuqsume coleuqsuem coleuqseum coleuqsemu coleuqmsue coleuqmseu
coleuqmuse coleuqmues coleuqmeus coleuqmesu coleuqumse coleuqumes coleuqusme coleuqusem coleuquesm coleuquems coleuqemus
coleuqemsu coleuqeums coleuqeusm coleuqesum coleuqesmu coleuusqme coleuusqem coleuusmqe coleuusmeq coleuusemq coleuuseqm
coleuuqsme coleuuqsem coleuuqmse coleuuqmes coleuuqems coleuuqesm coleuumqse coleuumqes coleuumsqe coleuumseq coleuumesq
coleuumeqs coleuueqms coleuueqsm coleuuemqs coleuuemsq coleuuesmq coleuuesqm coleuesqum coleuesqmu coleuesuqm coleuesumq
coleuesmuq coleuesmqu coleueqsum coleueqsmu coleuequsm coleuequms coleueqmus coleueqmsu coleueuqsm coleueuqms coleueusqm
coleueusmq coleueumsq coleueumqs coleuemqus coleuemqsu coleuemuqs coleuemusq coleuemsuq coleuemsqu colesumque colesumqeu
colesumuqe colesumueq colesumeuq colesumequ colesuqmue colesuqmeu colesuqume colesuquem colesuqeum colesuqemu colesuuqme
colesuuqem colesuumqe colesuumeq colesuuemq colesuueqm colesuequm colesueqmu colesueuqm colesueumq colesuemuq colesuemqu
colesmuque colesmuqeu colesmuuqe colesmuueq colesmueuq colesmuequ colesmquue colesmqueu colesmquue colesmqueu colesmqeuu
colesmqeuu colesmuque colesmuqeu colesmuuqe colesmuueq colesmueuq colesmuequ colesmequu colesmequu colesmeuqu colesmeuuq
colesmeuuq colesmeuqu colesqmuue colesqmueu colesqmuue colesqmueu colesqmeuu colesqmeuu colesqumue colesqumeu colesquume
colesquuem colesqueum colesquemu colesquume colesquuem colesqumue colesqumeu colesquemu colesqueum colesqeuum colesqeumu
colesqeuum colesqeumu colesqemuu colesqemuu colesumque colesumqeu colesumuqe colesumueq colesumeuq colesumequ colesuqmue
colesuqmeu colesuqume colesuquem colesuqeum colesuqemu colesuuqme colesuuqem colesuumqe colesuumeq colesuuemq colesuueqm
colesuequm colesueqmu colesueuqm colesueumq colesuemuq colesuemqu colesemquu colesemquu colesemuqu colesemuuq colesemuuq
colesemuqu coleseqmuu coleseqmuu colesequmu colesequum colesequum colesequmu coleseuqmu coleseuqum coleseumqu coleseumuq
coleseuumq coleseuuqm coleseuqum coleseuqmu coleseuuqm coleseuumq coleseumuq coleseumqu colequsmue colequsmeu colequsume
colequsuem colequseum colequsemu colequmsue colequmseu colequmuse colequmues colequmeus colequmesu colequumse colequumes
colequusme colequusem colequuesm colequuems colequemus colequemsu colequeums colequeusm colequesum colequesmu coleqsumue
coleqsumeu coleqsuume coleqsuuem coleqsueum coleqsuemu coleqsmuue coleqsmueu coleqsmuue coleqsmueu coleqsmeuu coleqsmeuu
coleqsumue coleqsumeu coleqsuume coleqsuuem coleqsueum coleqsuemu coleqsemuu coleqsemuu coleqseumu coleqseuum coleqseuum
coleqseumu coleqmsuue coleqmsueu coleqmsuue coleqmsueu coleqmseuu coleqmseuu coleqmusue coleqmuseu coleqmuuse coleqmuues
coleqmueus coleqmuesu coleqmuuse coleqmuues coleqmusue coleqmuseu coleqmuesu coleqmueus coleqmeuus coleqmeusu coleqmeuus
coleqmeusu coleqmesuu coleqmesuu colequsmue colequsmeu colequsume colequsuem colequseum colequsemu colequmsue colequmseu
colequmuse colequmues colequmeus colequmesu colequumse colequumes colequusme colequusem colequuesm colequuems colequemus
colequemsu colequeums colequeusm colequesum colequesmu coleqesmuu coleqesmuu coleqesumu coleqesuum coleqesuum coleqesumu
coleqemsuu coleqemsuu coleqemusu coleqemuus coleqemuus coleqemusu coleqeumsu coleqeumus coleqeusmu coleqeusum coleqeuusm
coleqeuums coleqeumus coleqeumsu coleqeuums coleqeuusm coleqeusum coleqeusmu coleuusqme coleuusqem coleuusmqe coleuusmeq
coleuusemq coleuuseqm coleuuqsme coleuuqsem coleuuqmse coleuuqmes coleuuqems coleuuqesm coleuumqse coleuumqes coleuumsqe
coleuumseq coleuumesq coleuumeqs coleuueqms coleuueqsm coleuuemqs coleuuemsq coleuuesmq coleuuesqm coleusuqme coleusuqem
coleusumqe coleusumeq coleusuemq coleusueqm coleusqume coleusquem coleusqmue coleusqmeu coleusqemu coleusqeum coleusmque
coleusmqeu coleusmuqe coleusmueq coleusmeuq coleusmequ coleuseqmu coleusequm coleusemqu coleusemuq coleuseumq coleuseuqm
coleuqsume coleuqsuem coleuqsmue coleuqsmeu coleuqsemu coleuqseum coleuqusme coleuqusem coleuqumse coleuqumes coleuquems
coleuquesm coleuqmuse coleuqmues coleuqmsue coleuqmseu coleuqmesu coleuqmeus coleuqeums coleuqeusm coleuqemus coleuqemsu
coleuqesmu coleuqesum coleumsque coleumsqeu coleumsuqe coleumsueq coleumseuq coleumsequ coleumqsue coleumqseu coleumquse
coleumques coleumqeus coleumqesu coleumuqse coleumuqes coleumusqe coleumuseq coleumuesq coleumueqs coleumequs coleumeqsu
coleumeuqs coleumeusq coleumesuq coleumesqu coleuesqmu coleuesqum coleuesmqu coleuesmuq coleuesumq coleuesuqm coleueqsmu
coleueqsum coleueqmsu coleueqmus coleuequms coleuequsm coleuemqsu coleuemqus coleuemsqu coleuemsuq coleuemusq coleuemuqs
coleueuqms coleueuqsm coleueumqs coleueumsq coleueusmq coleueusqm coleeusqum coleeusqmu coleeusuqm coleeusumq coleeusmuq
coleeusmqu coleeuqsum coleeuqsmu coleeuqusm coleeuqums coleeuqmus coleeuqmsu coleeuuqsm coleeuuqms coleeuusqm coleeuusmq
coleeuumsq coleeuumqs coleeumqus coleeumqsu coleeumuqs coleeumusq coleeumsuq coleeumsqu coleesuqum coleesuqmu coleesuuqm
coleesuumq coleesumuq coleesumqu coleesquum coleesqumu coleesquum coleesqumu coleesqmuu coleesqmuu coleesuqum coleesuqmu
coleesuuqm coleesuumq coleesumuq coleesumqu coleesmquu coleesmquu coleesmuqu coleesmuuq coleesmuuq coleesmuqu coleeqsuum
coleeqsumu coleeqsuum coleeqsumu coleeqsmuu coleeqsmuu coleequsum coleequsmu coleequusm coleequums coleequmus coleequmsu
coleequusm coleequums coleequsum coleequsmu coleequmsu coleequmus coleeqmuus coleeqmusu coleeqmuus coleeqmusu coleeqmsuu
coleeqmsuu coleeusqum coleeusqmu coleeusuqm coleeusumq coleeusmuq coleeusmqu coleeuqsum coleeuqsmu coleeuqusm coleeuqums
coleeuqmus coleeuqmsu coleeuuqsm coleeuuqms coleeuusqm coleeuusmq coleeuumsq coleeuumqs coleeumqus coleeumqsu coleeumuqs
coleeumusq coleeumsuq coleeumsqu coleemsquu coleemsquu coleemsuqu coleemsuuq coleemsuuq coleemsuqu coleemqsuu coleemqsuu
coleemqusu coleemquus coleemquus coleemqusu coleemuqsu coleemuqus coleemusqu coleemusuq coleemuusq coleemuuqs coleemuqus
coleemuqsu coleemuuqs coleemuusq coleemusuq coleemusqu colmeusque colmeusqeu colmeusuqe colmeusueq colmeuseuq colmeusequ
colmeuqsue colmeuqseu colmeuquse colmeuques colmeuqeus colmeuqesu colmeuuqse colmeuuqes colmeuusqe colmeuuseq colmeuuesq
colmeuueqs colmeuequs colmeueqsu colmeueuqs colmeueusq colmeuesuq colmeuesqu colmesuque colmesuqeu colmesuuqe colmesuueq
colmesueuq colmesuequ colmesquue colmesqueu colmesquue colmesqueu colmesqeuu colmesqeuu colmesuque colmesuqeu colmesuuqe
colmesuueq colmesueuq colmesuequ colmesequu colmesequu colmeseuqu colmeseuuq colmeseuuq colmeseuqu colmeqsuue colmeqsueu
colmeqsuue colmeqsueu colmeqseuu colmeqseuu colmequsue colmequseu colmequuse colmequues colmequeus colmequesu colmequuse
