easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

sptest

enger

little

pervades

faresonen

photosyntax

clavelize

infixerunt

felsen

loralyn

sulphurate

queler

geniumne

saponifier

relictarum

cervical

persuasiorigis

bravers


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: coemereque
cipher variations:
dpfnfsfrvf eqgogtgswg frhphuhtxh gsiqiviuyi htjrjwjvzj
iukskxkwak jvltlylxbl kwmumzmycm lxnvnanzdn myowoboaeo
nzpxpcpbfp oaqyqdqcgq pbrzrerdhr qcsasfseis rdtbtgtfjt
seucuhugku tfvdvivhlv ugwewjwimw vhxfxkxjnx wiygylykoy
xjzhzmzlpz ykaianamqa zlbjbobnrb amckcpcosc bndldqdptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: coemereque
Cipher: xlvnvivjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: coemereque
Cipher: AAABA ABBAB AABAA ABABB AABAA BAAAA AABAA ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: coemereque
cipher variations:
dpfnfsfrvfhrnlnanxjnltvjvivdxvpvdhdqdjldtxlflylpzlxztdtgtvntfdjzjwjhpjjfrxrerndr
nhzvzmztrzrjhthuhzfhvlprpcpftpznxpxkxlhxeqgogtgswgisomoboykomuwkwjweywqweierekme
uymgmzmqamyaueuhuwougekakxkiqkkgsysfsoesoiawanausaskiuiviagiwmqsqdqguqaoyqylymiy
frhphuhtxhjtpnpcpzlpnvxlxkxfzxrxfjfsflnfvznhnanrbnzbvfvivxpvhflblyljrllhtztgtpft
pjbxbobvtbtljvjwjbhjxnrtrerhvrbpzrzmznjzgsiqiviuyikuqoqdqamqowymylygaysygkgtgmog
waoioboscoacwgwjwyqwigmcmzmksmmiuauhuqguqkcycpcwucumkwkxkcikyosusfsiwscqasanaoka
htjrjwjvzjlvrprerbnrpxznzmzhbztzhlhuhnphxbpjpcptdpbdxhxkxzrxjhndnanltnnjvbvivrhv
rldzdqdxvdvnlxlyldjlzptvtgtjxtdrbtbobplbiukskxkwakmwsqsfscosqyaoanaicauaimivioqi
ycqkqdqueqceyiylyasykioeobomuookwcwjwsiwsmeaereywewomymzmekmaquwuhukyuescucpcqmc
jvltlylxblnxtrtgtdptrzbpbobjdbvbjnjwjprjzdrlrervfrdfzjzmzbtzljpfpcpnvpplxdxkxtjx
tnfbfsfzxfxpnznanflnbrvxvivlzvftdvdqdrndkwmumzmycmoyusuhuequsacqcpckecwckokxkqsk
aesmsfswgsegakanacuamkqgqdqowqqmyeylyukyuogcgtgaygyqoaobogmocswywjwmawgueweresoe
lxnvnanzdnpzvtvivfrvtbdrdqdlfdxdlplylrtlbftntgtxhtfhblbobdvbnlrhrerpxrrnzfzmzvlz
vphdhuhbzhzrpbpcphnpdtxzxkxnbxhvfxfsftpfmyowoboaeoqawuwjwgswuceseremgeyemqmzmsum
cguouhuyiugicmcpcewcomsisfsqyssoaganawmawqieivicaiasqcqdqioqeuyaylyocyiwgygtguqg
nzpxpcpbfprbxvxkxhtxvdftfsfnhfzfnrnantvndhvpvivzjvhjdndqdfxdpntjtgtrzttpbhbobxnb
xrjfjwjdbjbtrdrerjprfvzbzmzpdzjxhzhuhvrhoaqyqdqcgqscywylyiuywegugtgoigagosobouwo
eiwqwjwakwikeoeregyeqoukuhusauuqcicpcyocyskgkxkeckcusesfskqsgwacanaqeakyiaiviwsi
pbrzrerdhrtdzxzmzjvzxfhvhuhpjhbhptpcpvxpfjxrxkxblxjlfpfsfhzfrpvlvivtbvvrdjdqdzpd
ztlhlylfdldvtftgtlrthxbdbobrfblzjbjwjxtjqcsasfseisueayanakwaygiwiviqkiciquqdqwyq
gkysylycmykmgqgtgiagsqwmwjwucwwsekereaqeaumimzmgemewuguhumsuiycecpcsgcmakckxkyuk
rdtbtgtfjtvfbzboblxbzhjxjwjrljdjrvrerxzrhlztzmzdnzlnhrhuhjbhtrxnxkxvdxxtflfsfbrf
bvnjnanhfnfxvhvivntvjzdfdqdthdnbldlylzvlseucuhugkuwgcacpcmycaikykxksmkekswsfsyas
imauanaeoamoisivikciusyoylyweyyugmgtgcsgcwokoboigogywiwjwouwkaegereuieocmemzmawm
tfvdvivhlvxhdbdqdnzdbjlzlyltnlfltxtgtzbtjnbvbobfpbnpjtjwjldjvtzpzmzxfzzvhnhuhdth
dxplpcpjhphzxjxkxpvxlbfhfsfvjfpdnfnanbxnugwewjwimwyiecereoaeckmamzmuomgmuyuhuacu
kocwcpcgqcoqkukxkmekwuaqanaygaawioivieuieyqmqdqkiqiaykylyqwymcgigtgwkgqeogobocyo
vhxfxkxjnxzjfdfsfpbfdlnbnanvpnhnvzvivbdvlpdxdqdhrdprlvlylnflxvbrbobzhbbxjpjwjfvj
fzrnrerljrjbzlzmzrxzndhjhuhxlhrfphpcpdzpwiygylykoyakgegtgqcgemocobowqoiowawjwcew
mqeyereiseqsmwmzmogmywcscpcaiccykqkxkgwkgasosfsmkskcamanasyaoeikiviymisgqiqdqeaq
xjzhzmzlpzblhfhuhrdhfnpdpcpxrpjpxbxkxdfxnrfzfsfjtfrtnxnanphnzxdtdqdbjddzlrlylhxl
hbtptgtnltldbnbobtzbpfjljwjznjthrjrerfbrykaianamqacmigiviseigoqeqdqysqkqycylyegy
osgagtgkugsuoyoboqioayeuereckeeamsmzmiymicuquhuomumecocpcuacqgkmkxkaokuisksfsgcs
zlbjbobnrbdnjhjwjtfjhprfrerztrlrzdzmzfhzpthbhuhlvhtvpzpcprjpbzfvfsfdlffbntnanjzn
jdvrvivpnvnfdpdqdvbdrhlnlylbplvjtltgthdtamckcpcosceokikxkugkiqsgsfsausmsaeanagia
quicivimwiuwqaqdqskqcagwgtgemggcouobokaokewswjwqowogeqerewcesimomzmcqmwkumuhuieu
bndldqdptdfpljlylvhljrthtgtbvtntbfbobhjbrvjdjwjnxjvxrbrertlrdbhxhuhfnhhdpvpcplbp
lfxtxkxrpxphfrfsfxdftjnpnandrnxlvnvivjfvcoemerequegqmkmzmwimksuiuhucwuoucgcpcikc
swkekxkoykwyscsfsumseciyivigoiieqwqdqmcqmgyuylysqyqigsgtgyegukoqoboesoymwowjwkgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: coemereque
Cipher: pbrzrerdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: coemereque
Cipher: 31435123512451145451

Extended Methods:
Method #1

Plaintext: coemereque
method variations:
htkrkwkvzknypwpbpaepsdubugufkuxizgzmzlpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
c o e m e r e q u e 
3 4 5 2 5 2 5 1 5 5 
1 3 1 3 1 4 1 4 4 1 
They are then read out in rows:
34525251551313141441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: coemereque
Cipher: skkezllqqd

Read more ...
Method #3

Plaintext: coemereque
method variations:
qxfxfyayyl xfxfyayylq fxfyayylqx
xfyayylqxf fyayylqxfx yayylqxfxf
ayylqxfxfy yylqxfxfya ylqxfxfyay
lqxfxfyayy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: coemereque

