easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

ventorium

erogenesis

amberoids

vallot

vanzile

squatted

malovany

ekavi

cessissemque

foedabatisque

dalpe

submucosa

hilgendorf

interweld

spiteproof

hyperthermalgesia

jaegars

symcom


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: clarescas
cipher variations:
dmbsftdbt enctguecu foduhvfdv gpeviwgew hqfwjxhfx
irgxkyigy jshylzjhz ktizmakia lujanbljb mvkbocmkc
nwlcpdnld oxmdqeome pynerfpnf qzofsgqog rapgthrph
sbqhuisqi tcrivjtrj udsjwkusk vetkxlvtl wfulymwum
xgvmznxvn yhwnaoywo zixobpzxp ajypcqayq bkzqdrbzr

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: clarescas
Cipher: xozivhxzh

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: clarescas
Cipher: AAABA ABABA AAAAA BAAAA AABAA BAAAB AAABA AAAAA BAAAB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: clarescas
cipher variations:
dmbsftdbthibandhbdlebivnlbnpabqdxpbxtwbylhtbhxsbgtrxbrfkbwjlfbljgbervjbv
ncbmzfnbfrybuhprbpvubcpzvbzzqbkxjzbjenctguecuijcboeicemfcjwomcoqbcreyqcy
uxczmiuciytchusycsglcxkmgcmkhcfswkcwodcnagocgszcviqscqwvcdqawcaarclykack
foduhvfdvjkdcpfjdfngdkxpndprcdsfzrdzvydanjvdjzudivtzdthmdylnhdnlidgtxldx
pedobhpdhtadwjrtdrxwderbxdbbsdmzlbdlgpeviwgewkledqgkegohelyqoeqsdetgasea
wzebokwekavejwuaeuinezmoieomjehuymeyqfepciqeiubexksuesyxefscyecctenamcem
hqfwjxhfxlmferhlfhpifmzrpfrtefuhbtfbxafcplxflbwfkxvbfvjofanpjfpnkfivznfz
rgfqdjrfjvcfyltvftzyfgtdzfddufobndfnirgxkyigymngfsimgiqjgnasqgsufgvicugc
ybgdqmygmcxglywcgwkpgboqkgqolgjwaogashgreksgkwdgzmuwguazghueageevgpcoego
jshylzjhznohgtjnhjrkhobtrhtvghwjdvhdzchernzhndyhmzxdhxlqhcprlhrpmhkxbphb
tihsflthlxehanvxhvbahivfbhffwhqdpfhpktizmakiaopihukoikslipcusiuwhixkewie
adifsoaioezinayeiymridqsmisqnilycqicujitgmuimyfibowyiwcbijwgciggxireqgiq
lujanbljbpqjivlpjltmjqdvtjvxijylfxjfbejgtpbjpfajobzfjznsjertnjtrojmzdrjd
vkjuhnvjnzgjcpxzjxdcjkxhdjhhyjsfrhjrmvkbocmkcqrkjwmqkmunkrewukwyjkzmgykg
cfkhuqckqgbkpcagkaotkfsuokuspknaeskewlkviowkoahkdqyakyedklyiekiizktgsiks
nwlcpdnldrslkxnrlnvolsfxvlxzklanhzlhdglivrdlrhclqdbhlbpulgtvplvtqlobftlf
xmlwjpxlpbilerzblzfelmzjfljjaluhtjltoxmdqeomestmlyosmowpmtgywmyalmboiami
ehmjwsemsidmrecimcqvmhuwqmwurmpcgumgynmxkqymqcjmfsacmagfmnakgmkkbmviukmu
pynerfpnftunmzptnpxqnuhzxnzbmncpjbnjfinkxtfntjensfdjndrwnivxrnxvsnqdhvnh
zonylrznrdkngtbdnbhgnoblhnllcnwjvlnvqzofsgqoguvonaquoqyroviayoacnodqkcok
gjolyugoukfotgekoesxojwysoywtoreiwoiapozmsaoselohuceocihopcmiommdoxkwmow
rapgthrphvwpobrvprzspwjbzpbdoperldplhkpmzvhpvlgpuhflpftypkxztpzxupsfjxpj
bqpantbptfmpivdfpdjipqdnjpnnepylxnpxsbqhuisqiwxqpcswqsatqxkcaqcepqfsmeqm
ilqnawiqwmhqvigmqguzqlyauqayvqtgkyqkcrqboucqugnqjwegqekjqreokqoofqzmyoqy
tcrivjtrjxyrqdtxrtburyldbrdfqrgtnfrnjmrobxjrxnirwjhnrhvarmzbvrbzwruhlzrl
dsrcpvdrvhorkxfhrflkrsfplrppgranzprzudsjwkuskyzsreuysucvszmecsegrshuogso
knspcyksyojsxkiosiwbsnacwscaxsvimasmetsdqweswipslygisgmlstgqmsqqhsboaqsa
vetkxlvtlzatsfvztvdwtanfdtfhstivphtplotqdzltzpktyljptjxctobdxtdbytwjnbtn
futerxftxjqtmzhjthnmtuhrntrritcpbrtbwfulymwumabutgwauwexubogeugitujwqiuq
mpureamuaqluzmkqukydupceyueczuxkocuogvufsyguykrunaikuionuvisoussjudqcsuc
xgvmznxvnbcvuhxbvxfyvcphfvhjuvkxrjvrnqvsfbnvbrmvanlrvlzevqdfzvfdavylpdvp
hwvgtzhvzlsvobjlvjpovwjtpvttkverdtvdyhwnaoywocdwviycwygzwdqigwikvwlyskws
orwtgcowcsnwbomswmafwregawgebwzmqewqixwhuaiwamtwpckmwkqpwxkuqwuulwfseuwe
zixobpzxpdexwjzdxzhaxerjhxjlwxmztlxtpsxuhdpxdtoxcpntxnbgxsfhbxhfcxanrfxr
jyxivbjxbnuxqdlnxlrqxylvrxvvmxgtfvxfajypcqayqefyxkaeyaibyfskiykmxynaumyu
qtyvieqyeupydqouyochytgicyigdybosgyskzyjwckycovyremoymsryzmwsywwnyhugwyg
bkzqdrbzrfgzylbfzbjczgtljzlnyzobvnzvruzwjfrzfvqzerpvzpdizuhjdzjhezcpthzt
lazkxdlzdpwzsfnpzntszanxtzxxozivhxzhclarescasghazmcgackdahumkamozapcwoaw
svaxkgsagwrafsqwaqejavikeakifadquiaumbalyemaeqxatgoqaoutaboyuayypajwiyai