colmequues colmequsue colmequseu colmequesu colmequeus colmeqeuus colmeqeusu colmeqeuus colmeqeusu colmeqesuu colmeqesuu
colmeusque colmeusqeu colmeusuqe colmeusueq colmeuseuq colmeusequ colmeuqsue colmeuqseu colmeuquse colmeuques colmeuqeus
colmeuqesu colmeuuqse colmeuuqes colmeuusqe colmeuuseq colmeuuesq colmeuueqs colmeuequs colmeueqsu colmeueuqs colmeueusq
colmeuesuq colmeuesqu colmeesquu colmeesquu colmeesuqu colmeesuuq colmeesuuq colmeesuqu colmeeqsuu colmeeqsuu colmeequsu
colmeequus colmeequus colmeequsu colmeeuqsu colmeeuqus colmeeusqu colmeeusuq colmeeuusq colmeeuuqs colmeeuqus colmeeuqsu
colmeeuuqs colmeeuusq colmeeusuq colmeeusqu colmuesque colmuesqeu colmuesuqe colmuesueq colmueseuq colmuesequ colmueqsue
colmueqseu colmuequse colmueques colmueqeus colmueqesu colmueuqse colmueuqes colmueusqe colmueuseq colmueuesq colmueueqs
colmueequs colmueeqsu colmueeuqs colmueeusq colmueesuq colmueesqu colmuseque colmuseqeu colmuseuqe colmuseueq colmuseeuq
colmuseequ colmusqeue colmusqeeu colmusquee colmusquee colmusqeue colmusqeeu colmusuqee colmusuqee colmusueqe colmusueeq
colmusueeq colmusueqe colmuseque colmuseqeu colmuseuqe colmuseueq colmuseeuq colmuseequ colmuqseue colmuqseeu colmuqsuee
colmuqsuee colmuqseue colmuqseeu colmuqesue colmuqeseu colmuqeuse colmuqeues colmuqeeus colmuqeesu colmuquese colmuquees
colmuqusee colmuqusee colmuquese colmuquees colmuqeeus colmuqeesu colmuqeues colmuqeuse colmuqesue colmuqeseu colmuusqee
colmuusqee colmuuseqe colmuuseeq colmuuseeq colmuuseqe colmuuqsee colmuuqsee colmuuqese colmuuqees colmuuqees colmuuqese
colmuueqse colmuueqes colmuuesqe colmuueseq colmuueesq colmuueeqs colmuueqes colmuueqse colmuueeqs colmuueesq colmuueseq
colmuuesqe colmuesque colmuesqeu colmuesuqe colmuesueq colmueseuq colmuesequ colmueqsue colmueqseu colmuequse colmueques
colmueqeus colmueqesu colmueuqse colmueuqes colmueusqe colmueuseq colmueuesq colmueueqs colmueequs colmueeqsu colmueeuqs
colmueeusq colmueesuq colmueesqu colmsueque colmsueqeu colmsueuqe colmsueueq colmsueeuq colmsueequ colmsuqeue colmsuqeeu
colmsuquee colmsuquee colmsuqeue colmsuqeeu colmsuuqee colmsuuqee colmsuueqe colmsuueeq colmsuueeq colmsuueqe colmsueque
colmsueqeu colmsueuqe colmsueueq colmsueeuq colmsueequ colmseuque colmseuqeu colmseuuqe colmseuueq colmseueuq colmseuequ
colmsequue colmsequeu colmsequue colmsequeu colmseqeuu colmseqeuu colmseuque colmseuqeu colmseuuqe colmseuueq colmseueuq
colmseuequ colmseequu colmseequu colmseeuqu colmseeuuq colmseeuuq colmseeuqu colmsqeuue colmsqeueu colmsqeuue colmsqeueu
colmsqeeuu colmsqeeuu colmsqueue colmsqueeu colmsquuee colmsquuee colmsqueue colmsqueeu colmsquuee colmsquuee colmsqueue
colmsqueeu colmsqueeu colmsqueue colmsqeuue colmsqeueu colmsqeuue colmsqeueu colmsqeeuu colmsqeeuu colmsueque colmsueqeu
colmsueuqe colmsueueq colmsueeuq colmsueequ colmsuqeue colmsuqeeu colmsuquee colmsuquee colmsuqeue colmsuqeeu colmsuuqee
colmsuuqee colmsuueqe colmsuueeq colmsuueeq colmsuueqe colmsueque colmsueqeu colmsueuqe colmsueueq colmsueeuq colmsueequ
colmseequu colmseequu colmseeuqu colmseeuuq colmseeuuq colmseeuqu colmseqeuu colmseqeuu colmsequeu colmsequue colmsequue
colmsequeu colmseuqeu colmseuque colmseuequ colmseueuq colmseuueq colmseuuqe colmseuque colmseuqeu colmseuuqe colmseuueq
colmseueuq colmseuequ colmquseue colmquseeu colmqusuee colmqusuee colmquseue colmquseeu colmquesue colmqueseu colmqueuse
colmqueues colmqueeus colmqueesu colmquuese colmquuees colmquusee colmquusee colmquuese colmquuees colmqueeus colmqueesu
colmqueues colmqueuse colmquesue colmqueseu colmqsueue colmqsueeu colmqsuuee colmqsuuee colmqsueue colmqsueeu colmqseuue
colmqseueu colmqseuue colmqseueu colmqseeuu colmqseeuu colmqsueue colmqsueeu colmqsuuee colmqsuuee colmqsueue colmqsueeu
colmqseeuu colmqseeuu colmqseueu colmqseuue colmqseuue colmqseueu colmqesuue colmqesueu colmqesuue colmqesueu colmqeseuu
colmqeseuu colmqeusue colmqeuseu colmqeuuse colmqeuues colmqeueus colmqeuesu colmqeuuse colmqeuues colmqeusue colmqeuseu
colmqeuesu colmqeueus colmqeeuus colmqeeusu colmqeeuus colmqeeusu colmqeesuu colmqeesuu colmquseue colmquseeu colmqusuee
colmqusuee colmquseue colmquseeu colmquesue colmqueseu colmqueuse colmqueues colmqueeus colmqueesu colmquuese colmquuees
colmquusee colmquusee colmquuese colmquuees colmqueeus colmqueesu colmqueues colmqueuse colmquesue colmqueseu colmqeseuu
colmqeseuu colmqesueu colmqesuue colmqesuue colmqesueu colmqeesuu colmqeesuu colmqeeusu colmqeeuus colmqeeuus colmqeeusu
colmqeuesu colmqeueus colmqeuseu colmqeusue colmqeuuse colmqeuues colmqeueus colmqeuesu colmqeuues colmqeuuse colmqeusue
colmqeuseu colmuusqee colmuusqee colmuuseqe colmuuseeq colmuuseeq colmuuseqe colmuuqsee colmuuqsee colmuuqese colmuuqees
colmuuqees colmuuqese colmuueqse colmuueqes colmuuesqe colmuueseq colmuueesq colmuueeqs colmuueqes colmuueqse colmuueeqs
colmuueesq colmuueseq colmuuesqe colmusuqee colmusuqee colmusueqe colmusueeq colmusueeq colmusueqe colmusquee colmusquee
colmusqeue colmusqeeu colmusqeeu colmusqeue colmuseque colmuseqeu colmuseuqe colmuseueq colmuseeuq colmuseequ colmuseqeu
colmuseque colmuseequ colmuseeuq colmuseueq colmuseuqe colmuqsuee colmuqsuee colmuqseue colmuqseeu colmuqseeu colmuqseue
colmuqusee colmuqusee colmuquese colmuquees colmuquees colmuquese colmuqeuse colmuqeues colmuqesue colmuqeseu colmuqeesu
colmuqeeus colmuqeues colmuqeuse colmuqeeus colmuqeesu colmuqeseu colmuqesue colmuesque colmuesqeu colmuesuqe colmuesueq
colmueseuq colmuesequ colmueqsue colmueqseu colmuequse colmueques colmueqeus colmueqesu colmueuqse colmueuqes colmueusqe
colmueuseq colmueuesq colmueueqs colmueequs colmueeqsu colmueeuqs colmueeusq colmueesuq colmueesqu colmuesqeu colmuesque
colmuesequ colmueseuq colmuesueq colmuesuqe colmueqseu colmueqsue colmueqesu colmueqeus colmueques colmuequse colmueeqsu
colmueequs colmueesqu colmueesuq colmueeusq colmueeuqs colmueuqes colmueuqse colmueueqs colmueuesq colmueuseq colmueusqe
colmeusque colmeusqeu colmeusuqe colmeusueq colmeuseuq colmeusequ colmeuqsue colmeuqseu colmeuquse colmeuques colmeuqeus
colmeuqesu colmeuuqse colmeuuqes colmeuusqe colmeuuseq colmeuuesq colmeuueqs colmeuequs colmeueqsu colmeueuqs colmeueusq
colmeuesuq colmeuesqu colmesuque colmesuqeu colmesuuqe colmesuueq colmesueuq colmesuequ colmesquue colmesqueu colmesquue
colmesqueu colmesqeuu colmesqeuu colmesuque colmesuqeu colmesuuqe colmesuueq colmesueuq colmesuequ colmesequu colmesequu
colmeseuqu colmeseuuq colmeseuuq colmeseuqu colmeqsuue colmeqsueu colmeqsuue colmeqsueu colmeqseuu colmeqseuu colmequsue
colmequseu colmequuse colmequues colmequeus colmequesu colmequuse colmequues colmequsue colmequseu colmequesu colmequeus