first 5040 cipher variations(3628800 total)
coemereque coemereqeu coemereuqe coemereueq coemereeuq coemereequ coemerqeue coemerqeeu coemerquee coemerquee coemerqeue
coemerqeeu coemeruqee coemeruqee coemerueqe coemerueeq coemerueeq coemerueqe coemereque coemereqeu coemereuqe coemereueq
coemereeuq coemereequ coemeerque coemeerqeu coemeeruqe coemeerueq coemeereuq coemeerequ coemeeqrue coemeeqreu coemeequre
coemeequer coemeeqeur coemeeqeru coemeeuqre coemeeuqer coemeeurqe coemeeureq coemeeuerq coemeeueqr coemeeequr coemeeeqru
coemeeeuqr coemeeeurq coemeeeruq coemeeerqu coemeqerue coemeqereu coemeqeure coemeqeuer coemeqeeur coemeqeeru coemeqreue
coemeqreeu coemeqruee coemeqruee coemeqreue coemeqreeu coemequree coemequree coemequere coemequeer coemequeer coemequere
coemeqerue coemeqereu coemeqeure coemeqeuer coemeqeeur coemeqeeru coemeueqre coemeueqer coemeuerqe coemeuereq coemeueerq
coemeueeqr coemeuqere coemeuqeer coemeuqree coemeuqree coemeuqere coemeuqeer coemeurqee coemeurqee coemeureqe coemeureeq
coemeureeq coemeureqe coemeueqre coemeueqer coemeuerqe coemeuereq coemeueerq coemeueeqr coemeeequr coemeeeqru coemeeeuqr
coemeeeurq coemeeeruq coemeeerqu coemeeqeur coemeeqeru coemeequer coemeequre coemeeqrue coemeeqreu coemeeuqer coemeeuqre
coemeeueqr coemeeuerq coemeeureq coemeeurqe coemeerque coemeerqeu coemeeruqe coemeerueq coemeereuq coemeerequ coemreeque
coemreeqeu coemreeuqe coemreeueq coemreeeuq coemreeequ coemreqeue coemreqeeu coemrequee coemrequee coemreqeue coemreqeeu
coemreuqee coemreuqee coemreueqe coemreueeq coemreueeq coemreueqe coemreeque coemreeqeu coemreeuqe coemreeueq coemreeeuq
coemreeequ coemreeque coemreeqeu coemreeuqe coemreeueq coemreeeuq coemreeequ coemreqeue coemreqeeu coemrequee coemrequee
coemreqeue coemreqeeu coemreuqee coemreuqee coemreueqe coemreueeq coemreueeq coemreueqe coemreeque coemreeqeu coemreeuqe
coemreeueq coemreeeuq coemreeequ coemrqeeue coemrqeeeu coemrqeuee coemrqeuee coemrqeeue coemrqeeeu coemrqeeue coemrqeeeu
coemrqeuee coemrqeuee coemrqeeue coemrqeeeu coemrqueee coemrqueee coemrqueee coemrqueee coemrqueee coemrqueee coemrqeeue
coemrqeeeu coemrqeuee coemrqeuee coemrqeeue coemrqeeeu coemrueqee coemrueqee coemrueeqe coemrueeeq coemrueeeq coemrueeqe
coemruqeee coemruqeee coemruqeee coemruqeee coemruqeee coemruqeee coemrueqee coemrueqee coemrueeqe coemrueeeq coemrueeeq
coemrueeqe coemrueqee coemrueqee coemrueeqe coemrueeeq coemrueeeq coemrueeqe coemreeque coemreeqeu coemreeuqe coemreeueq
coemreeeuq coemreeequ coemreqeue coemreqeeu coemrequee coemrequee coemreqeue coemreqeeu coemreuqee coemreuqee coemreueqe
coemreueeq coemreueeq coemreueqe coemreeque coemreeqeu coemreeuqe coemreeueq coemreeeuq coemreeequ coemereque coemereqeu
coemereuqe coemereueq coemereeuq coemereequ coemerqeue coemerqeeu coemerquee coemerquee coemerqeue coemerqeeu coemeruqee
coemeruqee coemerueqe coemerueeq coemerueeq coemerueqe coemereque coemereqeu coemereuqe coemereueq coemereeuq coemereequ
coemeerque coemeerqeu coemeeruqe coemeerueq coemeereuq coemeerequ coemeeqrue coemeeqreu coemeequre coemeequer coemeeqeur
coemeeqeru coemeeuqre coemeeuqer coemeeurqe coemeeureq coemeeuerq coemeeueqr coemeeequr coemeeeqru coemeeeuqr coemeeeurq
coemeeeruq coemeeerqu coemeqerue coemeqereu coemeqeure coemeqeuer coemeqeeur coemeqeeru coemeqreue coemeqreeu coemeqruee
coemeqruee coemeqreue coemeqreeu coemequree coemequree coemequere coemequeer coemequeer coemequere coemeqerue coemeqereu
coemeqeure coemeqeuer coemeqeeur coemeqeeru coemeueqre coemeueqer coemeuerqe coemeuereq coemeueerq coemeueeqr coemeuqere
coemeuqeer coemeuqree coemeuqree coemeuqere coemeuqeer coemeurqee coemeurqee coemeureqe coemeureeq coemeureeq coemeureqe
coemeueqre coemeueqer coemeuerqe coemeuereq coemeueerq coemeueeqr coemeeequr coemeeeqru coemeeeuqr coemeeeurq coemeeeruq
coemeeerqu coemeeqeur coemeeqeru coemeequer coemeequre coemeeqrue coemeeqreu coemeeuqer coemeeuqre coemeeueqr coemeeuerq
coemeeureq coemeeurqe coemeerque coemeerqeu coemeeruqe coemeerueq coemeereuq coemeerequ coemqreeue coemqreeeu coemqreuee
coemqreuee coemqreeue coemqreeeu coemqreeue coemqreeeu coemqreuee coemqreuee coemqreeue coemqreeeu coemqrueee coemqrueee
coemqrueee coemqrueee coemqrueee coemqrueee coemqreeue coemqreeeu coemqreuee coemqreuee coemqreeue coemqreeeu coemqereue
coemqereeu coemqeruee coemqeruee coemqereue coemqereeu coemqeerue coemqeereu coemqeeure coemqeeuer coemqeeeur coemqeeeru
coemqeuere coemqeueer coemqeuree coemqeuree coemqeuere coemqeueer coemqeeeur coemqeeeru coemqeeuer coemqeeure coemqeerue
coemqeereu coemqeerue coemqeereu coemqeeure coemqeeuer coemqeeeur coemqeeeru coemqereue coemqereeu coemqeruee coemqeruee
coemqereue coemqereeu coemqeuree coemqeuree coemqeuere coemqeueer coemqeueer coemqeuere coemqeerue coemqeereu coemqeeure
coemqeeuer coemqeeeur coemqeeeru coemqueere coemqueeer coemqueree coemqueree coemqueere coemqueeer coemqueere coemqueeer
coemqueree coemqueree coemqueere coemqueeer coemqureee coemqureee coemqureee coemqureee coemqureee coemqureee coemqueere
coemqueeer coemqueree coemqueree coemqueere coemqueeer coemqeeeur coemqeeeru coemqeeuer coemqeeure coemqeerue coemqeereu
coemqeeeur coemqeeeru coemqeeuer coemqeeure coemqeerue coemqeereu coemqeueer coemqeuere coemqeueer coemqeuere coemqeuree
coemqeuree coemqereue coemqereeu coemqeruee coemqeruee coemqereue coemqereeu coemureqee coemureqee coemureeqe coemureeeq
coemureeeq coemureeqe coemurqeee coemurqeee coemurqeee coemurqeee coemurqeee coemurqeee coemureqee coemureqee coemureeqe
coemureeeq coemureeeq coemureeqe coemureqee coemureqee coemureeqe coemureeeq coemureeeq coemureeqe coemuerqee coemuerqee
coemuereqe coemuereeq coemuereeq coemuereqe coemueqree coemueqree coemueqere coemueqeer coemueqeer coemueqere coemueeqre
coemueeqer coemueerqe coemueereq coemueeerq coemueeeqr coemueeqer coemueeqre coemueeeqr coemueeerq coemueereq coemueerqe
coemuqeree coemuqeree coemuqeere coemuqeeer coemuqeeer coemuqeere coemuqreee coemuqreee coemuqreee coemuqreee coemuqreee
coemuqreee coemuqeree coemuqeree coemuqeere coemuqeeer coemuqeeer coemuqeere coemuqeree coemuqeree coemuqeere coemuqeeer
coemuqeeer coemuqeere coemueeqre coemueeqer coemueerqe coemueereq coemueeerq coemueeeqr coemueqere coemueqeer coemueqree
coemueqree coemueqere coemueqeer coemuerqee coemuerqee coemuereqe coemuereeq coemuereeq coemuereqe coemueeqre coemueeqer
coemueerqe coemueereq coemueeerq coemueeeqr coemueeqer coemueeqre coemueeeqr coemueeerq coemueereq coemueerqe coemueqeer
coemueqere coemueqeer coemueqere coemueqree coemueqree coemueeqer coemueeqre coemueeeqr coemueeerq coemueereq coemueerqe
coemuerqee coemuerqee coemuereqe coemuereeq coemuereeq coemuereqe coemereque coemereqeu coemereuqe coemereueq coemereeuq
coemereequ coemerqeue coemerqeeu coemerquee coemerquee coemerqeue coemerqeeu coemeruqee coemeruqee coemerueqe coemerueeq
coemerueeq coemerueqe coemereque coemereqeu coemereuqe coemereueq coemereeuq coemereequ coemeerque coemeerqeu coemeeruqe
coemeerueq coemeereuq coemeerequ coemeeqrue coemeeqreu coemeequre coemeequer coemeeqeur coemeeqeru coemeeuqre coemeeuqer
coemeeurqe coemeeureq coemeeuerq coemeeueqr coemeeequr coemeeeqru coemeeeuqr coemeeeurq coemeeeruq coemeeerqu coemeqerue
coemeqereu coemeqeure coemeqeuer coemeqeeur coemeqeeru coemeqreue coemeqreeu coemeqruee coemeqruee coemeqreue coemeqreeu
coemequree coemequree coemequere coemequeer coemequeer coemequere coemeqerue coemeqereu coemeqeure coemeqeuer coemeqeeur
coemeqeeru coemeueqre coemeueqer coemeuerqe coemeuereq coemeueerq coemeueeqr coemeuqere coemeuqeer coemeuqree coemeuqree
coemeuqere coemeuqeer coemeurqee coemeurqee coemeureqe coemeureeq coemeureeq coemeureqe coemeueqre coemeueqer coemeuerqe
coemeuereq coemeueerq coemeueeqr coemeeequr coemeeeqru coemeeeuqr coemeeeurq coemeeeruq coemeeerqu coemeeqeur coemeeqeru
coemeequer coemeequre coemeeqrue coemeeqreu coemeeuqer coemeeuqre coemeeueqr coemeeuerq coemeeureq coemeeurqe coemeerque