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: clarescas
Cipher: pynerfpnf

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: clarescas
Cipher: 311311245134311134

Extended Methods:
Method #1

Plaintext: clarescas
method variations:
hqfwkxhfxnvlbpcnlcsaqguhsqhxfvmznxvn

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
c l a r e s c a s 
3 1 1 2 5 3 3 1 3 
1 3 1 4 1 4 1 1 4 
They are then read out in rows:
311253313131414114
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: clarescas
Cipher: cfpcccddq

Read more ...
Method #3

Plaintext: clarescas
method variations:
acfyloalo cfyloaloa fyloaloac
yloaloacf loaloacfy oaloacfyl
aloacfylo loacfyloa oacfyloal

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: clarescas

first 5040 cipher variations(362880 total)
clarescas clarescsa claresacs claresasc claressac claressca clarecsas clarecssa clarecass clarecass clarecsas
clarecssa clareacss clareacss clareascs clareassc clareassc clareascs clarescas clarescsa claresacs claresasc
claressac claressca clarsecas clarsecsa clarseacs clarseasc clarsesac clarsesca clarsceas clarscesa clarscaes
clarscase clarscsae clarscsea clarsaces clarsacse clarsaecs clarsaesc clarsasec clarsasce clarsscae clarsscea
clarssace clarssaec clarsseac clarsseca clarcseas clarcsesa clarcsaes clarcsase clarcssae clarcssea clarcesas
clarcessa clarceass clarceass clarcesas clarcessa clarcaess clarcaess clarcases clarcasse clarcasse clarcases
clarcseas clarcsesa clarcsaes clarcsase clarcssae clarcssea clarasces clarascse clarasecs clarasesc clarassec
clarassce claracses claracsse claracess claracess claracses claracsse claraecss claraecss claraescs claraessc
claraessc claraescs clarasces clarascse clarasecs clarasesc clarassec clarassce clarsscae clarsscea clarssace
clarssaec clarsseac clarsseca clarscsae clarscsea clarscase clarscaes clarsceas clarscesa clarsacse clarsaces
clarsasce clarsasec clarsaesc clarsaecs clarsecas clarsecsa clarseacs clarseasc clarsesac clarsesca claerscas
claerscsa claersacs claersasc claerssac claerssca claercsas claercssa claercass claercass claercsas claercssa
claeracss claeracss claerascs claerassc claerassc claerascs claerscas claerscsa claersacs claersasc claerssac
claerssca claesrcas claesrcsa claesracs claesrasc claesrsac claesrsca claescras claescrsa claescars claescasr
claescsar claescsra claesacrs claesacsr claesarcs claesarsc claesasrc claesascr claesscar claesscra claessacr
claessarc claessrac claessrca claecsras claecsrsa claecsars claecsasr claecssar claecssra claecrsas claecrssa
claecrass claecrass claecrsas claecrssa claecarss claecarss claecasrs claecassr claecassr claecasrs claecsras
claecsrsa claecsars claecsasr claecssar claecssra claeascrs claeascsr claeasrcs claeasrsc claeassrc claeasscr
claeacsrs claeacssr claeacrss claeacrss claeacsrs claeacssr claearcss claearcss claearscs claearssc claearssc
claearscs claeascrs claeascsr claeasrcs claeasrsc claeassrc claeasscr claesscar claesscra claessacr claessarc
claessrac claessrca claescsar claescsra claescasr claescars claescras claescrsa claesacsr claesacrs claesascr
claesasrc claesarsc claesarcs claesrcas claesrcsa claesracs claesrasc claesrsac claesrsca clasercas clasercsa
claseracs claserasc clasersac clasersca clasecras clasecrsa clasecars clasecasr clasecsar clasecsra claseacrs
claseacsr clasearcs clasearsc claseasrc claseascr clasescar clasescra clasesacr clasesarc clasesrac clasesrca
clasrecas clasrecsa clasreacs clasreasc clasresac clasresca clasrceas clasrcesa clasrcaes clasrcase clasrcsae
clasrcsea clasraces clasracse clasraecs clasraesc clasrasec clasrasce clasrscae clasrscea clasrsace clasrsaec
clasrseac clasrseca clascreas clascresa clascraes clascrase clascrsae clascrsea clasceras clascersa clascears
clasceasr clascesar clascesra clascaers clascaesr clascares clascarse clascasre clascaser clascsear clascsera
clascsaer clascsare clascsrae clascsrea clasarces clasarcse clasarecs clasaresc clasarsec clasarsce clasacres
clasacrse clasacers clasacesr clasacser clasacsre clasaecrs clasaecsr clasaercs clasaersc clasaesrc clasaescr
clasascer clasascre clasasecr clasaserc clasasrec clasasrce classrcae classrcea classrace classraec classreac
classreca classcrae classcrea classcare classcaer classcear classcera classacre classacer classarce classarec
classaerc classaecr classecar classecra classeacr classearc classerac classerca clacesras clacesrsa clacesars
clacesasr clacessar clacessra clacersas clacerssa clacerass clacerass clacersas clacerssa clacearss clacearss