colmeqeuus colmeqeusu colmeqeuus colmeqeusu colmeqesuu colmeqesuu colmeusque colmeusqeu colmeusuqe colmeusueq colmeuseuq
colmeusequ colmeuqsue colmeuqseu colmeuquse colmeuques colmeuqeus colmeuqesu colmeuuqse colmeuuqes colmeuusqe colmeuuseq
colmeuuesq colmeuueqs colmeuequs colmeueqsu colmeueuqs colmeueusq colmeuesuq colmeuesqu colmeesquu colmeesquu colmeesuqu
colmeesuuq colmeesuuq colmeesuqu colmeeqsuu colmeeqsuu colmeequsu colmeequus colmeequus colmeequsu colmeeuqsu colmeeuqus
colmeeusqu colmeeusuq colmeeuusq colmeeuuqs colmeeuqus colmeeuqsu colmeeuuqs colmeeuusq colmeeusuq colmeeusqu columesque
columesqeu columesuqe columesueq columeseuq columesequ columeqsue columeqseu columequse columeques columeqeus columeqesu
columeuqse columeuqes columeusqe columeuseq columeuesq columeueqs columeequs columeeqsu columeeuqs columeeusq columeesuq
columeesqu columseque columseqeu columseuqe columseueq columseeuq columseequ columsqeue columsqeeu columsquee columsquee
columsqeue columsqeeu columsuqee columsuqee columsueqe columsueeq columsueeq columsueqe columseque columseqeu columseuqe
columseueq columseeuq columseequ columqseue columqseeu columqsuee columqsuee columqseue columqseeu columqesue columqeseu
columqeuse columqeues columqeeus columqeesu columquese columquees columqusee columqusee columquese columquees columqeeus
columqeesu columqeues columqeuse columqesue columqeseu columusqee columusqee columuseqe columuseeq columuseeq columuseqe
columuqsee columuqsee columuqese columuqees columuqees columuqese columueqse columueqes columuesqe columueseq columueesq
columueeqs columueqes columueqse columueeqs columueesq columueseq columuesqe columesque columesqeu columesuqe columesueq
columeseuq columesequ columeqsue columeqseu columequse columeques columeqeus columeqesu columeuqse columeuqes columeusqe
columeuseq columeuesq columeueqs columeequs columeeqsu columeeuqs columeeusq columeesuq columeesqu coluemsque coluemsqeu
coluemsuqe coluemsueq coluemseuq coluemsequ coluemqsue coluemqseu coluemquse coluemques coluemqeus coluemqesu coluemuqse
coluemuqes coluemusqe coluemuseq coluemuesq coluemueqs coluemequs coluemeqsu coluemeuqs coluemeusq coluemesuq coluemesqu
coluesmque coluesmqeu coluesmuqe coluesmueq coluesmeuq coluesmequ coluesqmue coluesqmeu coluesqume coluesquem coluesqeum
coluesqemu coluesuqme coluesuqem coluesumqe coluesumeq coluesuemq coluesueqm coluesequm colueseqmu colueseuqm colueseumq
coluesemuq coluesemqu colueqsmue colueqsmeu colueqsume colueqsuem colueqseum colueqsemu colueqmsue colueqmseu colueqmuse
colueqmues colueqmeus colueqmesu coluequmse coluequmes coluequsme coluequsem coluequesm coluequems colueqemus colueqemsu
colueqeums colueqeusm colueqesum colueqesmu colueusqme colueusqem colueusmqe colueusmeq colueusemq colueuseqm colueuqsme
colueuqsem colueuqmse colueuqmes colueuqems colueuqesm colueumqse colueumqes colueumsqe colueumseq colueumesq colueumeqs
colueueqms colueueqsm colueuemqs colueuemsq colueuesmq colueuesqm colueesqum colueesqmu colueesuqm colueesumq colueesmuq
colueesmqu colueeqsum colueeqsmu colueequsm colueequms colueeqmus colueeqmsu colueeuqsm colueeuqms colueeusqm colueeusmq
colueeumsq colueeumqs colueemqus colueemqsu colueemuqs colueemusq colueemsuq colueemsqu colusemque colusemqeu colusemuqe
colusemueq colusemeuq colusemequ coluseqmue coluseqmeu colusequme colusequem coluseqeum coluseqemu coluseuqme coluseuqem
coluseumqe coluseumeq coluseuemq coluseueqm coluseequm coluseeqmu coluseeuqm coluseeumq coluseemuq coluseemqu colusmeque
colusmeqeu colusmeuqe colusmeueq colusmeeuq colusmeequ colusmqeue colusmqeeu colusmquee colusmquee colusmqeue colusmqeeu
colusmuqee colusmuqee colusmueqe colusmueeq colusmueeq colusmueqe colusmeque colusmeqeu colusmeuqe colusmeueq colusmeeuq
colusmeequ colusqmeue colusqmeeu colusqmuee colusqmuee colusqmeue colusqmeeu colusqemue colusqemeu colusqeume colusqeuem
colusqeeum colusqeemu colusqueme colusqueem colusqumee colusqumee colusqueme colusqueem colusqeeum colusqeemu colusqeuem
colusqeume colusqemue colusqemeu colusumqee colusumqee colusumeqe colusumeeq colusumeeq colusumeqe colusuqmee colusuqmee
colusuqeme colusuqeem colusuqeem colusuqeme colusueqme colusueqem colusuemqe colusuemeq colusueemq colusueeqm colusueqem
colusueqme colusueeqm colusueemq colusuemeq colusuemqe colusemque colusemqeu colusemuqe colusemueq colusemeuq colusemequ
coluseqmue coluseqmeu colusequme colusequem coluseqeum coluseqemu coluseuqme coluseuqem coluseumqe coluseumeq coluseuemq
coluseueqm coluseequm coluseeqmu coluseeuqm coluseeumq coluseemuq coluseemqu coluqesmue coluqesmeu coluqesume coluqesuem
coluqeseum coluqesemu coluqemsue coluqemseu coluqemuse coluqemues coluqemeus coluqemesu coluqeumse coluqeumes coluqeusme
coluqeusem coluqeuesm coluqeuems coluqeemus coluqeemsu coluqeeums coluqeeusm coluqeesum coluqeesmu coluqsemue coluqsemeu
coluqseume coluqseuem coluqseeum coluqseemu coluqsmeue coluqsmeeu coluqsmuee coluqsmuee coluqsmeue coluqsmeeu coluqsumee
coluqsumee coluqsueme coluqsueem coluqsueem coluqsueme coluqsemue coluqsemeu coluqseume coluqseuem coluqseeum coluqseemu
coluqmseue coluqmseeu coluqmsuee coluqmsuee coluqmseue coluqmseeu coluqmesue coluqmeseu coluqmeuse coluqmeues coluqmeeus
coluqmeesu coluqmuese coluqmuees coluqmusee coluqmusee coluqmuese coluqmuees coluqmeeus coluqmeesu coluqmeues coluqmeuse
coluqmesue coluqmeseu coluqusmee coluqusmee coluquseme coluquseem coluquseem coluquseme coluqumsee coluqumsee coluqumese
coluqumees coluqumees coluqumese coluquemse coluquemes coluquesme coluquesem coluqueesm coluqueems coluquemes coluquemse
coluqueems coluqueesm coluquesem coluquesme coluqesmue coluqesmeu coluqesume coluqesuem coluqeseum coluqesemu coluqemsue
coluqemseu coluqemuse coluqemues coluqemeus coluqemesu coluqeumse coluqeumes coluqeusme coluqeusem coluqeuesm coluqeuems
coluqeemus coluqeemsu coluqeeums coluqeeusm coluqeesum coluqeesmu coluuesqme coluuesqem coluuesmqe coluuesmeq coluuesemq
coluueseqm coluueqsme coluueqsem coluueqmse coluueqmes coluueqems coluueqesm coluuemqse coluuemqes coluuemsqe coluuemseq
coluuemesq coluuemeqs coluueeqms coluueeqsm coluueemqs coluueemsq coluueesmq coluueesqm coluuseqme coluuseqem coluusemqe
coluusemeq coluuseemq coluuseeqm coluusqeme coluusqeem coluusqmee coluusqmee coluusqeme coluusqeem coluusmqee coluusmqee
coluusmeqe coluusmeeq coluusmeeq coluusmeqe coluuseqme coluuseqem coluusemqe coluusemeq coluuseemq coluuseeqm coluuqseme
coluuqseem coluuqsmee coluuqsmee coluuqseme coluuqseem coluuqesme coluuqesem coluuqemse coluuqemes coluuqeems coluuqeesm
coluuqmese coluuqmees coluuqmsee coluuqmsee coluuqmese coluuqmees coluuqeems coluuqeesm coluuqemes coluuqemse coluuqesme
coluuqesem coluumsqee coluumsqee coluumseqe coluumseeq coluumseeq coluumseqe coluumqsee coluumqsee coluumqese coluumqees