coemeerqeu coemeeruqe coemeerueq coemeereuq coemeerequ coeemreque coeemreqeu coeemreuqe coeemreueq coeemreeuq coeemreequ
coeemrqeue coeemrqeeu coeemrquee coeemrquee coeemrqeue coeemrqeeu coeemruqee coeemruqee coeemrueqe coeemrueeq coeemrueeq
coeemrueqe coeemreque coeemreqeu coeemreuqe coeemreueq coeemreeuq coeemreequ coeemerque coeemerqeu coeemeruqe coeemerueq
coeemereuq coeemerequ coeemeqrue coeemeqreu coeemequre coeemequer coeemeqeur coeemeqeru coeemeuqre coeemeuqer coeemeurqe
coeemeureq coeemeuerq coeemeueqr coeemeequr coeemeeqru coeemeeuqr coeemeeurq coeemeeruq coeemeerqu coeemqerue coeemqereu
coeemqeure coeemqeuer coeemqeeur coeemqeeru coeemqreue coeemqreeu coeemqruee coeemqruee coeemqreue coeemqreeu coeemquree
coeemquree coeemquere coeemqueer coeemqueer coeemquere coeemqerue coeemqereu coeemqeure coeemqeuer coeemqeeur coeemqeeru
coeemueqre coeemueqer coeemuerqe coeemuereq coeemueerq coeemueeqr coeemuqere coeemuqeer coeemuqree coeemuqree coeemuqere
coeemuqeer coeemurqee coeemurqee coeemureqe coeemureeq coeemureeq coeemureqe coeemueqre coeemueqer coeemuerqe coeemuereq
coeemueerq coeemueeqr coeemeequr coeemeeqru coeemeeuqr coeemeeurq coeemeeruq coeemeerqu coeemeqeur coeemeqeru coeemequer
coeemequre coeemeqrue coeemeqreu coeemeuqer coeemeuqre coeemeueqr coeemeuerq coeemeureq coeemeurqe coeemerque coeemerqeu
coeemeruqe coeemerueq coeemereuq coeemerequ coeermeque coeermeqeu coeermeuqe coeermeueq coeermeeuq coeermeequ coeermqeue
coeermqeeu coeermquee coeermquee coeermqeue coeermqeeu coeermuqee coeermuqee coeermueqe coeermueeq coeermueeq coeermueqe
coeermeque coeermeqeu coeermeuqe coeermeueq coeermeeuq coeermeequ coeeremque coeeremqeu coeeremuqe coeeremueq coeeremeuq
coeeremequ coeereqmue coeereqmeu coeerequme coeerequem coeereqeum coeereqemu coeereuqme coeereuqem coeereumqe coeereumeq
coeereuemq coeereueqm coeereequm coeereeqmu coeereeuqm coeereeumq coeereemuq coeereemqu coeerqemue coeerqemeu coeerqeume
coeerqeuem coeerqeeum coeerqeemu coeerqmeue coeerqmeeu coeerqmuee coeerqmuee coeerqmeue coeerqmeeu coeerqumee coeerqumee
coeerqueme coeerqueem coeerqueem coeerqueme coeerqemue coeerqemeu coeerqeume coeerqeuem coeerqeeum coeerqeemu coeerueqme
coeerueqem coeeruemqe coeeruemeq coeerueemq coeerueeqm coeeruqeme coeeruqeem coeeruqmee coeeruqmee coeeruqeme coeeruqeem
coeerumqee coeerumqee coeerumeqe coeerumeeq coeerumeeq coeerumeqe coeerueqme coeerueqem coeeruemqe coeeruemeq coeerueemq
coeerueeqm coeereequm coeereeqmu coeereeuqm coeereeumq coeereemuq coeereemqu coeereqeum coeereqemu coeerequem coeerequme
coeereqmue coeereqmeu coeereuqem coeereuqme coeereueqm coeereuemq coeereumeq coeereumqe coeeremque coeeremqeu coeeremuqe
coeeremueq coeeremeuq coeeremequ coeeermque coeeermqeu coeeermuqe coeeermueq coeeermeuq coeeermequ coeeerqmue coeeerqmeu
coeeerqume coeeerquem coeeerqeum coeeerqemu coeeeruqme coeeeruqem coeeerumqe coeeerumeq coeeeruemq coeeerueqm coeeerequm
coeeereqmu coeeereuqm coeeereumq coeeeremuq coeeeremqu coeeemrque coeeemrqeu coeeemruqe coeeemrueq coeeemreuq coeeemrequ
coeeemqrue coeeemqreu coeeemqure coeeemquer coeeemqeur coeeemqeru coeeemuqre coeeemuqer coeeemurqe coeeemureq coeeemuerq
coeeemueqr coeeemequr coeeemeqru coeeemeuqr coeeemeurq coeeemeruq coeeemerqu coeeeqmrue coeeeqmreu coeeeqmure coeeeqmuer
coeeeqmeur coeeeqmeru coeeeqrmue coeeeqrmeu coeeeqrume coeeeqruem coeeeqreum coeeeqremu coeeequrme coeeequrem coeeequmre
coeeequmer coeeequemr coeeequerm coeeeqerum coeeeqermu coeeeqeurm coeeeqeumr coeeeqemur coeeeqemru coeeeumqre coeeeumqer
coeeeumrqe coeeeumreq coeeeumerq coeeeumeqr coeeeuqmre coeeeuqmer coeeeuqrme coeeeuqrem coeeeuqerm coeeeuqemr coeeeurqme
coeeeurqem coeeeurmqe coeeeurmeq coeeeuremq coeeeureqm coeeeueqrm coeeeueqmr coeeeuerqm coeeeuermq coeeeuemrq coeeeuemqr
coeeeemqur coeeeemqru coeeeemuqr coeeeemurq coeeeemruq coeeeemrqu coeeeeqmur coeeeeqmru coeeeequmr coeeeequrm coeeeeqrum
coeeeeqrmu coeeeeuqmr coeeeeuqrm coeeeeumqr coeeeeumrq coeeeeurmq coeeeeurqm coeeeerqum coeeeerqmu coeeeeruqm coeeeerumq
coeeeermuq coeeeermqu coeeqremue coeeqremeu coeeqreume coeeqreuem coeeqreeum coeeqreemu coeeqrmeue coeeqrmeeu coeeqrmuee
coeeqrmuee coeeqrmeue coeeqrmeeu coeeqrumee coeeqrumee coeeqrueme coeeqrueem coeeqrueem coeeqrueme coeeqremue coeeqremeu
coeeqreume coeeqreuem coeeqreeum coeeqreemu coeeqermue coeeqermeu coeeqerume coeeqeruem coeeqereum coeeqeremu coeeqemrue
coeeqemreu coeeqemure coeeqemuer coeeqemeur coeeqemeru coeeqeumre coeeqeumer coeeqeurme coeeqeurem coeeqeuerm coeeqeuemr
coeeqeemur coeeqeemru coeeqeeumr coeeqeeurm coeeqeerum coeeqeermu coeeqmerue coeeqmereu coeeqmeure coeeqmeuer coeeqmeeur
coeeqmeeru coeeqmreue coeeqmreeu coeeqmruee coeeqmruee coeeqmreue coeeqmreeu coeeqmuree coeeqmuree coeeqmuere coeeqmueer
coeeqmueer coeeqmuere coeeqmerue coeeqmereu coeeqmeure coeeqmeuer coeeqmeeur coeeqmeeru coeequemre coeequemer coeequerme
coeequerem coeequeerm coeequeemr coeequmere coeequmeer coeequmree coeequmree coeequmere coeequmeer coeequrmee coeequrmee
coeequreme coeequreem coeequreem coeequreme coeequemre coeequemer coeequerme coeequerem coeequeerm coeequeemr coeeqeemur
coeeqeemru coeeqeeumr coeeqeeurm coeeqeerum coeeqeermu coeeqemeur coeeqemeru coeeqemuer coeeqemure coeeqemrue coeeqemreu
coeeqeumer coeeqeumre coeeqeuemr coeeqeuerm coeeqeurem coeeqeurme coeeqermue coeeqermeu coeeqerume coeeqeruem coeeqereum
coeeqeremu coeeureqme coeeureqem coeeuremqe coeeuremeq coeeureemq coeeureeqm coeeurqeme coeeurqeem coeeurqmee coeeurqmee
coeeurqeme coeeurqeem coeeurmqee coeeurmqee coeeurmeqe coeeurmeeq coeeurmeeq coeeurmeqe coeeureqme coeeureqem coeeuremqe
coeeuremeq coeeureemq coeeureeqm coeeuerqme coeeuerqem coeeuermqe coeeuermeq coeeueremq coeeuereqm coeeueqrme coeeueqrem
coeeueqmre coeeueqmer coeeueqemr coeeueqerm coeeuemqre coeeuemqer coeeuemrqe coeeuemreq coeeuemerq coeeuemeqr coeeueeqmr
coeeueeqrm coeeueemqr coeeueemrq coeeueermq coeeueerqm coeeuqerme coeeuqerem coeeuqemre coeeuqemer coeeuqeemr coeeuqeerm
coeeuqreme coeeuqreem coeeuqrmee coeeuqrmee coeeuqreme coeeuqreem coeeuqmree coeeuqmree coeeuqmere coeeuqmeer coeeuqmeer
coeeuqmere coeeuqerme coeeuqerem coeeuqemre coeeuqemer coeeuqeemr coeeuqeerm coeeumeqre coeeumeqer coeeumerqe coeeumereq
coeeumeerq coeeumeeqr coeeumqere coeeumqeer coeeumqree coeeumqree coeeumqere coeeumqeer coeeumrqee coeeumrqee coeeumreqe
coeeumreeq coeeumreeq coeeumreqe coeeumeqre coeeumeqer coeeumerqe coeeumereq coeeumeerq coeeumeeqr coeeueeqmr coeeueeqrm
coeeueemqr coeeueemrq coeeueermq coeeueerqm coeeueqemr coeeueqerm coeeueqmer coeeueqmre coeeueqrme coeeueqrem coeeuemqer
coeeuemqre coeeuemeqr coeeuemerq coeeuemreq coeeuemrqe coeeuerqme coeeuerqem coeeuermqe coeeuermeq coeeueremq coeeuereqm
coeeerequm coeeereqmu coeeereuqm coeeereumq coeeeremuq coeeeremqu coeeerqeum coeeerqemu coeeerquem coeeerqume coeeerqmue
coeeerqmeu coeeeruqem coeeeruqme coeeerueqm coeeeruemq coeeerumeq coeeerumqe coeeermque coeeermqeu coeeermuqe coeeermueq
coeeermeuq coeeermequ coeeeerqum coeeeerqmu coeeeeruqm coeeeerumq coeeeermuq coeeeermqu coeeeeqrum coeeeeqrmu coeeeequrm
coeeeequmr coeeeeqmur coeeeeqmru coeeeeuqrm coeeeeuqmr coeeeeurqm coeeeeurmq coeeeeumrq coeeeeumqr coeeeemqur coeeeemqru
coeeeemuqr coeeeemurq coeeeemruq coeeeemrqu coeeeqerum coeeeqermu coeeeqeurm coeeeqeumr coeeeqemur coeeeqemru coeeeqreum
coeeeqremu coeeeqruem coeeeqrume coeeeqrmue coeeeqrmeu coeeequrem coeeequrme coeeequerm coeeequemr coeeequmer coeeequmre
coeeeqmrue coeeeqmreu coeeeqmure coeeeqmuer coeeeqmeur coeeeqmeru coeeeueqrm coeeeueqmr coeeeuerqm coeeeuermq coeeeuemrq
coeeeuemqr coeeeuqerm coeeeuqemr coeeeuqrem coeeeuqrme coeeeuqmre coeeeuqmer coeeeurqem coeeeurqme coeeeureqm coeeeuremq
coeeeurmeq coeeeurmqe coeeeumqre coeeeumqer coeeeumrqe coeeeumreq coeeeumerq coeeeumeqr coeeemequr coeeemeqru coeeemeuqr
coeeemeurq coeeemeruq coeeemerqu coeeemqeur coeeemqeru coeeemquer coeeemqure coeeemqrue coeeemqreu coeeemuqer coeeemuqre
coeeemueqr coeeemuerq coeeemureq coeeemurqe coeeemrque coeeemrqeu coeeemruqe coeeemrueq coeeemreuq coeeemrequ coeremeque