claceasrs claceassr claceassr claceasrs clacesras clacesrsa clacesars clacesasr clacessar clacessra clacseras
clacsersa clacsears clacseasr clacsesar clacsesra clacsreas clacsresa clacsraes clacsrase clacsrsae clacsrsea
clacsares clacsarse clacsaers clacsaesr clacsaser clacsasre clacssrae clacssrea clacssare clacssaer clacssear
clacssera clacrseas clacrsesa clacrsaes clacrsase clacrssae clacrssea clacresas clacressa clacreass clacreass
clacresas clacressa clacraess clacraess clacrases clacrasse clacrasse clacrases clacrseas clacrsesa clacrsaes
clacrsase clacrssae clacrssea clacasres clacasrse clacasers clacasesr clacasser clacassre clacarses clacarsse
clacaress clacaress clacarses clacarsse clacaerss clacaerss clacaesrs clacaessr clacaessr clacaesrs clacasres
clacasrse clacasers clacasesr clacasser clacassre clacssrae clacssrea clacssare clacssaer clacssear clacssera
clacsrsae clacsrsea clacsrase clacsraes clacsreas clacsresa clacsarse clacsares clacsasre clacsaser clacsaesr
clacsaers clacseras clacsersa clacsears clacseasr clacsesar clacsesra claaescrs claaescsr claaesrcs claaesrsc
claaessrc claaesscr claaecsrs claaecssr claaecrss claaecrss claaecsrs claaecssr claaercss claaercss claaerscs
claaerssc claaerssc claaerscs claaescrs claaescsr claaesrcs claaesrsc claaessrc claaesscr claasecrs claasecsr
claasercs claasersc claasesrc claasescr claascers claascesr claascres claascrse claascsre claascser claasrces
claasrcse claasrecs claasresc claasrsec claasrsce claasscre claasscer claassrce claassrec claasserc claassecr
claacsers claacsesr claacsres claacsrse claacssre claacsser claacesrs claacessr claacerss claacerss claacesrs
claacessr claacress claacress claacrses claacrsse claacrsse claacrses claacsers claacsesr claacsres claacsrse
claacssre claacsser claarsces claarscse claarsecs claarsesc claarssec claarssce claarcses claarcsse claarcess
claarcess claarcses claarcsse claarecss claarecss claarescs claaressc claaressc claarescs claarsces claarscse
claarsecs claarsesc claarssec claarssce claasscre claasscer claassrce claassrec claasserc claassecr claascsre
claascser claascrse claascres claascers claascesr claasrcse claasrces claasrsce claasrsec claasresc claasrecs
claasecrs claasecsr claasercs claasersc claasesrc claasescr clasescar clasescra clasesacr clasesarc clasesrac
clasesrca clasecsar clasecsra clasecasr clasecars clasecras clasecrsa claseacsr claseacrs claseascr claseasrc
clasearsc clasearcs clasercas clasercsa claseracs claserasc clasersac clasersca classecar classecra classeacr
classearc classerac classerca classcear classcera classcaer classcare classcrae classcrea classacer classacre
classaecr classaerc classarec classarce classrcae classrcea classrace classraec classreac classreca clascsear
clascsera clascsaer clascsare clascsrae clascsrea clascesar clascesra clasceasr clascears clasceras clascersa
clascaesr clascaers clascaser clascasre clascarse clascares clascreas clascresa clascraes clascrase clascrsae
clascrsea clasascer clasascre clasasecr clasaserc clasasrec clasasrce clasacser clasacsre clasacesr clasacers
clasacres clasacrse clasaecsr clasaecrs clasaescr clasaesrc clasaersc clasaercs clasarces clasarcse clasarecs
clasaresc clasarsec clasarsce clasrscae clasrscea clasrsace clasrsaec clasrseac clasrseca clasrcsae clasrcsea
clasrcase clasrcaes clasrceas clasrcesa clasracse clasraces clasrasce clasrasec clasraesc clasraecs clasrecas
clasrecsa clasreacs clasreasc clasresac clasresca clraescas clraescsa clraesacs clraesasc clraessac clraessca
clraecsas clraecssa clraecass clraecass clraecsas clraecssa clraeacss clraeacss clraeascs clraeassc clraeassc
clraeascs clraescas clraescsa clraesacs clraesasc clraessac clraessca clrasecas clrasecsa clraseacs clraseasc
clrasesac clrasesca clrasceas clrascesa clrascaes clrascase clrascsae clrascsea clrasaces clrasacse clrasaecs
clrasaesc clrasasec clrasasce clrasscae clrasscea clrassace clrassaec clrasseac clrasseca clracseas clracsesa
clracsaes clracsase clracssae clracssea clracesas clracessa clraceass clraceass clracesas clracessa clracaess
clracaess clracases clracasse clracasse clracases clracseas clracsesa clracsaes clracsase clracssae clracssea
clraasces clraascse clraasecs clraasesc clraassec clraassce clraacses clraacsse clraacess clraacess clraacses
clraacsse clraaecss clraaecss clraaescs clraaessc clraaessc clraaescs clraasces clraascse clraasecs clraasesc
clraassec clraassce clrasscae clrasscea clrassace clrassaec clrasseac clrasseca clrascsae clrascsea clrascase
clrascaes clrasceas clrascesa clrasacse clrasaces clrasasce clrasasec clrasaesc clrasaecs clrasecas clrasecsa