coluumqees coluumqese coluumeqse coluumeqes coluumesqe coluumeseq coluumeesq coluumeeqs coluumeqes coluumeqse coluumeeqs
coluumeesq coluumeseq coluumesqe coluuesqme coluuesqem coluuesmqe coluuesmeq coluuesemq coluueseqm coluueqsme coluueqsem
coluueqmse coluueqmes coluueqems coluueqesm coluuemqse coluuemqes coluuemsqe coluuemseq coluuemesq coluuemeqs coluueeqms
coluueeqsm coluueemqs coluueemsq coluueesmq coluueesqm colueesqum colueesqmu colueesuqm colueesumq colueesmuq colueesmqu
colueeqsum colueeqsmu colueequsm colueequms colueeqmus colueeqmsu colueeuqsm colueeuqms colueeusqm colueeusmq colueeumsq
colueeumqs colueemqus colueemqsu colueemuqs colueemusq colueemsuq colueemsqu coluesequm colueseqmu colueseuqm colueseumq
coluesemuq coluesemqu coluesqeum coluesqemu coluesquem coluesqume coluesqmue coluesqmeu coluesuqem coluesuqme coluesueqm
coluesuemq coluesumeq coluesumqe coluesmque coluesmqeu coluesmuqe coluesmueq coluesmeuq coluesmequ colueqseum colueqsemu
colueqsuem colueqsume colueqsmue colueqsmeu colueqesum colueqesmu colueqeusm colueqeums colueqemus colueqemsu coluequesm
coluequems coluequsem coluequsme coluequmse coluequmes colueqmeus colueqmesu colueqmues colueqmuse colueqmsue colueqmseu
colueusqem colueusqme colueuseqm colueusemq colueusmeq colueusmqe colueuqsem colueuqsme colueuqesm colueuqems colueuqmes
colueuqmse colueueqsm colueueqms colueuesqm colueuesmq colueuemsq colueuemqs colueumqes colueumqse colueumeqs colueumesq
colueumseq colueumsqe coluemsque coluemsqeu coluemsuqe coluemsueq coluemseuq coluemsequ coluemqsue coluemqseu coluemquse
coluemques coluemqeus coluemqesu coluemuqse coluemuqes coluemusqe coluemuseq coluemuesq coluemueqs coluemequs coluemeqsu
coluemeuqs coluemeusq coluemesuq coluemesqu colsmueque colsmueqeu colsmueuqe colsmueueq colsmueeuq colsmueequ colsmuqeue
colsmuqeeu colsmuquee colsmuquee colsmuqeue colsmuqeeu colsmuuqee colsmuuqee colsmuueqe colsmuueeq colsmuueeq colsmuueqe
colsmueque colsmueqeu colsmueuqe colsmueueq colsmueeuq colsmueequ colsmeuque colsmeuqeu colsmeuuqe colsmeuueq colsmeueuq
colsmeuequ colsmequue colsmequeu colsmequue colsmequeu colsmeqeuu colsmeqeuu colsmeuque colsmeuqeu colsmeuuqe colsmeuueq
colsmeueuq colsmeuequ colsmeequu colsmeequu colsmeeuqu colsmeeuuq colsmeeuuq colsmeeuqu colsmqeuue colsmqeueu colsmqeuue
colsmqeueu colsmqeeuu colsmqeeuu colsmqueue colsmqueeu colsmquuee colsmquuee colsmqueue colsmqueeu colsmquuee colsmquuee
colsmqueue colsmqueeu colsmqueeu colsmqueue colsmqeuue colsmqeueu colsmqeuue colsmqeueu colsmqeeuu colsmqeeuu colsmueque
colsmueqeu colsmueuqe colsmueueq colsmueeuq colsmueequ colsmuqeue colsmuqeeu colsmuquee colsmuquee colsmuqeue colsmuqeeu
colsmuuqee colsmuuqee colsmuueqe colsmuueeq colsmuueeq colsmuueqe colsmueque colsmueqeu colsmueuqe colsmueueq colsmueeuq
colsmueequ colsmeequu colsmeequu colsmeeuqu colsmeeuuq colsmeeuuq colsmeeuqu colsmeqeuu colsmeqeuu colsmequeu colsmequue
colsmequue colsmequeu colsmeuqeu colsmeuque colsmeuequ colsmeueuq colsmeuueq colsmeuuqe colsmeuque colsmeuqeu colsmeuuqe
colsmeuueq colsmeueuq colsmeuequ colsumeque colsumeqeu colsumeuqe colsumeueq colsumeeuq colsumeequ colsumqeue colsumqeeu
colsumquee colsumquee colsumqeue colsumqeeu colsumuqee colsumuqee colsumueqe colsumueeq colsumueeq colsumueqe colsumeque
colsumeqeu colsumeuqe colsumeueq colsumeeuq colsumeequ colsuemque colsuemqeu colsuemuqe colsuemueq colsuemeuq colsuemequ
colsueqmue colsueqmeu colsuequme colsuequem colsueqeum colsueqemu colsueuqme colsueuqem colsueumqe colsueumeq colsueuemq
colsueueqm colsueequm colsueeqmu colsueeuqm colsueeumq colsueemuq colsueemqu colsuqemue colsuqemeu colsuqeume colsuqeuem
colsuqeeum colsuqeemu colsuqmeue colsuqmeeu colsuqmuee colsuqmuee colsuqmeue colsuqmeeu colsuqumee colsuqumee colsuqueme
colsuqueem colsuqueem colsuqueme colsuqemue colsuqemeu colsuqeume colsuqeuem colsuqeeum colsuqeemu colsuueqme colsuueqem
colsuuemqe colsuuemeq colsuueemq colsuueeqm colsuuqeme colsuuqeem colsuuqmee colsuuqmee colsuuqeme colsuuqeem colsuumqee
colsuumqee colsuumeqe colsuumeeq colsuumeeq colsuumeqe colsuueqme colsuueqem colsuuemqe colsuuemeq colsuueemq colsuueeqm
colsueequm colsueeqmu colsueeuqm colsueeumq colsueemuq colsueemqu colsueqeum colsueqemu colsuequem colsuequme colsueqmue
colsueqmeu colsueuqem colsueuqme colsueueqm colsueuemq colsueumeq colsueumqe colsuemque colsuemqeu colsuemuqe colsuemueq
colsuemeuq colsuemequ colseumque colseumqeu colseumuqe colseumueq colseumeuq colseumequ colseuqmue colseuqmeu colseuqume
colseuquem colseuqeum colseuqemu colseuuqme colseuuqem colseuumqe colseuumeq colseuuemq colseuueqm colseuequm colseueqmu
colseueuqm colseueumq colseuemuq colseuemqu colsemuque colsemuqeu colsemuuqe colsemuueq colsemueuq colsemuequ colsemquue
colsemqueu colsemquue colsemqueu colsemqeuu colsemqeuu colsemuque colsemuqeu colsemuuqe colsemuueq colsemueuq colsemuequ
colsemequu colsemequu colsemeuqu colsemeuuq colsemeuuq colsemeuqu colseqmuue colseqmueu colseqmuue colseqmueu colseqmeuu
colseqmeuu colsequmue colsequmeu colsequume colsequuem colsequeum colsequemu colsequume colsequuem colsequmue colsequmeu
colsequemu colsequeum colseqeuum colseqeumu colseqeuum colseqeumu colseqemuu colseqemuu colseumque colseumqeu colseumuqe
colseumueq colseumeuq colseumequ colseuqmue colseuqmeu colseuqume colseuquem colseuqeum colseuqemu colseuuqme colseuuqem
colseuumqe colseuumeq colseuuemq colseuueqm colseuequm colseueqmu colseueuqm colseueumq colseuemuq colseuemqu colseemquu
colseemquu colseemuqu colseemuuq colseemuuq colseemuqu colseeqmuu colseeqmuu colseequmu colseequum colseequum colseequmu
colseeuqmu colseeuqum colseeumqu colseeumuq colseeuumq colseeuuqm colseeuqum colseeuqmu colseeuuqm colseeuumq colseeumuq
colseeumqu colsquemue colsquemeu colsqueume colsqueuem colsqueeum colsqueemu colsqumeue colsqumeeu colsqumuee colsqumuee
colsqumeue colsqumeeu colsquumee colsquumee colsquueme colsquueem colsquueem colsquueme colsquemue colsquemeu colsqueume
colsqueuem colsqueeum colsqueemu colsqeumue colsqeumeu colsqeuume colsqeuuem colsqeueum colsqeuemu colsqemuue colsqemueu
colsqemuue colsqemueu colsqemeuu colsqemeuu colsqeumue colsqeumeu colsqeuume colsqeuuem colsqeueum colsqeuemu colsqeemuu
colsqeemuu colsqeeumu colsqeeuum colsqeeuum colsqeeumu colsqmeuue colsqmeueu colsqmeuue colsqmeueu colsqmeeuu colsqmeeuu
colsqmueue colsqmueeu colsqmuuee colsqmuuee colsqmueue colsqmueeu colsqmuuee colsqmuuee colsqmueue colsqmueeu colsqmueeu
colsqmueue colsqmeuue colsqmeueu colsqmeuue colsqmeueu colsqmeeuu colsqmeeuu colsquemue colsquemeu colsqueume colsqueuem
colsqueeum colsqueemu colsqumeue colsqumeeu colsqumuee colsqumuee colsqumeue colsqumeeu colsquumee colsquumee colsquueme