coeremeqeu coeremeuqe coeremeueq coeremeeuq coeremeequ coeremqeue coeremqeeu coeremquee coeremquee coeremqeue coeremqeeu
coeremuqee coeremuqee coeremueqe coeremueeq coeremueeq coeremueqe coeremeque coeremeqeu coeremeuqe coeremeueq coeremeeuq
coeremeequ coereemque coereemqeu coereemuqe coereemueq coereemeuq coereemequ coereeqmue coereeqmeu coereequme coereequem
coereeqeum coereeqemu coereeuqme coereeuqem coereeumqe coereeumeq coereeuemq coereeueqm coereeequm coereeeqmu coereeeuqm
coereeeumq coereeemuq coereeemqu coereqemue coereqemeu coereqeume coereqeuem coereqeeum coereqeemu coereqmeue coereqmeeu
coereqmuee coereqmuee coereqmeue coereqmeeu coerequmee coerequmee coerequeme coerequeem coerequeem coerequeme coereqemue
coereqemeu coereqeume coereqeuem coereqeeum coereqeemu coereueqme coereueqem coereuemqe coereuemeq coereueemq coereueeqm
coereuqeme coereuqeem coereuqmee coereuqmee coereuqeme coereuqeem coereumqee coereumqee coereumeqe coereumeeq coereumeeq
coereumeqe coereueqme coereueqem coereuemqe coereuemeq coereueemq coereueeqm coereeequm coereeeqmu coereeeuqm coereeeumq
coereeemuq coereeemqu coereeqeum coereeqemu coereequem coereequme coereeqmue coereeqmeu coereeuqem coereeuqme coereeueqm
coereeuemq coereeumeq coereeumqe coereemque coereemqeu coereemuqe coereemueq coereemeuq coereemequ coermeeque coermeeqeu
coermeeuqe coermeeueq coermeeeuq coermeeequ coermeqeue coermeqeeu coermequee coermequee coermeqeue coermeqeeu coermeuqee
coermeuqee coermeueqe coermeueeq coermeueeq coermeueqe coermeeque coermeeqeu coermeeuqe coermeeueq coermeeeuq coermeeequ
coermeeque coermeeqeu coermeeuqe coermeeueq coermeeeuq coermeeequ coermeqeue coermeqeeu coermequee coermequee coermeqeue
coermeqeeu coermeuqee coermeuqee coermeueqe coermeueeq coermeueeq coermeueqe coermeeque coermeeqeu coermeeuqe coermeeueq
coermeeeuq coermeeequ coermqeeue coermqeeeu coermqeuee coermqeuee coermqeeue coermqeeeu coermqeeue coermqeeeu coermqeuee
coermqeuee coermqeeue coermqeeeu coermqueee coermqueee coermqueee coermqueee coermqueee coermqueee coermqeeue coermqeeeu
coermqeuee coermqeuee coermqeeue coermqeeeu coermueqee coermueqee coermueeqe coermueeeq coermueeeq coermueeqe coermuqeee
coermuqeee coermuqeee coermuqeee coermuqeee coermuqeee coermueqee coermueqee coermueeqe coermueeeq coermueeeq coermueeqe
coermueqee coermueqee coermueeqe coermueeeq coermueeeq coermueeqe coermeeque coermeeqeu coermeeuqe coermeeueq coermeeeuq
coermeeequ coermeqeue coermeqeeu coermequee coermequee coermeqeue coermeqeeu coermeuqee coermeuqee coermeueqe coermeueeq
coermeueeq coermeueqe coermeeque coermeeqeu coermeeuqe coermeeueq coermeeeuq coermeeequ coeremeque coeremeqeu coeremeuqe
coeremeueq coeremeeuq coeremeequ coeremqeue coeremqeeu coeremquee coeremquee coeremqeue coeremqeeu coeremuqee coeremuqee
coeremueqe coeremueeq coeremueeq coeremueqe coeremeque coeremeqeu coeremeuqe coeremeueq coeremeeuq coeremeequ coereemque
coereemqeu coereemuqe coereemueq coereemeuq coereemequ coereeqmue coereeqmeu coereequme coereequem coereeqeum coereeqemu
coereeuqme coereeuqem coereeumqe coereeumeq coereeuemq coereeueqm coereeequm coereeeqmu coereeeuqm coereeeumq coereeemuq
coereeemqu coereqemue coereqemeu coereqeume coereqeuem coereqeeum coereqeemu coereqmeue coereqmeeu coereqmuee coereqmuee
coereqmeue coereqmeeu coerequmee coerequmee coerequeme coerequeem coerequeem coerequeme coereqemue coereqemeu coereqeume
coereqeuem coereqeeum coereqeemu coereueqme coereueqem coereuemqe coereuemeq coereueemq coereueeqm coereuqeme coereuqeem
coereuqmee coereuqmee coereuqeme coereuqeem coereumqee coereumqee coereumeqe coereumeeq coereumeeq coereumeqe coereueqme
coereueqem coereuemqe coereuemeq coereueemq coereueeqm coereeequm coereeeqmu coereeeuqm coereeeumq coereeemuq coereeemqu
coereeqeum coereeqemu coereequem coereequme coereeqmue coereeqmeu coereeuqem coereeuqme coereeueqm coereeuemq coereeumeq
coereeumqe coereemque coereemqeu coereemuqe coereemueq coereemeuq coereemequ coerqmeeue coerqmeeeu coerqmeuee coerqmeuee
coerqmeeue coerqmeeeu coerqmeeue coerqmeeeu coerqmeuee coerqmeuee coerqmeeue coerqmeeeu coerqmueee coerqmueee coerqmueee
coerqmueee coerqmueee coerqmueee coerqmeeue coerqmeeeu coerqmeuee coerqmeuee coerqmeeue coerqmeeeu coerqemeue coerqemeeu
coerqemuee coerqemuee coerqemeue coerqemeeu coerqeemue coerqeemeu coerqeeume coerqeeuem coerqeeeum coerqeeemu coerqeueme
coerqeueem coerqeumee coerqeumee coerqeueme coerqeueem coerqeeeum coerqeeemu coerqeeuem coerqeeume coerqeemue coerqeemeu
coerqeemue coerqeemeu coerqeeume coerqeeuem coerqeeeum coerqeeemu coerqemeue coerqemeeu coerqemuee coerqemuee coerqemeue
coerqemeeu coerqeumee coerqeumee coerqeueme coerqeueem coerqeueem coerqeueme coerqeemue coerqeemeu coerqeeume coerqeeuem
coerqeeeum coerqeeemu coerqueeme coerqueeem coerquemee coerquemee coerqueeme coerqueeem coerqueeme coerqueeem coerquemee
coerquemee coerqueeme coerqueeem coerqumeee coerqumeee coerqumeee coerqumeee coerqumeee coerqumeee coerqueeme coerqueeem
coerquemee coerquemee coerqueeme coerqueeem coerqeeeum coerqeeemu coerqeeuem coerqeeume coerqeemue coerqeemeu coerqeeeum
coerqeeemu coerqeeuem coerqeeume coerqeemue coerqeemeu coerqeueem coerqeueme coerqeueem coerqeueme coerqeumee coerqeumee
coerqemeue coerqemeeu coerqemuee coerqemuee coerqemeue coerqemeeu coerumeqee coerumeqee coerumeeqe coerumeeeq coerumeeeq
coerumeeqe coerumqeee coerumqeee coerumqeee coerumqeee coerumqeee coerumqeee coerumeqee coerumeqee coerumeeqe coerumeeeq
coerumeeeq coerumeeqe coerumeqee coerumeqee coerumeeqe coerumeeeq coerumeeeq coerumeeqe coeruemqee coeruemqee coeruemeqe
coeruemeeq coeruemeeq coeruemeqe coerueqmee coerueqmee coerueqeme coerueqeem coerueqeem coerueqeme coerueeqme coerueeqem
coerueemqe coerueemeq coerueeemq coerueeeqm coerueeqem coerueeqme coerueeeqm coerueeemq coerueemeq coerueemqe coeruqemee
coeruqemee coeruqeeme coeruqeeem coeruqeeem coeruqeeme coeruqmeee coeruqmeee coeruqmeee coeruqmeee coeruqmeee coeruqmeee
coeruqemee coeruqemee coeruqeeme coeruqeeem coeruqeeem coeruqeeme coeruqemee coeruqemee coeruqeeme coeruqeeem coeruqeeem
coeruqeeme coerueeqme coerueeqem coerueemqe coerueemeq coerueeemq coerueeeqm coerueqeme coerueqeem coerueqmee coerueqmee
coerueqeme coerueqeem coeruemqee coeruemqee coeruemeqe coeruemeeq coeruemeeq coeruemeqe coerueeqme coerueeqem coerueemqe
coerueemeq coerueeemq coerueeeqm coerueeqem coerueeqme coerueeeqm coerueeemq coerueemeq coerueemqe coerueqeem coerueqeme
coerueqeem coerueqeme coerueqmee coerueqmee coerueeqem coerueeqme coerueeeqm coerueeemq coerueemeq coerueemqe coeruemqee
coeruemqee coeruemeqe coeruemeeq coeruemeeq coeruemeqe coeremeque coeremeqeu coeremeuqe coeremeueq coeremeeuq coeremeequ
coeremqeue coeremqeeu coeremquee coeremquee coeremqeue coeremqeeu coeremuqee coeremuqee coeremueqe coeremueeq coeremueeq
coeremueqe coeremeque coeremeqeu coeremeuqe coeremeueq coeremeeuq coeremeequ coereemque coereemqeu coereemuqe coereemueq
coereemeuq coereemequ coereeqmue coereeqmeu coereequme coereequem coereeqeum coereeqemu coereeuqme coereeuqem coereeumqe
coereeumeq coereeuemq coereeueqm coereeequm coereeeqmu coereeeuqm coereeeumq coereeemuq coereeemqu coereqemue coereqemeu
coereqeume coereqeuem coereqeeum coereqeemu coereqmeue coereqmeeu coereqmuee coereqmuee coereqmeue coereqmeeu coerequmee
coerequmee coerequeme coerequeem coerequeem coerequeme coereqemue coereqemeu coereqeume coereqeuem coereqeeum coereqeemu
coereueqme coereueqem coereuemqe coereuemeq coereueemq coereueeqm coereuqeme coereuqeem coereuqmee coereuqmee coereuqeme
coereuqeem coereumqee coereumqee coereumeqe coereumeeq coereumeeq coereumeqe coereueqme coereueqem coereuemqe coereuemeq
coereueemq coereueeqm coereeequm coereeeqmu coereeeuqm coereeeumq coereeemuq coereeemqu coereeqeum coereeqemu coereequem
coereequme coereeqmue coereeqmeu coereeuqem coereeuqme coereeueqm coereeuemq coereeumeq coereeumqe coereemque coereemqeu