clraseacs clraseasc clrasesac clrasesca clreascas clreascsa clreasacs clreasasc clreassac clreassca clreacsas
clreacssa clreacass clreacass clreacsas clreacssa clreaacss clreaacss clreaascs clreaassc clreaassc clreaascs
clreascas clreascsa clreasacs clreasasc clreassac clreassca clresacas clresacsa clresaacs clresaasc clresasac
clresasca clrescaas clrescasa clrescaas clrescasa clrescsaa clrescsaa clresacas clresacsa clresaacs clresaasc
clresasac clresasca clresscaa clresscaa clressaca clressaac clressaac clressaca clrecsaas clrecsasa clrecsaas
clrecsasa clrecssaa clrecssaa clrecasas clrecassa clrecaass clrecaass clrecasas clrecassa clrecaass clrecaass
clrecasas clrecassa clrecassa clrecasas clrecsaas clrecsasa clrecsaas clrecsasa clrecssaa clrecssaa clreascas
clreascsa clreasacs clreasasc clreassac clreassca clreacsas clreacssa clreacass clreacass clreacsas clreacssa
clreaacss clreaacss clreaascs clreaassc clreaassc clreaascs clreascas clreascsa clreasacs clreasasc clreassac
clreassca clresscaa clresscaa clressaca clressaac clressaac clressaca clrescsaa clrescsaa clrescasa clrescaas
clrescaas clrescasa clresacsa clresacas clresasca clresasac clresaasc clresaacs clresacas clresacsa clresaacs
clresaasc clresasac clresasca clrseacas clrseacsa clrseaacs clrseaasc clrseasac clrseasca clrsecaas clrsecasa
clrsecaas clrsecasa clrsecsaa clrsecsaa clrseacas clrseacsa clrseaacs clrseaasc clrseasac clrseasca clrsescaa
clrsescaa clrsesaca clrsesaac clrsesaac clrsesaca clrsaecas clrsaecsa clrsaeacs clrsaeasc clrsaesac clrsaesca
clrsaceas clrsacesa clrsacaes clrsacase clrsacsae clrsacsea clrsaaces clrsaacse clrsaaecs clrsaaesc clrsaasec
clrsaasce clrsascae clrsascea clrsasace clrsasaec clrsaseac clrsaseca clrscaeas clrscaesa clrscaaes clrscaase
clrscasae clrscasea clrsceaas clrsceasa clrsceaas clrsceasa clrscesaa clrscesaa clrscaeas clrscaesa clrscaaes
clrscaase clrscasae clrscasea clrscseaa clrscseaa clrscsaea clrscsaae clrscsaae clrscsaea clrsaaces clrsaacse
clrsaaecs clrsaaesc clrsaasec clrsaasce clrsacaes clrsacase clrsaceas clrsacesa clrsacsea clrsacsae clrsaecas
clrsaecsa clrsaeacs clrsaeasc clrsaesac clrsaesca clrsascea clrsascae clrsaseca clrsaseac clrsasaec clrsasace
clrssacae clrssacea clrssaace clrssaaec clrssaeac clrssaeca clrsscaae clrsscaea clrsscaae clrsscaea clrssceaa
clrssceaa clrssacae clrssacea clrssaace clrssaaec clrssaeac clrssaeca clrssecaa clrssecaa clrsseaca clrsseaac
clrsseaac clrsseaca clrcesaas clrcesasa clrcesaas clrcesasa clrcessaa clrcessaa clrceasas clrceassa clrceaass
clrceaass clrceasas clrceassa clrceaass clrceaass clrceasas clrceassa clrceassa clrceasas clrcesaas clrcesasa
clrcesaas clrcesasa clrcessaa clrcessaa clrcseaas clrcseasa clrcseaas clrcseasa clrcsesaa clrcsesaa clrcsaeas
clrcsaesa clrcsaaes clrcsaase clrcsasae clrcsasea clrcsaaes clrcsaase clrcsaeas clrcsaesa clrcsasea clrcsasae
clrcssaae clrcssaea clrcssaae clrcssaea clrcsseaa clrcsseaa clrcaseas clrcasesa clrcasaes clrcasase clrcassae
clrcassea clrcaesas clrcaessa clrcaeass clrcaeass clrcaesas clrcaessa clrcaaess clrcaaess clrcaases clrcaasse
clrcaasse clrcaases clrcaseas clrcasesa clrcasaes clrcasase clrcassae clrcassea clrcasaes clrcasase clrcaseas
clrcasesa clrcassea clrcassae clrcaases clrcaasse clrcaaess clrcaaess clrcaases clrcaasse clrcaeass clrcaeass
clrcaesas clrcaessa clrcaessa clrcaesas clrcasaes clrcasase clrcaseas clrcasesa clrcassea clrcassae clrcssaae
clrcssaea clrcssaae clrcssaea clrcsseaa clrcsseaa clrcsasae clrcsasea clrcsaase clrcsaaes clrcsaeas clrcsaesa
clrcsaase clrcsaaes clrcsasae clrcsasea clrcsaesa clrcsaeas clrcseaas clrcseasa clrcseaas clrcseasa clrcsesaa
clrcsesaa clraescas clraescsa clraesacs clraesasc clraessac clraessca clraecsas clraecssa clraecass clraecass
clraecsas clraecssa clraeacss clraeacss clraeascs clraeassc clraeassc clraeascs clraescas clraescsa clraesacs
clraesasc clraessac clraessca clrasecas clrasecsa clraseacs clraseasc clrasesac clrasesca clrasceas clrascesa
clrascaes clrascase clrascsae clrascsea clrasaces clrasacse clrasaecs clrasaesc clrasasec clrasasce clrasscae
clrasscea clrassace clrassaec clrasseac clrasseca clracseas clracsesa clracsaes clracsase clracssae clracssea
clracesas clracessa clraceass clraceass clracesas clracessa clracaess clracaess clracases clracasse clracasse
clracases clracseas clracsesa clracsaes clracsase clracssae clracssea clraasces clraascse clraasecs clraasesc
clraassec clraassce clraacses clraacsse clraacess clraacess clraacses clraacsse clraaecss clraaecss clraaescs