colsquueem colsquueem colsquueme colsquemue colsquemeu colsqueume colsqueuem colsqueeum colsqueemu colsqeemuu colsqeemuu
colsqeeumu colsqeeuum colsqeeuum colsqeeumu colsqemeuu colsqemeuu colsqemueu colsqemuue colsqemuue colsqemueu colsqeumeu
colsqeumue colsqeuemu colsqeueum colsqeuuem colsqeuume colsqeumue colsqeumeu colsqeuume colsqeuuem colsqeueum colsqeuemu
colsuueqme colsuueqem colsuuemqe colsuuemeq colsuueemq colsuueeqm colsuuqeme colsuuqeem colsuuqmee colsuuqmee colsuuqeme
colsuuqeem colsuumqee colsuumqee colsuumeqe colsuumeeq colsuumeeq colsuumeqe colsuueqme colsuueqem colsuuemqe colsuuemeq
colsuueemq colsuueeqm colsueuqme colsueuqem colsueumqe colsueumeq colsueuemq colsueueqm colsuequme colsuequem colsueqmue
colsueqmeu colsueqemu colsueqeum colsuemque colsuemqeu colsuemuqe colsuemueq colsuemeuq colsuemequ colsueeqmu colsueequm
colsueemqu colsueemuq colsueeumq colsueeuqm colsuqeume colsuqeuem colsuqemue colsuqemeu colsuqeemu colsuqeeum colsuqueme
colsuqueem colsuqumee colsuqumee colsuqueme colsuqueem colsuqmuee colsuqmuee colsuqmeue colsuqmeeu colsuqmeeu colsuqmeue
colsuqeume colsuqeuem colsuqemue colsuqemeu colsuqeemu colsuqeeum colsumeque colsumeqeu colsumeuqe colsumeueq colsumeeuq
colsumeequ colsumqeue colsumqeeu colsumquee colsumquee colsumqeue colsumqeeu colsumuqee colsumuqee colsumueqe colsumueeq
colsumueeq colsumueqe colsumeque colsumeqeu colsumeuqe colsumeueq colsumeeuq colsumeequ colsueeqmu colsueequm colsueemqu
colsueemuq colsueeumq colsueeuqm colsueqemu colsueqeum colsueqmeu colsueqmue colsuequme colsuequem colsuemqeu colsuemque
colsuemequ colsuemeuq colsuemueq colsuemuqe colsueuqme colsueuqem colsueumqe colsueumeq colsueuemq colsueueqm colseuequm
colseueqmu colseueuqm colseueumq colseuemuq colseuemqu colseuqeum colseuqemu colseuquem colseuqume colseuqmue colseuqmeu
colseuuqem colseuuqme colseuueqm colseuuemq colseuumeq colseuumqe colseumque colseumqeu colseumuqe colseumueq colseumeuq
colseumequ colseeuqum colseeuqmu colseeuuqm colseeuumq colseeumuq colseeumqu colseequum colseequmu colseequum colseequmu
colseeqmuu colseeqmuu colseeuqum colseeuqmu colseeuuqm colseeuumq colseeumuq colseeumqu colseemquu colseemquu colseemuqu
colseemuuq colseemuuq colseemuqu colseqeuum colseqeumu colseqeuum colseqeumu colseqemuu colseqemuu colsequeum colsequemu
colsequuem colsequume colsequmue colsequmeu colsequuem colsequume colsequeum colsequemu colsequmeu colsequmue colseqmuue
colseqmueu colseqmuue colseqmueu colseqmeuu colseqmeuu colseuequm colseueqmu colseueuqm colseueumq colseuemuq colseuemqu
colseuqeum colseuqemu colseuquem colseuqume colseuqmue colseuqmeu colseuuqem colseuuqme colseuueqm colseuuemq colseuumeq
colseuumqe colseumque colseumqeu colseumuqe colseumueq colseumeuq colseumequ colsemequu colsemequu colsemeuqu colsemeuuq
colsemeuuq colsemeuqu colsemqeuu colsemqeuu colsemqueu colsemquue colsemquue colsemqueu colsemuqeu colsemuque colsemuequ
colsemueuq colsemuueq colsemuuqe colsemuque colsemuqeu colsemuuqe colsemuueq colsemueuq colsemuequ colqmuseue colqmuseeu
colqmusuee colqmusuee colqmuseue colqmuseeu colqmuesue colqmueseu colqmueuse colqmueues colqmueeus colqmueesu colqmuuese
colqmuuees colqmuusee colqmuusee colqmuuese colqmuuees colqmueeus colqmueesu colqmueues colqmueuse colqmuesue colqmueseu
colqmsueue colqmsueeu colqmsuuee colqmsuuee colqmsueue colqmsueeu colqmseuue colqmseueu colqmseuue colqmseueu colqmseeuu
colqmseeuu colqmsueue colqmsueeu colqmsuuee colqmsuuee colqmsueue colqmsueeu colqmseeuu colqmseeuu colqmseueu colqmseuue
colqmseuue colqmseueu colqmesuue colqmesueu colqmesuue colqmesueu colqmeseuu colqmeseuu colqmeusue colqmeuseu colqmeuuse
colqmeuues colqmeueus colqmeuesu colqmeuuse colqmeuues colqmeusue colqmeuseu colqmeuesu colqmeueus colqmeeuus colqmeeusu
colqmeeuus colqmeeusu colqmeesuu colqmeesuu colqmuseue colqmuseeu colqmusuee colqmusuee colqmuseue colqmuseeu colqmuesue
colqmueseu colqmueuse colqmueues colqmueeus colqmueesu colqmuuese colqmuuees colqmuusee colqmuusee colqmuuese colqmuuees
colqmueeus colqmueesu colqmueues colqmueuse colqmuesue colqmueseu colqmeseuu colqmeseuu colqmesueu colqmesuue colqmesuue
colqmesueu colqmeesuu colqmeesuu colqmeeusu colqmeeuus colqmeeuus colqmeeusu colqmeuesu colqmeueus colqmeuseu colqmeusue
colqmeuuse colqmeuues colqmeueus colqmeuesu colqmeuues colqmeuuse colqmeusue colqmeuseu colqumseue colqumseeu colqumsuee
colqumsuee colqumseue colqumseeu colqumesue colqumeseu colqumeuse colqumeues colqumeeus colqumeesu colqumuese colqumuees
colqumusee colqumusee colqumuese colqumuees colqumeeus colqumeesu colqumeues colqumeuse colqumesue colqumeseu colqusmeue
colqusmeeu colqusmuee colqusmuee colqusmeue colqusmeeu colqusemue colqusemeu colquseume colquseuem colquseeum colquseemu
colqusueme colqusueem colqusumee colqusumee colqusueme colqusueem colquseeum colquseemu colquseuem colquseume colqusemue
colqusemeu colquesmue colquesmeu colquesume colquesuem colqueseum colquesemu colquemsue colquemseu colquemuse colquemues
colquemeus colquemesu colqueumse colqueumes colqueusme colqueusem colqueuesm colqueuems colqueemus colqueemsu colqueeums
colqueeusm colqueesum colqueesmu colquuseme colquuseem colquusmee colquusmee colquuseme colquuseem colquuesme colquuesem
colquuemse colquuemes colquueems colquueesm colquumese colquumees colquumsee colquumsee colquumese colquumees colquueems
colquueesm colquuemes colquuemse colquuesme colquuesem colqueseum colquesemu colquesuem colquesume colquesmue colquesmeu
colqueesum colqueesmu colqueeusm colqueeums colqueemus colqueemsu colqueuesm colqueuems colqueusem colqueusme colqueumse
colqueumes colquemeus colquemesu colquemues colquemuse colquemsue colquemseu colqsumeue colqsumeeu colqsumuee colqsumuee
colqsumeue colqsumeeu colqsuemue colqsuemeu colqsueume colqsueuem colqsueeum colqsueemu colqsuueme colqsuueem colqsuumee
colqsuumee colqsuueme colqsuueem colqsueeum colqsueemu colqsueuem colqsueume colqsuemue colqsuemeu colqsmueue colqsmueeu
colqsmuuee colqsmuuee colqsmueue colqsmueeu colqsmeuue colqsmeueu colqsmeuue colqsmeueu colqsmeeuu colqsmeeuu colqsmueue
colqsmueeu colqsmuuee colqsmuuee colqsmueue colqsmueeu colqsmeeuu colqsmeeuu colqsmeueu colqsmeuue colqsmeuue colqsmeueu
colqsemuue colqsemueu colqsemuue colqsemueu colqsemeuu colqsemeuu colqseumue colqseumeu colqseuume colqseuuem colqseueum
colqseuemu colqseuume colqseuuem colqseumue colqseumeu colqseuemu colqseueum colqseeuum colqseeumu colqseeuum colqseeumu
colqseemuu colqseemuu colqsumeue colqsumeeu colqsumuee colqsumuee colqsumeue colqsumeeu colqsuemue colqsuemeu colqsueume
colqsueuem colqsueeum colqsueemu colqsuueme colqsuueem colqsuumee colqsuumee colqsuueme colqsuueem colqsueeum colqsueemu