coereemuqe coereemueq coereemeuq coereemequ coeeermque coeeermqeu coeeermuqe coeeermueq coeeermeuq coeeermequ coeeerqmue
coeeerqmeu coeeerqume coeeerquem coeeerqeum coeeerqemu coeeeruqme coeeeruqem coeeerumqe coeeerumeq coeeeruemq coeeerueqm
coeeerequm coeeereqmu coeeereuqm coeeereumq coeeeremuq coeeeremqu coeeemrque coeeemrqeu coeeemruqe coeeemrueq coeeemreuq
coeeemrequ coeeemqrue coeeemqreu coeeemqure coeeemquer coeeemqeur coeeemqeru coeeemuqre coeeemuqer coeeemurqe coeeemureq
coeeemuerq coeeemueqr coeeemequr coeeemeqru coeeemeuqr coeeemeurq coeeemeruq coeeemerqu coeeeqmrue coeeeqmreu coeeeqmure
coeeeqmuer coeeeqmeur coeeeqmeru coeeeqrmue coeeeqrmeu coeeeqrume coeeeqruem coeeeqreum coeeeqremu coeeequrme coeeequrem
coeeequmre coeeequmer coeeequemr coeeequerm coeeeqerum coeeeqermu coeeeqeurm coeeeqeumr coeeeqemur coeeeqemru coeeeumqre
coeeeumqer coeeeumrqe coeeeumreq coeeeumerq coeeeumeqr coeeeuqmre coeeeuqmer coeeeuqrme coeeeuqrem coeeeuqerm coeeeuqemr
coeeeurqme coeeeurqem coeeeurmqe coeeeurmeq coeeeuremq coeeeureqm coeeeueqrm coeeeueqmr coeeeuerqm coeeeuermq coeeeuemrq
coeeeuemqr coeeeemqur coeeeemqru coeeeemuqr coeeeemurq coeeeemruq coeeeemrqu coeeeeqmur coeeeeqmru coeeeequmr coeeeequrm
coeeeeqrum coeeeeqrmu coeeeeuqmr coeeeeuqrm coeeeeumqr coeeeeumrq coeeeeurmq coeeeeurqm coeeeerqum coeeeerqmu coeeeeruqm
coeeeerumq coeeeermuq coeeeermqu coeeremque coeeremqeu coeeremuqe coeeremueq coeeremeuq coeeremequ coeereqmue coeereqmeu
coeerequme coeerequem coeereqeum coeereqemu coeereuqme coeereuqem coeereumqe coeereumeq coeereuemq coeereueqm coeereequm
coeereeqmu coeereeuqm coeereeumq coeereemuq coeereemqu coeermeque coeermeqeu coeermeuqe coeermeueq coeermeeuq coeermeequ
coeermqeue coeermqeeu coeermquee coeermquee coeermqeue coeermqeeu coeermuqee coeermuqee coeermueqe coeermueeq coeermueeq
coeermueqe coeermeque coeermeqeu coeermeuqe coeermeueq coeermeeuq coeermeequ coeerqmeue coeerqmeeu coeerqmuee coeerqmuee
coeerqmeue coeerqmeeu coeerqemue coeerqemeu coeerqeume coeerqeuem coeerqeeum coeerqeemu coeerqueme coeerqueem coeerqumee
coeerqumee coeerqueme coeerqueem coeerqeeum coeerqeemu coeerqeuem coeerqeume coeerqemue coeerqemeu coeerumqee coeerumqee
coeerumeqe coeerumeeq coeerumeeq coeerumeqe coeeruqmee coeeruqmee coeeruqeme coeeruqeem coeeruqeem coeeruqeme coeerueqme
coeerueqem coeeruemqe coeeruemeq coeerueemq coeerueeqm coeerueqem coeerueqme coeerueeqm coeerueemq coeeruemeq coeeruemqe
coeeremque coeeremqeu coeeremuqe coeeremueq coeeremeuq coeeremequ coeereqmue coeereqmeu coeerequme coeerequem coeereqeum
coeereqemu coeereuqme coeereuqem coeereumqe coeereumeq coeereuemq coeereueqm coeereequm coeereeqmu coeereeuqm coeereeumq
coeereemuq coeereemqu coeemreque coeemreqeu coeemreuqe coeemreueq coeemreeuq coeemreequ coeemrqeue coeemrqeeu coeemrquee
coeemrquee coeemrqeue coeemrqeeu coeemruqee coeemruqee coeemrueqe coeemrueeq coeemrueeq coeemrueqe coeemreque coeemreqeu
coeemreuqe coeemreueq coeemreeuq coeemreequ coeemerque coeemerqeu coeemeruqe coeemerueq coeemereuq coeemerequ coeemeqrue
coeemeqreu coeemequre coeemequer coeemeqeur coeemeqeru coeemeuqre coeemeuqer coeemeurqe coeemeureq coeemeuerq coeemeueqr
coeemeequr coeemeeqru coeemeeuqr coeemeeurq coeemeeruq coeemeerqu coeemqerue coeemqereu coeemqeure coeemqeuer coeemqeeur
coeemqeeru coeemqreue coeemqreeu coeemqruee coeemqruee coeemqreue coeemqreeu coeemquree coeemquree coeemquere coeemqueer
coeemqueer coeemquere coeemqerue coeemqereu coeemqeure coeemqeuer coeemqeeur coeemqeeru coeemueqre coeemueqer coeemuerqe
coeemuereq coeemueerq coeemueeqr coeemuqere coeemuqeer coeemuqree coeemuqree coeemuqere coeemuqeer coeemurqee coeemurqee
coeemureqe coeemureeq coeemureeq coeemureqe coeemueqre coeemueqer coeemuerqe coeemuereq coeemueerq coeemueeqr coeemeequr
coeemeeqru coeemeeuqr coeemeeurq coeemeeruq coeemeerqu coeemeqeur coeemeqeru coeemequer coeemequre coeemeqrue coeemeqreu
coeemeuqer coeemeuqre coeemeueqr coeemeuerq coeemeureq coeemeurqe coeemerque coeemerqeu coeemeruqe coeemerueq coeemereuq
coeemerequ coeeqrmeue coeeqrmeeu coeeqrmuee coeeqrmuee coeeqrmeue coeeqrmeeu coeeqremue coeeqremeu coeeqreume coeeqreuem
coeeqreeum coeeqreemu coeeqrueme coeeqrueem coeeqrumee coeeqrumee coeeqrueme coeeqrueem coeeqreeum coeeqreemu coeeqreuem
coeeqreume coeeqremue coeeqremeu coeeqmreue coeeqmreeu coeeqmruee coeeqmruee coeeqmreue coeeqmreeu coeeqmerue coeeqmereu
coeeqmeure coeeqmeuer coeeqmeeur coeeqmeeru coeeqmuere coeeqmueer coeeqmuree coeeqmuree coeeqmuere coeeqmueer coeeqmeeur
coeeqmeeru coeeqmeuer coeeqmeure coeeqmerue coeeqmereu coeeqemrue coeeqemreu coeeqemure coeeqemuer coeeqemeur coeeqemeru
coeeqermue coeeqermeu coeeqerume coeeqeruem coeeqereum coeeqeremu coeeqeurme coeeqeurem coeeqeumre coeeqeumer coeeqeuemr
coeeqeuerm coeeqeerum coeeqeermu coeeqeeurm coeeqeeumr coeeqeemur coeeqeemru coeequmere coeequmeer coeequmree coeequmree
coeequmere coeequmeer coeequemre coeequemer coeequerme coeequerem coeequeerm coeequeemr coeequreme coeequreem coeequrmee
coeequrmee coeequreme coeequreem coeequeerm coeequeemr coeequerem coeequerme coeequemre coeequemer coeeqemeur coeeqemeru
coeeqemuer coeeqemure coeeqemrue coeeqemreu coeeqeemur coeeqeemru coeeqeeumr coeeqeeurm coeeqeerum coeeqeermu coeeqeuemr
coeeqeuerm coeeqeumer coeeqeumre coeeqeurme coeeqeurem coeeqereum coeeqeremu coeeqeruem coeeqerume coeeqermue coeeqermeu
coeeurmqee coeeurmqee coeeurmeqe coeeurmeeq coeeurmeeq coeeurmeqe coeeurqmee coeeurqmee coeeurqeme coeeurqeem coeeurqeem
coeeurqeme coeeureqme coeeureqem coeeuremqe coeeuremeq coeeureemq coeeureeqm coeeureqem coeeureqme coeeureeqm coeeureemq
coeeuremeq coeeuremqe coeeumrqee coeeumrqee coeeumreqe coeeumreeq coeeumreeq coeeumreqe coeeumqree coeeumqree coeeumqere
coeeumqeer coeeumqeer coeeumqere coeeumeqre coeeumeqer coeeumerqe coeeumereq coeeumeerq coeeumeeqr coeeumeqer coeeumeqre
coeeumeeqr coeeumeerq coeeumereq coeeumerqe coeeuqmree coeeuqmree coeeuqmere coeeuqmeer coeeuqmeer coeeuqmere coeeuqrmee
coeeuqrmee coeeuqreme coeeuqreem coeeuqreem coeeuqreme coeeuqerme coeeuqerem coeeuqemre coeeuqemer coeeuqeemr coeeuqeerm
coeeuqerem coeeuqerme coeeuqeerm coeeuqeemr coeeuqemer coeeuqemre coeeuemqre coeeuemqer coeeuemrqe coeeuemreq coeeuemerq
coeeuemeqr coeeueqmre coeeueqmer coeeueqrme coeeueqrem coeeueqerm coeeueqemr coeeuerqme coeeuerqem coeeuermqe coeeuermeq
coeeueremq coeeuereqm coeeueeqrm coeeueeqmr coeeueerqm coeeueermq coeeueemrq coeeueemqr coeeuemqer coeeuemqre coeeuemeqr
coeeuemerq coeeuemreq coeeuemrqe coeeueqmer coeeueqmre coeeueqemr coeeueqerm coeeueqrem coeeueqrme coeeueeqmr coeeueeqrm
coeeueemqr coeeueemrq coeeueermq coeeueerqm coeeuerqem coeeuerqme coeeuereqm coeeueremq coeeuermeq coeeuermqe coeeermque
coeeermqeu coeeermuqe coeeermueq coeeermeuq coeeermequ coeeerqmue coeeerqmeu coeeerqume coeeerquem coeeerqeum coeeerqemu
coeeeruqme coeeeruqem coeeerumqe coeeerumeq coeeeruemq coeeerueqm coeeerequm coeeereqmu coeeereuqm coeeereumq coeeeremuq
coeeeremqu coeeemrque coeeemrqeu coeeemruqe coeeemrueq coeeemreuq coeeemrequ coeeemqrue coeeemqreu coeeemqure coeeemquer
coeeemqeur coeeemqeru coeeemuqre coeeemuqer coeeemurqe coeeemureq coeeemuerq coeeemueqr coeeemequr coeeemeqru coeeemeuqr
coeeemeurq coeeemeruq coeeemerqu coeeeqmrue coeeeqmreu coeeeqmure coeeeqmuer coeeeqmeur coeeeqmeru coeeeqrmue coeeeqrmeu
coeeeqrume coeeeqruem coeeeqreum coeeeqremu coeeequrme coeeequrem coeeequmre coeeequmer coeeequemr coeeequerm coeeeqerum
coeeeqermu coeeeqeurm coeeeqeumr coeeeqemur coeeeqemru coeeeumqre coeeeumqer coeeeumrqe coeeeumreq coeeeumerq coeeeumeqr
coeeeuqmre coeeeuqmer coeeeuqrme coeeeuqrem coeeeuqerm coeeeuqemr coeeeurqme coeeeurqem coeeeurmqe coeeeurmeq coeeeuremq
coeeeureqm coeeeueqrm coeeeueqmr coeeeuerqm coeeeuermq coeeeuemrq coeeeuemqr coeeeemqur coeeeemqru coeeeemuqr coeeeemurq
coeeeemruq coeeeemrqu coeeeeqmur coeeeeqmru coeeeequmr coeeeequrm coeeeeqrum coeeeeqrmu coeeeeuqmr coeeeeuqrm coeeeeumqr
coeeeeumrq coeeeeurmq coeeeeurqm coeeeerqum coeeeerqmu coeeeeruqm coeeeerumq coeeeermuq coeeeermqu coeqeremue coeqeremeu