clraaessc clraaessc clraaescs clraasces clraascse clraasecs clraasesc clraassec clraassce clrasscae clrasscea
clrassace clrassaec clrasseac clrasseca clrascsae clrascsea clrascase clrascaes clrasceas clrascesa clrasacse
clrasaces clrasasce clrasasec clrasaesc clrasaecs clrasecas clrasecsa clraseacs clraseasc clrasesac clrasesca
clrsescaa clrsescaa clrsesaca clrsesaac clrsesaac clrsesaca clrsecsaa clrsecsaa clrsecasa clrsecaas clrsecaas
clrsecasa clrseacsa clrseacas clrseasca clrseasac clrseaasc clrseaacs clrseacas clrseacsa clrseaacs clrseaasc
clrseasac clrseasca clrssecaa clrssecaa clrsseaca clrsseaac clrsseaac clrsseaca clrssceaa clrssceaa clrsscaea
clrsscaae clrsscaae clrsscaea clrssacea clrssacae clrssaeca clrssaeac clrssaaec clrssaace clrssacae clrssacea
clrssaace clrssaaec clrssaeac clrssaeca clrscseaa clrscseaa clrscsaea clrscsaae clrscsaae clrscsaea clrscesaa
clrscesaa clrsceasa clrsceaas clrsceaas clrsceasa clrscaesa clrscaeas clrscasea clrscasae clrscaase clrscaaes
clrscaeas clrscaesa clrscaaes clrscaase clrscasae clrscasea clrsascea clrsascae clrsaseca clrsaseac clrsasaec
clrsasace clrsacsea clrsacsae clrsacesa clrsaceas clrsacaes clrsacase clrsaecsa clrsaecas clrsaesca clrsaesac
clrsaeasc clrsaeacs clrsaaces clrsaacse clrsaaecs clrsaaesc clrsaasec clrsaasce clrsascae clrsascea clrsasace
clrsasaec clrsaseac clrsaseca clrsacsae clrsacsea clrsacase clrsacaes clrsaceas clrsacesa clrsaacse clrsaaces
clrsaasce clrsaasec clrsaaesc clrsaaecs clrsaecas clrsaecsa clrsaeacs clrsaeasc clrsaesac clrsaesca clerascas
clerascsa clerasacs clerasasc clerassac clerassca cleracsas cleracssa cleracass cleracass cleracsas cleracssa
cleraacss cleraacss cleraascs cleraassc cleraassc cleraascs clerascas clerascsa clerasacs clerasasc clerassac
clerassca clersacas clersacsa clersaacs clersaasc clersasac clersasca clerscaas clerscasa clerscaas clerscasa
clerscsaa clerscsaa clersacas clersacsa clersaacs clersaasc clersasac clersasca clersscaa clersscaa clerssaca
clerssaac clerssaac clerssaca clercsaas clercsasa clercsaas clercsasa clercssaa clercssaa clercasas clercassa
clercaass clercaass clercasas clercassa clercaass clercaass clercasas clercassa clercassa clercasas clercsaas
clercsasa clercsaas clercsasa clercssaa clercssaa clerascas clerascsa clerasacs clerasasc clerassac clerassca
cleracsas cleracssa cleracass cleracass cleracsas cleracssa cleraacss cleraacss cleraascs cleraassc cleraassc
cleraascs clerascas clerascsa clerasacs clerasasc clerassac clerassca clersscaa clersscaa clerssaca clerssaac
clerssaac clerssaca clerscsaa clerscsaa clerscasa clerscaas clerscaas clerscasa clersacsa clersacas clersasca
clersasac clersaasc clersaacs clersacas clersacsa clersaacs clersaasc clersasac clersasca clearscas clearscsa
clearsacs clearsasc clearssac clearssca clearcsas clearcssa clearcass clearcass clearcsas clearcssa clearacss
clearacss clearascs clearassc clearassc clearascs clearscas clearscsa clearsacs clearsasc clearssac clearssca
cleasrcas cleasrcsa cleasracs cleasrasc cleasrsac cleasrsca cleascras cleascrsa cleascars cleascasr cleascsar
cleascsra cleasacrs cleasacsr cleasarcs cleasarsc cleasasrc cleasascr cleasscar cleasscra cleassacr cleassarc
cleassrac cleassrca cleacsras cleacsrsa cleacsars cleacsasr cleacssar cleacssra cleacrsas cleacrssa cleacrass
cleacrass cleacrsas cleacrssa cleacarss cleacarss cleacasrs cleacassr cleacassr cleacasrs cleacsras cleacsrsa
cleacsars cleacsasr cleacssar cleacssra cleaascrs cleaascsr cleaasrcs cleaasrsc cleaassrc cleaasscr cleaacsrs
cleaacssr cleaacrss cleaacrss cleaacsrs cleaacssr cleaarcss cleaarcss cleaarscs cleaarssc cleaarssc cleaarscs
cleaascrs cleaascsr cleaasrcs cleaasrsc cleaassrc cleaasscr cleasscar cleasscra cleassacr cleassarc cleassrac
cleassrca cleascsar cleascsra cleascasr cleascars cleascras cleascrsa cleasacsr cleasacrs cleasascr cleasasrc
cleasarsc cleasarcs cleasrcas cleasrcsa cleasracs cleasrasc cleasrsac cleasrsca clesarcas clesarcsa clesaracs
clesarasc clesarsac clesarsca clesacras clesacrsa clesacars clesacasr clesacsar clesacsra clesaacrs clesaacsr
clesaarcs clesaarsc clesaasrc clesaascr clesascar clesascra clesasacr clesasarc clesasrac clesasrca clesracas
clesracsa clesraacs clesraasc clesrasac clesrasca clesrcaas clesrcasa clesrcaas clesrcasa clesrcsaa clesrcsaa
clesracas clesracsa clesraacs clesraasc clesrasac clesrasca clesrscaa clesrscaa clesrsaca clesrsaac clesrsaac
clesrsaca clescraas clescrasa clescraas clescrasa clescrsaa clescrsaa clescaras clescarsa clescaars clescaasr
clescasar clescasra clescaars clescaasr clescaras clescarsa clescasra clescasar clescsaar clescsara clescsaar