colqsueuem colqsueume colqsuemue colqsuemeu colqsemeuu colqsemeuu colqsemueu colqsemuue colqsemuue colqsemueu colqseemuu
colqseemuu colqseeumu colqseeuum colqseeuum colqseeumu colqseuemu colqseueum colqseumeu colqseumue colqseuume colqseuuem
colqseueum colqseuemu colqseuuem colqseuume colqseumue colqseumeu colqeusmue colqeusmeu colqeusume colqeusuem colqeuseum
colqeusemu colqeumsue colqeumseu colqeumuse colqeumues colqeumeus colqeumesu colqeuumse colqeuumes colqeuusme colqeuusem
colqeuuesm colqeuuems colqeuemus colqeuemsu colqeueums colqeueusm colqeuesum colqeuesmu colqesumue colqesumeu colqesuume
colqesuuem colqesueum colqesuemu colqesmuue colqesmueu colqesmuue colqesmueu colqesmeuu colqesmeuu colqesumue colqesumeu
colqesuume colqesuuem colqesueum colqesuemu colqesemuu colqesemuu colqeseumu colqeseuum colqeseuum colqeseumu colqemsuue
colqemsueu colqemsuue colqemsueu colqemseuu colqemseuu colqemusue colqemuseu colqemuuse colqemuues colqemueus colqemuesu
colqemuuse colqemuues colqemusue colqemuseu colqemuesu colqemueus colqemeuus colqemeusu colqemeuus colqemeusu colqemesuu
colqemesuu colqeusmue colqeusmeu colqeusume colqeusuem colqeuseum colqeusemu colqeumsue colqeumseu colqeumuse colqeumues
colqeumeus colqeumesu colqeuumse colqeuumes colqeuusme colqeuusem colqeuuesm colqeuuems colqeuemus colqeuemsu colqeueums
colqeueusm colqeuesum colqeuesmu colqeesmuu colqeesmuu colqeesumu colqeesuum colqeesuum colqeesumu colqeemsuu colqeemsuu
colqeemusu colqeemuus colqeemuus colqeemusu colqeeumsu colqeeumus colqeeusmu colqeeusum colqeeuusm colqeeuums colqeeumus
colqeeumsu colqeeuums colqeeuusm colqeeusum colqeeusmu colquuseme colquuseem colquusmee colquusmee colquuseme colquuseem
colquuesme colquuesem colquuemse colquuemes colquueems colquueesm colquumese colquumees colquumsee colquumsee colquumese
colquumees colquueems colquueesm colquuemes colquuemse colquuesme colquuesem colqusueme colqusueem colqusumee colqusumee
colqusueme colqusueem colquseume colquseuem colqusemue colqusemeu colquseemu colquseeum colqusmeue colqusmeeu colqusmuee
colqusmuee colqusmeue colqusmeeu colquseemu colquseeum colqusemeu colqusemue colquseume colquseuem colquesume colquesuem
colquesmue colquesmeu colquesemu colqueseum colqueusme colqueusem colqueumse colqueumes colqueuems colqueuesm colquemuse
colquemues colquemsue colquemseu colquemesu colquemeus colqueeums colqueeusm colqueemus colqueemsu colqueesmu colqueesum
colqumseue colqumseeu colqumsuee colqumsuee colqumseue colqumseeu colqumesue colqumeseu colqumeuse colqumeues colqumeeus
colqumeesu colqumuese colqumuees colqumusee colqumusee colqumuese colqumuees colqumeeus colqumeesu colqumeues colqumeuse
colqumesue colqumeseu colquesemu colqueseum colquesmeu colquesmue colquesume colquesuem colqueesmu colqueesum colqueemsu
colqueemus colqueeums colqueeusm colquemesu colquemeus colquemseu colquemsue colquemuse colquemues colqueuems colqueuesm
colqueumes colqueumse colqueusme colqueusem colqeuseum colqeusemu colqeusuem colqeusume colqeusmue colqeusmeu colqeuesum
colqeuesmu colqeueusm colqeueums colqeuemus colqeuemsu colqeuuesm colqeuuems colqeuusem colqeuusme colqeuumse colqeuumes
colqeumeus colqeumesu colqeumues colqeumuse colqeumsue colqeumseu colqesueum colqesuemu colqesuuem colqesuume colqesumue
colqesumeu colqeseuum colqeseumu colqeseuum colqeseumu colqesemuu colqesemuu colqesueum colqesuemu colqesuuem colqesuume
colqesumue colqesumeu colqesmeuu colqesmeuu colqesmueu colqesmuue colqesmuue colqesmueu colqeesuum colqeesumu colqeesuum
colqeesumu colqeesmuu colqeesmuu colqeeusum colqeeusmu colqeeuusm colqeeuums colqeeumus colqeeumsu colqeeuusm colqeeuums
colqeeusum colqeeusmu colqeeumsu colqeeumus colqeemuus colqeemusu colqeemuus colqeemusu colqeemsuu colqeemsuu colqeuseum
colqeusemu colqeusuem colqeusume colqeusmue colqeusmeu colqeuesum colqeuesmu colqeueusm colqeueums colqeuemus colqeuemsu
colqeuuesm colqeuuems colqeuusem colqeuusme colqeuumse colqeuumes colqeumeus colqeumesu colqeumues colqeumuse colqeumsue
colqeumseu colqemseuu colqemseuu colqemsueu colqemsuue colqemsuue colqemsueu colqemesuu colqemesuu colqemeusu colqemeuus
colqemeuus colqemeusu colqemuesu colqemueus colqemuseu colqemusue colqemuuse colqemuues colqemueus colqemuesu colqemuues
colqemuuse colqemusue colqemuseu columusqee columusqee columuseqe columuseeq columuseeq columuseqe columuqsee columuqsee
columuqese columuqees columuqees columuqese columueqse columueqes columuesqe columueseq columueesq columueeqs columueqes
columueqse columueeqs columueesq columueseq columuesqe columsuqee columsuqee columsueqe columsueeq columsueeq columsueqe
columsquee columsquee columsqeue columsqeeu columsqeeu columsqeue columseque columseqeu columseuqe columseueq columseeuq
columseequ columseqeu columseque columseequ columseeuq columseueq columseuqe columqsuee columqsuee columqseue columqseeu
columqseeu columqseue columqusee columqusee columquese columquees columquees columquese columqeuse columqeues columqesue
columqeseu columqeesu columqeeus columqeues columqeuse columqeeus columqeesu columqeseu columqesue columesque columesqeu
columesuqe columesueq columeseuq columesequ columeqsue columeqseu columequse columeques columeqeus columeqesu columeuqse
columeuqes columeusqe columeuseq columeuesq columeueqs columeequs columeeqsu columeeuqs columeeusq columeesuq columeesqu
columesqeu columesque columesequ columeseuq columesueq columesuqe columeqseu columeqsue columeqesu columeqeus columeques
columequse columeeqsu columeequs columeesqu columeesuq columeeusq columeeuqs columeuqes columeuqse columeueqs columeuesq
columeuseq columeusqe coluumsqee coluumsqee coluumseqe coluumseeq coluumseeq coluumseqe coluumqsee coluumqsee coluumqese
coluumqees coluumqees coluumqese coluumeqse coluumeqes coluumesqe coluumeseq coluumeesq coluumeeqs coluumeqes coluumeqse
coluumeeqs coluumeesq coluumeseq coluumesqe coluusmqee coluusmqee coluusmeqe coluusmeeq coluusmeeq coluusmeqe coluusqmee
coluusqmee coluusqeme coluusqeem coluusqeem coluusqeme coluuseqme coluuseqem coluusemqe coluusemeq coluuseemq coluuseeqm
coluuseqem coluuseqme coluuseeqm coluuseemq coluusemeq coluusemqe coluuqsmee coluuqsmee coluuqseme coluuqseem coluuqseem
coluuqseme coluuqmsee coluuqmsee coluuqmese coluuqmees coluuqmees coluuqmese coluuqemse coluuqemes coluuqesme coluuqesem
coluuqeesm coluuqeems coluuqemes coluuqemse coluuqeems coluuqeesm coluuqesem coluuqesme coluuesqme coluuesqem coluuesmqe
coluuesmeq coluuesemq coluueseqm coluueqsme coluueqsem coluueqmse coluueqmes coluueqems coluueqesm coluuemqse coluuemqes
coluuemsqe coluuemseq coluuemesq coluuemeqs coluueeqms coluueeqsm coluueemqs coluueemsq coluueesmq coluueesqm coluuesqem
coluuesqme coluueseqm coluuesemq coluuesmeq coluuesmqe coluueqsem coluueqsme coluueqesm coluueqems coluueqmes coluueqmse