coeqereume coeqereuem coeqereeum coeqereemu coeqermeue coeqermeeu coeqermuee coeqermuee coeqermeue coeqermeeu coeqerumee
coeqerumee coeqerueme coeqerueem coeqerueem coeqerueme coeqeremue coeqeremeu coeqereume coeqereuem coeqereeum coeqereemu
coeqeermue coeqeermeu coeqeerume coeqeeruem coeqeereum coeqeeremu coeqeemrue coeqeemreu coeqeemure coeqeemuer coeqeemeur
coeqeemeru coeqeeumre coeqeeumer coeqeeurme coeqeeurem coeqeeuerm coeqeeuemr coeqeeemur coeqeeemru coeqeeeumr coeqeeeurm
coeqeeerum coeqeeermu coeqemerue coeqemereu coeqemeure coeqemeuer coeqemeeur coeqemeeru coeqemreue coeqemreeu coeqemruee
coeqemruee coeqemreue coeqemreeu coeqemuree coeqemuree coeqemuere coeqemueer coeqemueer coeqemuere coeqemerue coeqemereu
coeqemeure coeqemeuer coeqemeeur coeqemeeru coeqeuemre coeqeuemer coeqeuerme coeqeuerem coeqeueerm coeqeueemr coeqeumere
coeqeumeer coeqeumree coeqeumree coeqeumere coeqeumeer coeqeurmee coeqeurmee coeqeureme coeqeureem coeqeureem coeqeureme
coeqeuemre coeqeuemer coeqeuerme coeqeuerem coeqeueerm coeqeueemr coeqeeemur coeqeeemru coeqeeeumr coeqeeeurm coeqeeerum
coeqeeermu coeqeemeur coeqeemeru coeqeemuer coeqeemure coeqeemrue coeqeemreu coeqeeumer coeqeeumre coeqeeuemr coeqeeuerm
coeqeeurem coeqeeurme coeqeermue coeqeermeu coeqeerume coeqeeruem coeqeereum coeqeeremu coeqreemue coeqreemeu coeqreeume
coeqreeuem coeqreeeum coeqreeemu coeqremeue coeqremeeu coeqremuee coeqremuee coeqremeue coeqremeeu coeqreumee coeqreumee
coeqreueme coeqreueem coeqreueem coeqreueme coeqreemue coeqreemeu coeqreeume coeqreeuem coeqreeeum coeqreeemu coeqreemue
coeqreemeu coeqreeume coeqreeuem coeqreeeum coeqreeemu coeqremeue coeqremeeu coeqremuee coeqremuee coeqremeue coeqremeeu
coeqreumee coeqreumee coeqreueme coeqreueem coeqreueem coeqreueme coeqreemue coeqreemeu coeqreeume coeqreeuem coeqreeeum
coeqreeemu coeqrmeeue coeqrmeeeu coeqrmeuee coeqrmeuee coeqrmeeue coeqrmeeeu coeqrmeeue coeqrmeeeu coeqrmeuee coeqrmeuee
coeqrmeeue coeqrmeeeu coeqrmueee coeqrmueee coeqrmueee coeqrmueee coeqrmueee coeqrmueee coeqrmeeue coeqrmeeeu coeqrmeuee
coeqrmeuee coeqrmeeue coeqrmeeeu coeqruemee coeqruemee coeqrueeme coeqrueeem coeqrueeem coeqrueeme coeqrumeee coeqrumeee
coeqrumeee coeqrumeee coeqrumeee coeqrumeee coeqruemee coeqruemee coeqrueeme coeqrueeem coeqrueeem coeqrueeme coeqruemee
coeqruemee coeqrueeme coeqrueeem coeqrueeem coeqrueeme coeqreemue coeqreemeu coeqreeume coeqreeuem coeqreeeum coeqreeemu
coeqremeue coeqremeeu coeqremuee coeqremuee coeqremeue coeqremeeu coeqreumee coeqreumee coeqreueme coeqreueem coeqreueem
coeqreueme coeqreemue coeqreemeu coeqreeume coeqreeuem coeqreeeum coeqreeemu coeqeremue coeqeremeu coeqereume coeqereuem
coeqereeum coeqereemu coeqermeue coeqermeeu coeqermuee coeqermuee coeqermeue coeqermeeu coeqerumee coeqerumee coeqerueme
coeqerueem coeqerueem coeqerueme coeqeremue coeqeremeu coeqereume coeqereuem coeqereeum coeqereemu coeqeermue coeqeermeu
coeqeerume coeqeeruem coeqeereum coeqeeremu coeqeemrue coeqeemreu coeqeemure coeqeemuer coeqeemeur coeqeemeru coeqeeumre
coeqeeumer coeqeeurme coeqeeurem coeqeeuerm coeqeeuemr coeqeeemur coeqeeemru coeqeeeumr coeqeeeurm coeqeeerum coeqeeermu
coeqemerue coeqemereu coeqemeure coeqemeuer coeqemeeur coeqemeeru coeqemreue coeqemreeu coeqemruee coeqemruee coeqemreue
coeqemreeu coeqemuree coeqemuree coeqemuere coeqemueer coeqemueer coeqemuere coeqemerue coeqemereu coeqemeure coeqemeuer
coeqemeeur coeqemeeru coeqeuemre coeqeuemer coeqeuerme coeqeuerem coeqeueerm coeqeueemr coeqeumere coeqeumeer coeqeumree
coeqeumree coeqeumere coeqeumeer coeqeurmee coeqeurmee coeqeureme coeqeureem coeqeureem coeqeureme coeqeuemre coeqeuemer
coeqeuerme coeqeuerem coeqeueerm coeqeueemr coeqeeemur coeqeeemru coeqeeeumr coeqeeeurm coeqeeerum coeqeeermu coeqeemeur
coeqeemeru coeqeemuer coeqeemure coeqeemrue coeqeemreu coeqeeumer coeqeeumre coeqeeuemr coeqeeuerm coeqeeurem coeqeeurme
coeqeermue coeqeermeu coeqeerume coeqeeruem coeqeereum coeqeeremu coeqmreeue coeqmreeeu coeqmreuee coeqmreuee coeqmreeue
coeqmreeeu coeqmreeue coeqmreeeu coeqmreuee coeqmreuee coeqmreeue coeqmreeeu coeqmrueee coeqmrueee coeqmrueee coeqmrueee
coeqmrueee coeqmrueee coeqmreeue coeqmreeeu coeqmreuee coeqmreuee coeqmreeue coeqmreeeu coeqmereue coeqmereeu coeqmeruee
coeqmeruee coeqmereue coeqmereeu coeqmeerue coeqmeereu coeqmeeure coeqmeeuer coeqmeeeur coeqmeeeru coeqmeuere coeqmeueer
coeqmeuree coeqmeuree coeqmeuere coeqmeueer coeqmeeeur coeqmeeeru coeqmeeuer coeqmeeure coeqmeerue coeqmeereu coeqmeerue
coeqmeereu coeqmeeure coeqmeeuer coeqmeeeur coeqmeeeru coeqmereue coeqmereeu coeqmeruee coeqmeruee coeqmereue coeqmereeu
coeqmeuree coeqmeuree coeqmeuere coeqmeueer coeqmeueer coeqmeuere coeqmeerue coeqmeereu coeqmeeure coeqmeeuer coeqmeeeur
coeqmeeeru coeqmueere coeqmueeer coeqmueree coeqmueree coeqmueere coeqmueeer coeqmueere coeqmueeer coeqmueree coeqmueree
coeqmueere coeqmueeer coeqmureee coeqmureee coeqmureee coeqmureee coeqmureee coeqmureee coeqmueere coeqmueeer coeqmueree
coeqmueree coeqmueere coeqmueeer coeqmeeeur coeqmeeeru coeqmeeuer coeqmeeure coeqmeerue coeqmeereu coeqmeeeur coeqmeeeru
coeqmeeuer coeqmeeure coeqmeerue coeqmeereu coeqmeueer coeqmeuere coeqmeueer coeqmeuere coeqmeuree coeqmeuree coeqmereue
coeqmereeu coeqmeruee coeqmeruee coeqmereue coeqmereeu coequremee coequremee coequreeme coequreeem coequreeem coequreeme
coequrmeee coequrmeee coequrmeee coequrmeee coequrmeee coequrmeee coequremee coequremee coequreeme coequreeem coequreeem
coequreeme coequremee coequremee coequreeme coequreeem coequreeem coequreeme coequermee coequermee coequereme coequereem
coequereem coequereme coequemree coequemree coequemere coequemeer coequemeer coequemere coequeemre coequeemer coequeerme
coequeerem coequeeerm coequeeemr coequeemer coequeemre coequeeemr coequeeerm coequeerem coequeerme coequmeree coequmeree
coequmeere coequmeeer coequmeeer coequmeere coequmreee coequmreee coequmreee coequmreee coequmreee coequmreee coequmeree
coequmeree coequmeere coequmeeer coequmeeer coequmeere coequmeree coequmeree coequmeere coequmeeer coequmeeer coequmeere
coequeemre coequeemer coequeerme coequeerem coequeeerm coequeeemr coequemere coequemeer coequemree coequemree coequemere
coequemeer coequermee coequermee coequereme coequereem coequereem coequereme coequeemre coequeemer coequeerme coequeerem
coequeeerm coequeeemr coequeemer coequeemre coequeeemr coequeeerm coequeerem coequeerme coequemeer coequemere coequemeer
coequemere coequemree coequemree coequeemer coequeemre coequeeemr coequeeerm coequeerem coequeerme coequermee coequermee
coequereme coequereem coequereem coequereme coeqeremue coeqeremeu coeqereume coeqereuem coeqereeum coeqereemu coeqermeue
coeqermeeu coeqermuee coeqermuee coeqermeue coeqermeeu coeqerumee coeqerumee coeqerueme coeqerueem coeqerueem coeqerueme
coeqeremue coeqeremeu coeqereume coeqereuem coeqereeum coeqereemu coeqeermue coeqeermeu coeqeerume coeqeeruem coeqeereum
coeqeeremu coeqeemrue coeqeemreu coeqeemure coeqeemuer coeqeemeur coeqeemeru coeqeeumre coeqeeumer coeqeeurme coeqeeurem
coeqeeuerm coeqeeuemr coeqeeemur coeqeeemru coeqeeeumr coeqeeeurm coeqeeerum coeqeeermu coeqemerue coeqemereu coeqemeure
coeqemeuer coeqemeeur coeqemeeru coeqemreue coeqemreeu coeqemruee coeqemruee coeqemreue coeqemreeu coeqemuree coeqemuree
coeqemuere coeqemueer coeqemueer coeqemuere coeqemerue coeqemereu coeqemeure coeqemeuer coeqemeeur coeqemeeru coeqeuemre
coeqeuemer coeqeuerme coeqeuerem coeqeueerm coeqeueemr coeqeumere coeqeumeer coeqeumree coeqeumree coeqeumere coeqeumeer
coeqeurmee coeqeurmee coeqeureme coeqeureem coeqeureem coeqeureme coeqeuemre coeqeuemer coeqeuerme coeqeuerem coeqeueerm
coeqeueemr coeqeeemur coeqeeemru coeqeeeumr coeqeeeurm coeqeeerum coeqeeermu coeqeemeur coeqeemeru coeqeemuer coeqeemure
coeqeemrue coeqeemreu coeqeeumer coeqeeumre coeqeeuemr coeqeeuerm coeqeeurem coeqeeurme coeqeermue coeqeermeu coeqeerume