clescsara clescsraa clescsraa clesarcas clesarcsa clesaracs clesarasc clesarsac clesarsca clesacras clesacrsa
clesacars clesacasr clesacsar clesacsra clesaacrs clesaacsr clesaarcs clesaarsc clesaasrc clesaascr clesascar
clesascra clesasacr clesasarc clesasrac clesasrca clessrcaa clessrcaa clessraca clessraac clessraac clessraca
clesscraa clesscraa clesscara clesscaar clesscaar clesscara clessacra clessacar clessarca clessarac clessaarc
clessaacr clessacar clessacra clessaacr clessaarc clessarac clessarca clecasras clecasrsa clecasars clecasasr
clecassar clecassra clecarsas clecarssa clecarass clecarass clecarsas clecarssa clecaarss clecaarss clecaasrs
clecaassr clecaassr clecaasrs clecasras clecasrsa clecasars clecasasr clecassar clecassra clecsaras clecsarsa
clecsaars clecsaasr clecsasar clecsasra clecsraas clecsrasa clecsraas clecsrasa clecsrsaa clecsrsaa clecsaras
clecsarsa clecsaars clecsaasr clecsasar clecsasra clecssraa clecssraa clecssara clecssaar clecssaar clecssara
clecrsaas clecrsasa clecrsaas clecrsasa clecrssaa clecrssaa clecrasas clecrassa clecraass clecraass clecrasas
clecrassa clecraass clecraass clecrasas clecrassa clecrassa clecrasas clecrsaas clecrsasa clecrsaas clecrsasa
clecrssaa clecrssaa clecasras clecasrsa clecasars clecasasr clecassar clecassra clecarsas clecarssa clecarass
clecarass clecarsas clecarssa clecaarss clecaarss clecaasrs clecaassr clecaassr clecaasrs clecasras clecasrsa
clecasars clecasasr clecassar clecassra clecssraa clecssraa clecssara clecssaar clecssaar clecssara clecsrsaa
clecsrsaa clecsrasa clecsraas clecsraas clecsrasa clecsarsa clecsaras clecsasra clecsasar clecsaasr clecsaars
clecsaras clecsarsa clecsaars clecsaasr clecsasar clecsasra cleaascrs cleaascsr cleaasrcs cleaasrsc cleaassrc
cleaasscr cleaacsrs cleaacssr cleaacrss cleaacrss cleaacsrs cleaacssr cleaarcss cleaarcss cleaarscs cleaarssc
cleaarssc cleaarscs cleaascrs cleaascsr cleaasrcs cleaasrsc cleaassrc cleaasscr cleasacrs cleasacsr cleasarcs
cleasarsc cleasasrc cleasascr cleascars cleascasr cleascras cleascrsa cleascsra cleascsar cleasrcas cleasrcsa
cleasracs cleasrasc cleasrsac cleasrsca cleasscra cleasscar cleassrca cleassrac cleassarc cleassacr cleacsars
cleacsasr cleacsras cleacsrsa cleacssra cleacssar cleacasrs cleacassr cleacarss cleacarss cleacasrs cleacassr
cleacrass cleacrass cleacrsas cleacrssa cleacrssa cleacrsas cleacsars cleacsasr cleacsras cleacsrsa cleacssra
cleacssar clearscas clearscsa clearsacs clearsasc clearssac clearssca clearcsas clearcssa clearcass clearcass
clearcsas clearcssa clearacss clearacss clearascs clearassc clearassc clearascs clearscas clearscsa clearsacs
clearsasc clearssac clearssca cleasscra cleasscar cleassrca cleassrac cleassarc cleassacr cleascsra cleascsar
cleascrsa cleascras cleascars cleascasr cleasrcsa cleasrcas cleasrsca cleasrsac cleasrasc cleasracs cleasacrs
cleasacsr cleasarcs cleasarsc cleasasrc cleasascr clesascar clesascra clesasacr clesasarc clesasrac clesasrca
clesacsar clesacsra clesacasr clesacars clesacras clesacrsa clesaacsr clesaacrs clesaascr clesaasrc clesaarsc
clesaarcs clesarcas clesarcsa clesaracs clesarasc clesarsac clesarsca clessacar clessacra clessaacr clessaarc
clessarac clessarca clesscaar clesscara clesscaar clesscara clesscraa clesscraa clessacar clessacra clessaacr
clessaarc clessarac clessarca clessrcaa clessrcaa clessraca clessraac clessraac clessraca clescsaar clescsara
clescsaar clescsara clescsraa clescsraa clescasar clescasra clescaasr clescaars clescaras clescarsa clescaasr
clescaars clescasar clescasra clescarsa clescaras clescraas clescrasa clescraas clescrasa clescrsaa clescrsaa
clesascar clesascra clesasacr clesasarc clesasrac clesasrca clesacsar clesacsra clesacasr clesacars clesacras
clesacrsa clesaacsr clesaacrs clesaascr clesaasrc clesaarsc clesaarcs clesarcas clesarcsa clesaracs clesarasc
clesarsac clesarsca clesrscaa clesrscaa clesrsaca clesrsaac clesrsaac clesrsaca clesrcsaa clesrcsaa clesrcasa
clesrcaas clesrcaas clesrcasa clesracsa clesracas clesrasca clesrasac clesraasc clesraacs clesracas clesracsa
clesraacs clesraasc clesrasac clesrasca clsreacas clsreacsa clsreaacs clsreaasc clsreasac clsreasca clsrecaas
clsrecasa clsrecaas clsrecasa clsrecsaa clsrecsaa clsreacas clsreacsa clsreaacs clsreaasc clsreasac clsreasca
clsrescaa clsrescaa clsresaca clsresaac clsresaac clsresaca clsraecas clsraecsa clsraeacs clsraeasc clsraesac
clsraesca clsraceas clsracesa clsracaes clsracase clsracsae clsracsea clsraaces clsraacse clsraaecs clsraaesc