coluueeqsm coluueeqms coluueesqm coluueesmq coluueemsq coluueemqs coluuemqes coluuemqse coluuemeqs coluuemesq coluuemseq
coluuemsqe colusumqee colusumqee colusumeqe colusumeeq colusumeeq colusumeqe colusuqmee colusuqmee colusuqeme colusuqeem
colusuqeem colusuqeme colusueqme colusueqem colusuemqe colusuemeq colusueemq colusueeqm colusueqem colusueqme colusueeqm
colusueemq colusuemeq colusuemqe colusmuqee colusmuqee colusmueqe colusmueeq colusmueeq colusmueqe colusmquee colusmquee
colusmqeue colusmqeeu colusmqeeu colusmqeue colusmeque colusmeqeu colusmeuqe colusmeueq colusmeeuq colusmeequ colusmeqeu
colusmeque colusmeequ colusmeeuq colusmeueq colusmeuqe colusqmuee colusqmuee colusqmeue colusqmeeu colusqmeeu colusqmeue
colusqumee colusqumee colusqueme colusqueem colusqueem colusqueme colusqeume colusqeuem colusqemue colusqemeu colusqeemu
colusqeeum colusqeuem colusqeume colusqeeum colusqeemu colusqemeu colusqemue colusemque colusemqeu colusemuqe colusemueq
colusemeuq colusemequ coluseqmue coluseqmeu colusequme colusequem coluseqeum coluseqemu coluseuqme coluseuqem coluseumqe
coluseumeq coluseuemq coluseueqm coluseequm coluseeqmu coluseeuqm coluseeumq coluseemuq coluseemqu colusemqeu colusemque
colusemequ colusemeuq colusemueq colusemuqe coluseqmeu coluseqmue coluseqemu coluseqeum colusequem colusequme coluseeqmu
coluseequm coluseemqu coluseemuq coluseeumq coluseeuqm coluseuqem coluseuqme coluseueqm coluseuemq coluseumeq coluseumqe
coluqusmee coluqusmee coluquseme coluquseem coluquseem coluquseme coluqumsee coluqumsee coluqumese coluqumees coluqumees
coluqumese coluquemse coluquemes coluquesme coluquesem coluqueesm coluqueems coluquemes coluquemse coluqueems coluqueesm
coluquesem coluquesme coluqsumee coluqsumee coluqsueme coluqsueem coluqsueem coluqsueme coluqsmuee coluqsmuee coluqsmeue
coluqsmeeu coluqsmeeu coluqsmeue coluqsemue coluqsemeu coluqseume coluqseuem coluqseeum coluqseemu coluqsemeu coluqsemue
coluqseemu coluqseeum coluqseuem coluqseume coluqmsuee coluqmsuee coluqmseue coluqmseeu coluqmseeu coluqmseue coluqmusee
coluqmusee coluqmuese coluqmuees coluqmuees coluqmuese coluqmeuse coluqmeues coluqmesue coluqmeseu coluqmeesu coluqmeeus
coluqmeues coluqmeuse coluqmeeus coluqmeesu coluqmeseu coluqmesue coluqesmue coluqesmeu coluqesume coluqesuem coluqeseum
coluqesemu coluqemsue coluqemseu coluqemuse coluqemues coluqemeus coluqemesu coluqeumse coluqeumes coluqeusme coluqeusem
coluqeuesm coluqeuems coluqeemus coluqeemsu coluqeeums coluqeeusm coluqeesum coluqeesmu coluqesmeu coluqesmue coluqesemu
coluqeseum coluqesuem coluqesume coluqemseu coluqemsue coluqemesu coluqemeus coluqemues coluqemuse coluqeemsu coluqeemus
coluqeesmu coluqeesum coluqeeusm coluqeeums coluqeumes coluqeumse coluqeuems coluqeuesm coluqeusem coluqeusme colueusqme
colueusqem colueusmqe colueusmeq colueusemq colueuseqm colueuqsme colueuqsem colueuqmse colueuqmes colueuqems colueuqesm
colueumqse colueumqes colueumsqe colueumseq colueumesq colueumeqs colueueqms colueueqsm colueuemqs colueuemsq colueuesmq
colueuesqm coluesuqme coluesuqem coluesumqe coluesumeq coluesuemq coluesueqm coluesqume coluesquem coluesqmue coluesqmeu
coluesqemu coluesqeum coluesmque coluesmqeu coluesmuqe coluesmueq coluesmeuq coluesmequ colueseqmu coluesequm coluesemqu
coluesemuq colueseumq colueseuqm colueqsume colueqsuem colueqsmue colueqsmeu colueqsemu colueqseum coluequsme coluequsem
coluequmse coluequmes coluequems coluequesm colueqmuse colueqmues colueqmsue colueqmseu colueqmesu colueqmeus colueqeums
colueqeusm colueqemus colueqemsu colueqesmu colueqesum coluemsque coluemsqeu coluemsuqe coluemsueq coluemseuq coluemsequ
coluemqsue coluemqseu coluemquse coluemques coluemqeus coluemqesu coluemuqse coluemuqes coluemusqe coluemuseq coluemuesq
coluemueqs coluemequs coluemeqsu coluemeuqs coluemeusq coluemesuq coluemesqu colueesqmu colueesqum colueesmqu colueesmuq
colueesumq colueesuqm colueeqsmu colueeqsum colueeqmsu colueeqmus colueequms colueequsm colueemqsu colueemqus colueemsqu
colueemsuq colueemusq colueemuqs colueeuqms colueeuqsm colueeumqs colueeumsq colueeusmq colueeusqm colueusqem colueusqme
colueuseqm colueusemq colueusmeq colueusmqe colueuqsem colueuqsme colueuqesm colueuqems colueuqmes colueuqmse colueueqsm
colueueqms colueuesqm colueuesmq colueuemsq colueuemqs colueumqes colueumqse colueumeqs colueumesq colueumseq colueumsqe
coluesuqem coluesuqme coluesueqm coluesuemq coluesumeq coluesumqe coluesquem coluesqume coluesqeum coluesqemu coluesqmeu
coluesqmue coluesequm colueseqmu colueseuqm colueseumq coluesemuq coluesemqu coluesmqeu coluesmque coluesmequ coluesmeuq
coluesmueq coluesmuqe colueqsuem colueqsume colueqseum colueqsemu colueqsmeu colueqsmue coluequsem coluequsme coluequesm
coluequems coluequmes coluequmse colueqeusm colueqeums colueqesum colueqesmu colueqemsu colueqemus colueqmues colueqmuse
colueqmeus colueqmesu colueqmseu colueqmsue colueesqum colueesqmu colueesuqm colueesumq colueesmuq colueesmqu colueeqsum
colueeqsmu colueequsm colueequms colueeqmus colueeqmsu colueeuqsm colueeuqms colueeusqm colueeusmq colueeumsq colueeumqs
colueemqus colueemqsu colueemuqs colueemusq colueemsuq colueemsqu coluemsqeu coluemsque coluemsequ coluemseuq coluemsueq
coluemsuqe coluemqseu coluemqsue coluemqesu coluemqeus coluemques coluemquse coluemeqsu coluemequs coluemesqu coluemesuq
coluemeusq coluemeuqs coluemuqes coluemuqse coluemueqs coluemuesq coluemuseq coluemusqe colemusque colemusqeu colemusuqe
colemusueq colemuseuq colemusequ colemuqsue colemuqseu colemuquse colemuques colemuqeus colemuqesu colemuuqse colemuuqes
colemuusqe colemuuseq colemuuesq colemuueqs colemuequs colemueqsu colemueuqs colemueusq colemuesuq colemuesqu colemsuque
colemsuqeu colemsuuqe colemsuueq colemsueuq colemsuequ colemsquue colemsqueu colemsquue colemsqueu colemsqeuu colemsqeuu
colemsuque colemsuqeu colemsuuqe colemsuueq colemsueuq colemsuequ colemsequu colemsequu colemseuqu colemseuuq colemseuuq
colemseuqu colemqsuue colemqsueu colemqsuue colemqsueu colemqseuu colemqseuu colemqusue colemquseu colemquuse colemquues
colemqueus colemquesu colemquuse colemquues colemqusue colemquseu colemquesu colemqueus colemqeuus colemqeusu colemqeuus
colemqeusu colemqesuu colemqesuu colemusque colemusqeu colemusuqe colemusueq colemuseuq colemusequ colemuqsue colemuqseu
colemuquse colemuques colemuqeus colemuqesu colemuuqse colemuuqes colemuusqe colemuuseq colemuuesq colemuueqs colemuequs
colemueqsu colemueuqs colemueusq colemuesuq colemuesqu colemesquu colemesquu colemesuqu colemesuuq colemesuuq colemesuqu
colemeqsuu colemeqsuu colemequsu colemequus colemequus colemequsu colemeuqsu colemeuqus colemeusqu colemeusuq colemeuusq