coeqeeruem coeqeereum coeqeeremu coeuereqme coeuereqem coeueremqe coeueremeq coeuereemq coeuereeqm coeuerqeme coeuerqeem
coeuerqmee coeuerqmee coeuerqeme coeuerqeem coeuermqee coeuermqee coeuermeqe coeuermeeq coeuermeeq coeuermeqe coeuereqme
coeuereqem coeueremqe coeueremeq coeuereemq coeuereeqm coeueerqme coeueerqem coeueermqe coeueermeq coeueeremq coeueereqm
coeueeqrme coeueeqrem coeueeqmre coeueeqmer coeueeqemr coeueeqerm coeueemqre coeueemqer coeueemrqe coeueemreq coeueemerq
coeueemeqr coeueeeqmr coeueeeqrm coeueeemqr coeueeemrq coeueeermq coeueeerqm coeueqerme coeueqerem coeueqemre coeueqemer
coeueqeemr coeueqeerm coeueqreme coeueqreem coeueqrmee coeueqrmee coeueqreme coeueqreem coeueqmree coeueqmree coeueqmere
coeueqmeer coeueqmeer coeueqmere coeueqerme coeueqerem coeueqemre coeueqemer coeueqeemr coeueqeerm coeuemeqre coeuemeqer
coeuemerqe coeuemereq coeuemeerq coeuemeeqr coeuemqere coeuemqeer coeuemqree coeuemqree coeuemqere coeuemqeer coeuemrqee
coeuemrqee coeuemreqe coeuemreeq coeuemreeq coeuemreqe coeuemeqre coeuemeqer coeuemerqe coeuemereq coeuemeerq coeuemeeqr
coeueeeqmr coeueeeqrm coeueeemqr coeueeemrq coeueeermq coeueeerqm coeueeqemr coeueeqerm coeueeqmer coeueeqmre coeueeqrme
coeueeqrem coeueemqer coeueemqre coeueemeqr coeueemerq coeueemreq coeueemrqe coeueerqme coeueerqem coeueermqe coeueermeq
coeueeremq coeueereqm coeureeqme coeureeqem coeureemqe coeureemeq coeureeemq coeureeeqm coeureqeme coeureqeem coeureqmee
coeureqmee coeureqeme coeureqeem coeuremqee coeuremqee coeuremeqe coeuremeeq coeuremeeq coeuremeqe coeureeqme coeureeqem
coeureemqe coeureemeq coeureeemq coeureeeqm coeureeqme coeureeqem coeureemqe coeureemeq coeureeemq coeureeeqm coeureqeme
coeureqeem coeureqmee coeureqmee coeureqeme coeureqeem coeuremqee coeuremqee coeuremeqe coeuremeeq coeuremeeq coeuremeqe
coeureeqme coeureeqem coeureemqe coeureemeq coeureeemq coeureeeqm coeurqeeme coeurqeeem coeurqemee coeurqemee coeurqeeme
coeurqeeem coeurqeeme coeurqeeem coeurqemee coeurqemee coeurqeeme coeurqeeem coeurqmeee coeurqmeee coeurqmeee coeurqmeee
coeurqmeee coeurqmeee coeurqeeme coeurqeeem coeurqemee coeurqemee coeurqeeme coeurqeeem coeurmeqee coeurmeqee coeurmeeqe
coeurmeeeq coeurmeeeq coeurmeeqe coeurmqeee coeurmqeee coeurmqeee coeurmqeee coeurmqeee coeurmqeee coeurmeqee coeurmeqee
coeurmeeqe coeurmeeeq coeurmeeeq coeurmeeqe coeurmeqee coeurmeqee coeurmeeqe coeurmeeeq coeurmeeeq coeurmeeqe coeureeqme
coeureeqem coeureemqe coeureemeq coeureeemq coeureeeqm coeureqeme coeureqeem coeureqmee coeureqmee coeureqeme coeureqeem
coeuremqee coeuremqee coeuremeqe coeuremeeq coeuremeeq coeuremeqe coeureeqme coeureeqem coeureemqe coeureemeq coeureeemq
coeureeeqm coeuereqme coeuereqem coeueremqe coeueremeq coeuereemq coeuereeqm coeuerqeme coeuerqeem coeuerqmee coeuerqmee
coeuerqeme coeuerqeem coeuermqee coeuermqee coeuermeqe coeuermeeq coeuermeeq coeuermeqe coeuereqme coeuereqem coeueremqe
coeueremeq coeuereemq coeuereeqm coeueerqme coeueerqem coeueermqe coeueermeq coeueeremq coeueereqm coeueeqrme coeueeqrem
coeueeqmre coeueeqmer coeueeqemr coeueeqerm coeueemqre coeueemqer coeueemrqe coeueemreq coeueemerq coeueemeqr coeueeeqmr
coeueeeqrm coeueeemqr coeueeemrq coeueeermq coeueeerqm coeueqerme coeueqerem coeueqemre coeueqemer coeueqeemr coeueqeerm
coeueqreme coeueqreem coeueqrmee coeueqrmee coeueqreme coeueqreem coeueqmree coeueqmree coeueqmere coeueqmeer coeueqmeer
coeueqmere coeueqerme coeueqerem coeueqemre coeueqemer coeueqeemr coeueqeerm coeuemeqre coeuemeqer coeuemerqe coeuemereq
coeuemeerq coeuemeeqr coeuemqere coeuemqeer coeuemqree coeuemqree coeuemqere coeuemqeer coeuemrqee coeuemrqee coeuemreqe
coeuemreeq coeuemreeq coeuemreqe coeuemeqre coeuemeqer coeuemerqe coeuemereq coeuemeerq coeuemeeqr coeueeeqmr coeueeeqrm
coeueeemqr coeueeemrq coeueeermq coeueeerqm coeueeqemr coeueeqerm coeueeqmer coeueeqmre coeueeqrme coeueeqrem coeueemqer
coeueemqre coeueemeqr coeueemerq coeueemreq coeueemrqe coeueerqme coeueerqem coeueermqe coeueermeq coeueeremq coeueereqm
coeuqreeme coeuqreeem coeuqremee coeuqremee coeuqreeme coeuqreeem coeuqreeme coeuqreeem coeuqremee coeuqremee coeuqreeme
coeuqreeem coeuqrmeee coeuqrmeee coeuqrmeee coeuqrmeee coeuqrmeee coeuqrmeee coeuqreeme coeuqreeem coeuqremee coeuqremee
coeuqreeme coeuqreeem coeuqereme coeuqereem coeuqermee coeuqermee coeuqereme coeuqereem coeuqeerme coeuqeerem coeuqeemre
coeuqeemer coeuqeeemr coeuqeeerm coeuqemere coeuqemeer coeuqemree coeuqemree coeuqemere coeuqemeer coeuqeeemr coeuqeeerm
coeuqeemer coeuqeemre coeuqeerme coeuqeerem coeuqeerme coeuqeerem coeuqeemre coeuqeemer coeuqeeemr coeuqeeerm coeuqereme
coeuqereem coeuqermee coeuqermee coeuqereme coeuqereem coeuqemree coeuqemree coeuqemere coeuqemeer coeuqemeer coeuqemere
coeuqeerme coeuqeerem coeuqeemre coeuqeemer coeuqeeemr coeuqeeerm coeuqmeere coeuqmeeer coeuqmeree coeuqmeree coeuqmeere
coeuqmeeer coeuqmeere coeuqmeeer coeuqmeree coeuqmeree coeuqmeere coeuqmeeer coeuqmreee coeuqmreee coeuqmreee coeuqmreee
coeuqmreee coeuqmreee coeuqmeere coeuqmeeer coeuqmeree coeuqmeree coeuqmeere coeuqmeeer coeuqeeemr coeuqeeerm coeuqeemer
coeuqeemre coeuqeerme coeuqeerem coeuqeeemr coeuqeeerm coeuqeemer coeuqeemre coeuqeerme coeuqeerem coeuqemeer coeuqemere
coeuqemeer coeuqemere coeuqemree coeuqemree coeuqereme coeuqereem coeuqermee coeuqermee coeuqereme coeuqereem coeumreqee
coeumreqee coeumreeqe coeumreeeq coeumreeeq coeumreeqe coeumrqeee coeumrqeee coeumrqeee coeumrqeee coeumrqeee coeumrqeee
coeumreqee coeumreqee coeumreeqe coeumreeeq coeumreeeq coeumreeqe coeumreqee coeumreqee coeumreeqe coeumreeeq coeumreeeq
coeumreeqe coeumerqee coeumerqee coeumereqe coeumereeq coeumereeq coeumereqe coeumeqree coeumeqree coeumeqere coeumeqeer
coeumeqeer coeumeqere coeumeeqre coeumeeqer coeumeerqe coeumeereq coeumeeerq coeumeeeqr coeumeeqer coeumeeqre coeumeeeqr
coeumeeerq coeumeereq coeumeerqe coeumqeree coeumqeree coeumqeere coeumqeeer coeumqeeer coeumqeere coeumqreee coeumqreee
coeumqreee coeumqreee coeumqreee coeumqreee coeumqeree coeumqeree coeumqeere coeumqeeer coeumqeeer coeumqeere coeumqeree
coeumqeree coeumqeere coeumqeeer coeumqeeer coeumqeere coeumeeqre coeumeeqer coeumeerqe coeumeereq coeumeeerq coeumeeeqr
coeumeqere coeumeqeer coeumeqree coeumeqree coeumeqere coeumeqeer coeumerqee coeumerqee coeumereqe coeumereeq coeumereeq
coeumereqe coeumeeqre coeumeeqer coeumeerqe coeumeereq coeumeeerq coeumeeeqr coeumeeqer coeumeeqre coeumeeeqr coeumeeerq
coeumeereq coeumeerqe coeumeqeer coeumeqere coeumeqeer coeumeqere coeumeqree coeumeqree coeumeeqer coeumeeqre coeumeeeqr
coeumeeerq coeumeereq coeumeerqe coeumerqee coeumerqee coeumereqe coeumereeq coeumereeq coeumereqe coeuereqme coeuereqem
coeueremqe coeueremeq coeuereemq coeuereeqm coeuerqeme coeuerqeem coeuerqmee coeuerqmee coeuerqeme coeuerqeem coeuermqee
coeuermqee coeuermeqe coeuermeeq coeuermeeq coeuermeqe coeuereqme coeuereqem coeueremqe coeueremeq coeuereemq coeuereeqm
coeueerqme coeueerqem coeueermqe coeueermeq coeueeremq coeueereqm coeueeqrme coeueeqrem coeueeqmre coeueeqmer coeueeqemr
coeueeqerm coeueemqre coeueemqer coeueemrqe coeueemreq coeueemerq coeueemeqr coeueeeqmr coeueeeqrm coeueeemqr coeueeemrq
coeueeermq coeueeerqm coeueqerme coeueqerem coeueqemre coeueqemer coeueqeemr coeueqeerm coeueqreme coeueqreem coeueqrmee
coeueqrmee coeueqreme coeueqreem coeueqmree coeueqmree coeueqmere coeueqmeer coeueqmeer coeueqmere coeueqerme coeueqerem
coeueqemre coeueqemer coeueqeemr coeueqeerm coeuemeqre coeuemeqer coeuemerqe coeuemereq coeuemeerq coeuemeeqr coeuemqere
coeuemqeer coeuemqree coeuemqree coeuemqere coeuemqeer coeuemrqee coeuemrqee coeuemreqe coeuemreeq coeuemreeq coeuemreqe
coeuemeqre coeuemeqer coeuemerqe coeuemereq coeuemeerq coeuemeeqr coeueeeqmr coeueeeqrm coeueeemqr coeueeemrq coeueeermq
coeueeerqm coeueeqemr coeueeqerm coeueeqmer coeueeqmre coeueeqrme coeueeqrem coeueemqer coeueemqre coeueemeqr coeueemerq
coeueemreq coeueemrqe coeueerqme coeueerqem coeueermqe coeueermeq coeueeremq coeueereqm coeeerequm coeeereqmu coeeereuqm