clsraasec clsraasce clsrascae clsrascea clsrasace clsrasaec clsraseac clsraseca clsrcaeas clsrcaesa clsrcaaes
clsrcaase clsrcasae clsrcasea clsrceaas clsrceasa clsrceaas clsrceasa clsrcesaa clsrcesaa clsrcaeas clsrcaesa
clsrcaaes clsrcaase clsrcasae clsrcasea clsrcseaa clsrcseaa clsrcsaea clsrcsaae clsrcsaae clsrcsaea clsraaces
clsraacse clsraaecs clsraaesc clsraasec clsraasce clsracaes clsracase clsraceas clsracesa clsracsea clsracsae
clsraecas clsraecsa clsraeacs clsraeasc clsraesac clsraesca clsrascea clsrascae clsraseca clsraseac clsrasaec
clsrasace clsrsacae clsrsacea clsrsaace clsrsaaec clsrsaeac clsrsaeca clsrscaae clsrscaea clsrscaae clsrscaea
clsrsceaa clsrsceaa clsrsacae clsrsacea clsrsaace clsrsaaec clsrsaeac clsrsaeca clsrsecaa clsrsecaa clsrseaca
clsrseaac clsrseaac clsrseaca clseracas clseracsa clseraacs clseraasc clserasac clserasca clsercaas clsercasa
clsercaas clsercasa clsercsaa clsercsaa clseracas clseracsa clseraacs clseraasc clserasac clserasca clserscaa
clserscaa clsersaca clsersaac clsersaac clsersaca clsearcas clsearcsa clsearacs clsearasc clsearsac clsearsca
clseacras clseacrsa clseacars clseacasr clseacsar clseacsra clseaacrs clseaacsr clseaarcs clseaarsc clseaasrc
clseaascr clseascar clseascra clseasacr clseasarc clseasrac clseasrca clsecaras clsecarsa clsecaars clsecaasr
clsecasar clsecasra clsecraas clsecrasa clsecraas clsecrasa clsecrsaa clsecrsaa clsecaras clsecarsa clsecaars
clsecaasr clsecasar clsecasra clsecsraa clsecsraa clsecsara clsecsaar clsecsaar clsecsara clseaacrs clseaacsr
clseaarcs clseaarsc clseaasrc clseaascr clseacars clseacasr clseacras clseacrsa clseacsra clseacsar clsearcas
clsearcsa clsearacs clsearasc clsearsac clsearsca clseascra clseascar clseasrca clseasrac clseasarc clseasacr
clsesacar clsesacra clsesaacr clsesaarc clsesarac clsesarca clsescaar clsescara clsescaar clsescara clsescraa
clsescraa clsesacar clsesacra clsesaacr clsesaarc clsesarac clsesarca clsesrcaa clsesrcaa clsesraca clsesraac
clsesraac clsesraca clsaercas clsaercsa clsaeracs clsaerasc clsaersac clsaersca clsaecras clsaecrsa clsaecars
clsaecasr clsaecsar clsaecsra clsaeacrs clsaeacsr clsaearcs clsaearsc clsaeasrc clsaeascr clsaescar clsaescra
clsaesacr clsaesarc clsaesrac clsaesrca clsarecas clsarecsa clsareacs clsareasc clsaresac clsaresca clsarceas
clsarcesa clsarcaes clsarcase clsarcsae clsarcsea clsaraces clsaracse clsaraecs clsaraesc clsarasec clsarasce
clsarscae clsarscea clsarsace clsarsaec clsarseac clsarseca clsacreas clsacresa clsacraes clsacrase clsacrsae
clsacrsea clsaceras clsacersa clsacears clsaceasr clsacesar clsacesra clsacaers clsacaesr clsacares clsacarse
clsacasre clsacaser clsacsear clsacsera clsacsaer clsacsare clsacsrae clsacsrea clsaarces clsaarcse clsaarecs
clsaaresc clsaarsec clsaarsce clsaacres clsaacrse clsaacers clsaacesr clsaacser clsaacsre clsaaecrs clsaaecsr
clsaaercs clsaaersc clsaaesrc clsaaescr clsaascer clsaascre clsaasecr clsaaserc clsaasrec clsaasrce clsasrcae
clsasrcea clsasrace clsasraec clsasreac clsasreca clsascrae clsascrea clsascare clsascaer clsascear clsascera
clsasacre clsasacer clsasarce clsasarec clsasaerc clsasaecr clsasecar clsasecra clsaseacr clsasearc clsaserac
clsaserca clscearas clscearsa clsceaars clsceaasr clsceasar clsceasra clsceraas clscerasa clsceraas clscerasa
clscersaa clscersaa clscearas clscearsa clsceaars clsceaasr clsceasar clsceasra clscesraa clscesraa clscesara
clscesaar clscesaar clscesara clscaeras clscaersa clscaears clscaeasr clscaesar clscaesra clscareas clscaresa
clscaraes clscarase clscarsae clscarsea clscaares clscaarse clscaaers clscaaesr clscaaser clscaasre clscasrae
clscasrea clscasare clscasaer clscasear clscasera clscraeas clscraesa clscraaes clscraase clscrasae clscrasea
clscreaas clscreasa clscreaas clscreasa clscresaa clscresaa clscraeas clscraesa clscraaes clscraase clscrasae
clscrasea clscrseaa clscrseaa clscrsaea clscrsaae clscrsaae clscrsaea clscaares clscaarse clscaaers clscaaesr
clscaaser clscaasre clscaraes clscarase clscareas clscaresa clscarsea clscarsae clscaeras clscaersa clscaears
clscaeasr clscaesar clscaesra clscasrea clscasrae clscasera clscasear clscasaer clscasare clscsarae clscsarea
clscsaare clscsaaer clscsaear clscsaera clscsraae clscsraea clscsraae clscsraea clscsreaa clscsreaa clscsarae
clscsarea clscsaare clscsaaer clscsaear clscsaera clscseraa clscseraa clscseara clscseaar clscseaar clscseara
clsaeacrs clsaeacsr clsaearcs clsaearsc clsaeasrc clsaeascr clsaecars clsaecasr clsaecras clsaecrsa clsaecsra
clsaecsar clsaercas clsaercsa clsaeracs clsaerasc clsaersac clsaersca clsaescra clsaescar clsaesrca clsaesrac