colemeuuqs colemeuqus colemeuqsu colemeuuqs colemeuusq colemeusuq colemeusqu coleumsque coleumsqeu coleumsuqe coleumsueq
coleumseuq coleumsequ coleumqsue coleumqseu coleumquse coleumques coleumqeus coleumqesu coleumuqse coleumuqes coleumusqe
coleumuseq coleumuesq coleumueqs coleumequs coleumeqsu coleumeuqs coleumeusq coleumesuq coleumesqu coleusmque coleusmqeu
coleusmuqe coleusmueq coleusmeuq coleusmequ coleusqmue coleusqmeu coleusqume coleusquem coleusqeum coleusqemu coleusuqme
coleusuqem coleusumqe coleusumeq coleusuemq coleusueqm coleusequm coleuseqmu coleuseuqm coleuseumq coleusemuq coleusemqu
coleuqsmue coleuqsmeu coleuqsume coleuqsuem coleuqseum coleuqsemu coleuqmsue coleuqmseu coleuqmuse coleuqmues coleuqmeus
coleuqmesu coleuqumse coleuqumes coleuqusme coleuqusem coleuquesm coleuquems coleuqemus coleuqemsu coleuqeums coleuqeusm
coleuqesum coleuqesmu coleuusqme coleuusqem coleuusmqe coleuusmeq coleuusemq coleuuseqm coleuuqsme coleuuqsem coleuuqmse
coleuuqmes coleuuqems coleuuqesm coleuumqse coleuumqes coleuumsqe coleuumseq coleuumesq coleuumeqs coleuueqms coleuueqsm
coleuuemqs coleuuemsq coleuuesmq coleuuesqm coleuesqum coleuesqmu coleuesuqm coleuesumq coleuesmuq coleuesmqu coleueqsum
coleueqsmu coleuequsm coleuequms coleueqmus coleueqmsu coleueuqsm coleueuqms coleueusqm coleueusmq coleueumsq coleueumqs
coleuemqus coleuemqsu coleuemuqs coleuemusq coleuemsuq coleuemsqu colesumque colesumqeu colesumuqe colesumueq colesumeuq
colesumequ colesuqmue colesuqmeu colesuqume colesuquem colesuqeum colesuqemu colesuuqme colesuuqem colesuumqe colesuumeq
colesuuemq colesuueqm colesuequm colesueqmu colesueuqm colesueumq colesuemuq colesuemqu colesmuque colesmuqeu colesmuuqe
colesmuueq colesmueuq colesmuequ colesmquue colesmqueu colesmquue colesmqueu colesmqeuu colesmqeuu colesmuque colesmuqeu
colesmuuqe colesmuueq colesmueuq colesmuequ colesmequu colesmequu colesmeuqu colesmeuuq colesmeuuq colesmeuqu colesqmuue
colesqmueu colesqmuue colesqmueu colesqmeuu colesqmeuu colesqumue colesqumeu colesquume colesquuem colesqueum colesquemu
colesquume colesquuem colesqumue colesqumeu colesquemu colesqueum colesqeuum colesqeumu colesqeuum colesqeumu colesqemuu
colesqemuu colesumque colesumqeu colesumuqe colesumueq colesumeuq colesumequ colesuqmue colesuqmeu colesuqume colesuquem
colesuqeum colesuqemu colesuuqme colesuuqem colesuumqe colesuumeq colesuuemq colesuueqm colesuequm colesueqmu colesueuqm
colesueumq colesuemuq colesuemqu colesemquu colesemquu colesemuqu colesemuuq colesemuuq colesemuqu coleseqmuu coleseqmuu
colesequmu colesequum colesequum colesequmu coleseuqmu coleseuqum coleseumqu coleseumuq coleseuumq coleseuuqm coleseuqum
coleseuqmu coleseuuqm coleseuumq coleseumuq coleseumqu colequsmue colequsmeu colequsume colequsuem colequseum colequsemu
colequmsue colequmseu colequmuse colequmues colequmeus colequmesu colequumse colequumes colequusme colequusem colequuesm
colequuems colequemus colequemsu colequeums colequeusm colequesum colequesmu coleqsumue coleqsumeu coleqsuume coleqsuuem
coleqsueum coleqsuemu coleqsmuue coleqsmueu coleqsmuue coleqsmueu coleqsmeuu coleqsmeuu coleqsumue coleqsumeu coleqsuume
coleqsuuem coleqsueum coleqsuemu coleqsemuu coleqsemuu coleqseumu coleqseuum coleqseuum coleqseumu coleqmsuue coleqmsueu
coleqmsuue coleqmsueu coleqmseuu coleqmseuu coleqmusue coleqmuseu coleqmuuse coleqmuues coleqmueus coleqmuesu coleqmuuse
coleqmuues coleqmusue coleqmuseu coleqmuesu coleqmueus coleqmeuus coleqmeusu coleqmeuus coleqmeusu coleqmesuu coleqmesuu
colequsmue colequsmeu colequsume colequsuem colequseum colequsemu colequmsue colequmseu colequmuse colequmues colequmeus
colequmesu colequumse colequumes colequusme colequusem colequuesm colequuems colequemus colequemsu colequeums colequeusm
colequesum colequesmu coleqesmuu coleqesmuu coleqesumu coleqesuum coleqesuum coleqesumu coleqemsuu coleqemsuu coleqemusu
coleqemuus coleqemuus coleqemusu coleqeumsu coleqeumus coleqeusmu coleqeusum coleqeuusm coleqeuums coleqeumus coleqeumsu
coleqeuums coleqeuusm coleqeusum coleqeusmu coleuusqme coleuusqem coleuusmqe coleuusmeq coleuusemq coleuuseqm coleuuqsme
coleuuqsem coleuuqmse coleuuqmes coleuuqems coleuuqesm coleuumqse coleuumqes coleuumsqe coleuumseq coleuumesq coleuumeqs
coleuueqms coleuueqsm coleuuemqs coleuuemsq coleuuesmq coleuuesqm coleusuqme coleusuqem coleusumqe coleusumeq coleusuemq
coleusueqm coleusqume coleusquem coleusqmue coleusqmeu coleusqemu coleusqeum coleusmque coleusmqeu coleusmuqe coleusmueq
coleusmeuq coleusmequ coleuseqmu coleusequm coleusemqu coleusemuq coleuseumq coleuseuqm coleuqsume coleuqsuem coleuqsmue
coleuqsmeu coleuqsemu coleuqseum coleuqusme coleuqusem coleuqumse coleuqumes coleuquems coleuquesm coleuqmuse coleuqmues
coleuqmsue coleuqmseu coleuqmesu coleuqmeus coleuqeums coleuqeusm coleuqemus coleuqemsu coleuqesmu coleuqesum coleumsque
coleumsqeu coleumsuqe coleumsueq coleumseuq coleumsequ coleumqsue coleumqseu coleumquse coleumques coleumqeus coleumqesu
coleumuqse coleumuqes coleumusqe coleumuseq coleumuesq coleumueqs coleumequs coleumeqsu coleumeuqs coleumeusq coleumesuq
coleumesqu coleuesqmu coleuesqum coleuesmqu coleuesmuq coleuesumq coleuesuqm coleueqsmu coleueqsum coleueqmsu coleueqmus
coleuequms coleuequsm coleuemqsu coleuemqus coleuemsqu coleuemsuq coleuemusq coleuemuqs coleueuqms coleueuqsm coleueumqs
coleueumsq coleueusmq coleueusqm coleeusqum coleeusqmu coleeusuqm coleeusumq coleeusmuq coleeusmqu coleeuqsum coleeuqsmu
coleeuqusm coleeuqums coleeuqmus coleeuqmsu coleeuuqsm coleeuuqms coleeuusqm coleeuusmq coleeuumsq coleeuumqs coleeumqus
coleeumqsu coleeumuqs coleeumusq coleeumsuq coleeumsqu coleesuqum coleesuqmu coleesuuqm coleesuumq coleesumuq coleesumqu
coleesquum coleesqumu coleesquum coleesqumu coleesqmuu coleesqmuu coleesuqum coleesuqmu coleesuuqm coleesuumq coleesumuq
coleesumqu coleesmquu coleesmquu coleesmuqu coleesmuuq coleesmuuq coleesmuqu coleeqsuum coleeqsumu coleeqsuum coleeqsumu
coleeqsmuu coleeqsmuu coleequsum coleequsmu coleequusm coleequums coleequmus coleequmsu coleequusm coleequums coleequsum
coleequsmu coleequmsu coleequmus coleeqmuus coleeqmusu coleeqmuus coleeqmusu coleeqmsuu coleeqmsuu coleeusqum coleeusqmu
coleeusuqm coleeusumq coleeusmuq coleeusmqu coleeuqsum coleeuqsmu coleeuqusm coleeuqums coleeuqmus coleeuqmsu coleeuuqsm
coleeuuqms coleeuusqm coleeuusmq coleeuumsq coleeuumqs coleeumqus coleeumqsu coleeumuqs coleeumusq coleeumsuq coleeumsqu
coleemsquu coleemsquu coleemsuqu coleemsuuq coleemsuuq coleemsuqu coleemqsuu coleemqsuu coleemqusu coleemquus coleemquus
coleemqusu coleemuqsu coleemuqus coleemusqu coleemusuq coleemuusq coleemuuqs coleemuqus coleemuqsu coleemuuqs coleemuusq
coleemusuq coleemusqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us