coeeereumq coeeeremuq coeeeremqu coeeerqeum coeeerqemu coeeerquem coeeerqume coeeerqmue coeeerqmeu coeeeruqem coeeeruqme
coeeerueqm coeeeruemq coeeerumeq coeeerumqe coeeermque coeeermqeu coeeermuqe coeeermueq coeeermeuq coeeermequ coeeeerqum
coeeeerqmu coeeeeruqm coeeeerumq coeeeermuq coeeeermqu coeeeeqrum coeeeeqrmu coeeeequrm coeeeequmr coeeeeqmur coeeeeqmru
coeeeeuqrm coeeeeuqmr coeeeeurqm coeeeeurmq coeeeeumrq coeeeeumqr coeeeemqur coeeeemqru coeeeemuqr coeeeemurq coeeeemruq
coeeeemrqu coeeeqerum coeeeqermu coeeeqeurm coeeeqeumr coeeeqemur coeeeqemru coeeeqreum coeeeqremu coeeeqruem coeeeqrume
coeeeqrmue coeeeqrmeu coeeequrem coeeequrme coeeequerm coeeequemr coeeequmer coeeequmre coeeeqmrue coeeeqmreu coeeeqmure
coeeeqmuer coeeeqmeur coeeeqmeru coeeeueqrm coeeeueqmr coeeeuerqm coeeeuermq coeeeuemrq coeeeuemqr coeeeuqerm coeeeuqemr
coeeeuqrem coeeeuqrme coeeeuqmre coeeeuqmer coeeeurqem coeeeurqme coeeeureqm coeeeuremq coeeeurmeq coeeeurmqe coeeeumqre
coeeeumqer coeeeumrqe coeeeumreq coeeeumerq coeeeumeqr coeeemequr coeeemeqru coeeemeuqr coeeemeurq coeeemeruq coeeemerqu
coeeemqeur coeeemqeru coeeemquer coeeemqure coeeemqrue coeeemqreu coeeemuqer coeeemuqre coeeemueqr coeeemuerq coeeemureq
coeeemurqe coeeemrque coeeemrqeu coeeemruqe coeeemrueq coeeemreuq coeeemrequ coeereequm coeereeqmu coeereeuqm coeereeumq
coeereemuq coeereemqu coeereqeum coeereqemu coeerequem coeerequme coeereqmue coeereqmeu coeereuqem coeereuqme coeereueqm
coeereuemq coeereumeq coeereumqe coeeremque coeeremqeu coeeremuqe coeeremueq coeeremeuq coeeremequ coeereequm coeereeqmu
coeereeuqm coeereeumq coeereemuq coeereemqu coeereqeum coeereqemu coeerequem coeerequme coeereqmue coeereqmeu coeereuqem
coeereuqme coeereueqm coeereuemq coeereumeq coeereumqe coeeremque coeeremqeu coeeremuqe coeeremueq coeeremeuq coeeremequ
coeerqeeum coeerqeemu coeerqeuem coeerqeume coeerqemue coeerqemeu coeerqeeum coeerqeemu coeerqeuem coeerqeume coeerqemue
coeerqemeu coeerqueem coeerqueme coeerqueem coeerqueme coeerqumee coeerqumee coeerqmeue coeerqmeeu coeerqmuee coeerqmuee
coeerqmeue coeerqmeeu coeerueqem coeerueqme coeerueeqm coeerueemq coeeruemeq coeeruemqe coeeruqeem coeeruqeme coeeruqeem
coeeruqeme coeeruqmee coeeruqmee coeerueqem coeerueqme coeerueeqm coeerueemq coeeruemeq coeeruemqe coeerumqee coeerumqee
coeerumeqe coeerumeeq coeerumeeq coeerumeqe coeermeque coeermeqeu coeermeuqe coeermeueq coeermeeuq coeermeequ coeermqeue
coeermqeeu coeermquee coeermquee coeermqeue coeermqeeu coeermuqee coeermuqee coeermueqe coeermueeq coeermueeq coeermueqe
coeermeque coeermeqeu coeermeuqe coeermeueq coeermeeuq coeermeequ coeeerequm coeeereqmu coeeereuqm coeeereumq coeeeremuq
coeeeremqu coeeerqeum coeeerqemu coeeerquem coeeerqume coeeerqmue coeeerqmeu coeeeruqem coeeeruqme coeeerueqm coeeeruemq
coeeerumeq coeeerumqe coeeermque coeeermqeu coeeermuqe coeeermueq coeeermeuq coeeermequ coeeeerqum coeeeerqmu coeeeeruqm
coeeeerumq coeeeermuq coeeeermqu coeeeeqrum coeeeeqrmu coeeeequrm coeeeequmr coeeeeqmur coeeeeqmru coeeeeuqrm coeeeeuqmr
coeeeeurqm coeeeeurmq coeeeeumrq coeeeeumqr coeeeemqur coeeeemqru coeeeemuqr coeeeemurq coeeeemruq coeeeemrqu coeeeqerum
coeeeqermu coeeeqeurm coeeeqeumr coeeeqemur coeeeqemru coeeeqreum coeeeqremu coeeeqruem coeeeqrume coeeeqrmue coeeeqrmeu
coeeequrem coeeequrme coeeequerm coeeequemr coeeequmer coeeequmre coeeeqmrue coeeeqmreu coeeeqmure coeeeqmuer coeeeqmeur
coeeeqmeru coeeeueqrm coeeeueqmr coeeeuerqm coeeeuermq coeeeuemrq coeeeuemqr coeeeuqerm coeeeuqemr coeeeuqrem coeeeuqrme
coeeeuqmre coeeeuqmer coeeeurqem coeeeurqme coeeeureqm coeeeuremq coeeeurmeq coeeeurmqe coeeeumqre coeeeumqer coeeeumrqe
coeeeumreq coeeeumerq coeeeumeqr coeeemequr coeeemeqru coeeemeuqr coeeemeurq coeeemeruq coeeemerqu coeeemqeur coeeemqeru
coeeemquer coeeemqure coeeemqrue coeeemqreu coeeemuqer coeeemuqre coeeemueqr coeeemuerq coeeemureq coeeemurqe coeeemrque
coeeemrqeu coeeemruqe coeeemrueq coeeemreuq coeeemrequ coeeqreeum coeeqreemu coeeqreuem coeeqreume coeeqremue coeeqremeu
coeeqreeum coeeqreemu coeeqreuem coeeqreume coeeqremue coeeqremeu coeeqrueem coeeqrueme coeeqrueem coeeqrueme coeeqrumee
coeeqrumee coeeqrmeue coeeqrmeeu coeeqrmuee coeeqrmuee coeeqrmeue coeeqrmeeu coeeqereum coeeqeremu coeeqeruem coeeqerume
coeeqermue coeeqermeu coeeqeerum coeeqeermu coeeqeeurm coeeqeeumr coeeqeemur coeeqeemru coeeqeuerm coeeqeuemr coeeqeurem
coeeqeurme coeeqeumre coeeqeumer coeeqemeur coeeqemeru coeeqemuer coeeqemure coeeqemrue coeeqemreu coeeqeerum coeeqeermu
coeeqeeurm coeeqeeumr coeeqeemur coeeqeemru coeeqereum coeeqeremu coeeqeruem coeeqerume coeeqermue coeeqermeu coeeqeurem
coeeqeurme coeeqeuerm coeeqeuemr coeeqeumer coeeqeumre coeeqemrue coeeqemreu coeeqemure coeeqemuer coeeqemeur coeeqemeru
coeequeerm coeequeemr coeequerem coeequerme coeequemre coeequemer coeequeerm coeequeemr coeequerem coeequerme coeequemre
coeequemer coeequreem coeequreme coeequreem coeequreme coeequrmee coeequrmee coeequmere coeequmeer coeequmree coeequmree
coeequmere coeequmeer coeeqmeeur coeeqmeeru coeeqmeuer coeeqmeure coeeqmerue coeeqmereu coeeqmeeur coeeqmeeru coeeqmeuer
coeeqmeure coeeqmerue coeeqmereu coeeqmueer coeeqmuere coeeqmueer coeeqmuere coeeqmuree coeeqmuree coeeqmreue coeeqmreeu
coeeqmruee coeeqmruee coeeqmreue coeeqmreeu coeeureqem coeeureqme coeeureeqm coeeureemq coeeuremeq coeeuremqe coeeurqeem
coeeurqeme coeeurqeem coeeurqeme coeeurqmee coeeurqmee coeeureqem coeeureqme coeeureeqm coeeureemq coeeuremeq coeeuremqe
coeeurmqee coeeurmqee coeeurmeqe coeeurmeeq coeeurmeeq coeeurmeqe coeeuerqem coeeuerqme coeeuereqm coeeueremq coeeuermeq
coeeuermqe coeeueqrem coeeueqrme coeeueqerm coeeueqemr coeeueqmer coeeueqmre coeeueeqrm coeeueeqmr coeeueerqm coeeueermq
coeeueemrq coeeueemqr coeeuemqer coeeuemqre coeeuemeqr coeeuemerq coeeuemreq coeeuemrqe coeeuqerem coeeuqerme coeeuqeerm
coeeuqeemr coeeuqemer coeeuqemre coeeuqreem coeeuqreme coeeuqreem coeeuqreme coeeuqrmee coeeuqrmee coeeuqerem coeeuqerme
coeeuqeerm coeeuqeemr coeeuqemer coeeuqemre coeeuqmree coeeuqmree coeeuqmere coeeuqmeer coeeuqmeer coeeuqmere coeeueeqrm
coeeueeqmr coeeueerqm coeeueermq coeeueemrq coeeueemqr coeeueqerm coeeueqemr coeeueqrem coeeueqrme coeeueqmre coeeueqmer
coeeuerqem coeeuerqme coeeuereqm coeeueremq coeeuermeq coeeuermqe coeeuemqre coeeuemqer coeeuemrqe coeeuemreq coeeuemerq
coeeuemeqr coeeumeqer coeeumeqre coeeumeeqr coeeumeerq coeeumereq coeeumerqe coeeumqeer coeeumqere coeeumqeer coeeumqere
coeeumqree coeeumqree coeeumeqer coeeumeqre coeeumeeqr coeeumeerq coeeumereq coeeumerqe coeeumrqee coeeumrqee coeeumreqe
coeeumreeq coeeumreeq coeeumreqe coeemreque coeemreqeu coeemreuqe coeemreueq coeemreeuq coeemreequ coeemrqeue coeemrqeeu
coeemrquee coeemrquee coeemrqeue coeemrqeeu coeemruqee coeemruqee coeemrueqe coeemrueeq coeemrueeq coeemrueqe coeemreque
coeemreqeu coeemreuqe coeemreueq coeemreeuq coeemreequ coeemerque coeemerqeu coeemeruqe coeemerueq coeemereuq coeemerequ
coeemeqrue coeemeqreu coeemequre coeemequer coeemeqeur coeemeqeru coeemeuqre coeemeuqer coeemeurqe coeemeureq coeemeuerq
coeemeueqr coeemeequr coeemeeqru coeemeeuqr coeemeeurq coeemeeruq coeemeerqu coeemqerue coeemqereu coeemqeure coeemqeuer
coeemqeeur coeemqeeru coeemqreue coeemqreeu coeemqruee coeemqruee coeemqreue coeemqreeu coeemquree coeemquree coeemquere
coeemqueer coeemqueer coeemquere coeemqerue coeemqereu coeemqeure coeemqeuer coeemqeeur coeemqeeru coeemueqre coeemueqer
coeemuerqe coeemuereq coeemueerq coeemueeqr coeemuqere coeemuqeer coeemuqree coeemuqree coeemuqere coeemuqeer coeemurqee
coeemurqee coeemureqe coeemureeq coeemureeq coeemureqe coeemueqre coeemueqer coeemuerqe coeemuereq coeemueerq coeemueeqr
coeemeequr coeemeeqru coeemeeuqr coeemeeurq coeemeeruq coeemeerqu coeemeqeur coeemeqeru coeemequer coeemequre coeemeqrue
coeemeqreu coeemeuqer coeemeuqre coeemeueqr coeemeuerq coeemeureq coeemeurqe coeemerque coeemerqeu coeemeruqe coeemerueq
coeemereuq coeemerequ

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us