clsaesarc clsaesacr clsaaecrs clsaaecsr clsaaercs clsaaersc clsaaesrc clsaaescr clsaacers clsaacesr clsaacres
clsaacrse clsaacsre clsaacser clsaarces clsaarcse clsaarecs clsaaresc clsaarsec clsaarsce clsaascre clsaascer
clsaasrce clsaasrec clsaaserc clsaasecr clsacaers clsacaesr clsacares clsacarse clsacasre clsacaser clsacears
clsaceasr clsaceras clsacersa clsacesra clsacesar clsacreas clsacresa clsacraes clsacrase clsacrsae clsacrsea
clsacsera clsacsear clsacsrea clsacsrae clsacsare clsacsaer clsaraces clsaracse clsaraecs clsaraesc clsarasec
clsarasce clsarcaes clsarcase clsarceas clsarcesa clsarcsea clsarcsae clsarecas clsarecsa clsareacs clsareasc
clsaresac clsaresca clsarscea clsarscae clsarseca clsarseac clsarsaec clsarsace clsasacre clsasacer clsasarce
clsasarec clsasaerc clsasaecr clsascare clsascaer clsascrae clsascrea clsascera clsascear clsasrcae clsasrcea
clsasrace clsasraec clsasreac clsasreca clsasecra clsasecar clsaserca clsaserac clsasearc clsaseacr clsseacar
clsseacra clsseaacr clsseaarc clssearac clssearca clssecaar clssecara clssecaar clssecara clssecraa clssecraa
clsseacar clsseacra clsseaacr clsseaarc clssearac clssearca clssercaa clssercaa clsseraca clsseraac clsseraac
clsseraca clssaecar clssaecra clssaeacr clssaearc clssaerac clssaerca clssacear clssacera clssacaer clssacare
clssacrae clssacrea clssaacer clssaacre clssaaecr clssaaerc clssaarec clssaarce clssarcae clssarcea clssarace
clssaraec clssareac clssareca clsscaear clsscaera clsscaaer clsscaare clsscarae clsscarea clssceaar clssceara
clssceaar clssceara clssceraa clssceraa clsscaear clsscaera clsscaaer clsscaare clsscarae clsscarea clsscreaa
clsscreaa clsscraea clsscraae clsscraae clsscraea clssaacer clssaacre clssaaecr clssaaerc clssaarec clssaarce
clssacaer clssacare clssacear clssacera clssacrea clssacrae clssaecar clssaecra clssaeacr clssaearc clssaerac
clssaerca clssarcea clssarcae clssareca clssareac clssaraec clssarace clssracae clssracea clssraace clssraaec
clssraeac clssraeca clssrcaae clssrcaea clssrcaae clssrcaea clssrceaa clssrceaa clssracae clssracea clssraace
clssraaec clssraeac clssraeca clssrecaa clssrecaa clssreaca clssreaac clssreaac clssreaca clcresaas clcresasa
clcresaas clcresasa clcressaa clcressaa clcreasas clcreassa clcreaass clcreaass clcreasas clcreassa clcreaass
clcreaass clcreasas clcreassa clcreassa clcreasas clcresaas clcresasa clcresaas clcresasa clcressaa clcressaa
clcrseaas clcrseasa clcrseaas clcrseasa clcrsesaa clcrsesaa clcrsaeas clcrsaesa clcrsaaes clcrsaase clcrsasae
clcrsasea clcrsaaes clcrsaase clcrsaeas clcrsaesa clcrsasea clcrsasae clcrssaae clcrssaea clcrssaae clcrssaea
clcrsseaa clcrsseaa clcraseas clcrasesa clcrasaes clcrasase clcrassae clcrassea clcraesas clcraessa clcraeass
clcraeass clcraesas clcraessa clcraaess clcraaess clcraases clcraasse clcraasse clcraases clcraseas clcrasesa
clcrasaes clcrasase clcrassae clcrassea clcrasaes clcrasase clcraseas clcrasesa clcrassea clcrassae clcraases
clcraasse clcraaess clcraaess clcraases clcraasse clcraeass clcraeass clcraesas clcraessa clcraessa clcraesas
clcrasaes clcrasase clcraseas clcrasesa clcrassea clcrassae clcrssaae clcrssaea clcrssaae clcrssaea clcrsseaa
clcrsseaa clcrsasae clcrsasea clcrsaase clcrsaaes clcrsaeas clcrsaesa clcrsaase clcrsaaes clcrsasae clcrsasea
clcrsaesa clcrsaeas clcrseaas clcrseasa clcrseaas clcrseasa clcrsesaa clcrsesaa clcersaas clcersasa clcersaas
clcersasa clcerssaa clcerssaa clcerasas clcerassa clceraass clceraass clcerasas clcerassa clceraass clceraass
clcerasas clcerassa clcerassa clcerasas clcersaas clcersasa clcersaas clcersasa clcerssaa clcerssaa clcesraas
clcesrasa clcesraas clcesrasa clcesrsaa clcesrsaa clcesaras clcesarsa clcesaars clcesaasr clcesasar clcesasra
clcesaars clcesaasr clcesaras clcesarsa clcesasra clcesasar clcessaar clcessara clcessaar clcessara clcessraa
clcessraa clceasras clceasrsa clceasars clceasasr clceassar clceassra clcearsas clcearssa clcearass clcearass
clcearsas clcearssa clceaarss clceaarss clceaasrs clceaassr clceaassr clceaasrs clceasras clceasrsa clceasars
clceasasr clceassar clceassra clceasars clceasasr clceasras clceasrsa clceassra clceassar clceaasrs clceaassr
clceaarss clceaarss clceaasrs clceaassr clcearass clcearass clcearsas clcearssa clcearssa clcearsas clceasars
clceasasr clceasras clceasrsa clceassra clceassar clcessaar clcessara clcessaar clcessara clcessraa clcessraa
clcesasar clcesasra clcesaasr clcesaars clcesaras clcesarsa clcesaasr clcesaars clcesasar clcesasra clcesarsa
clcesaras clcesraas clcesrasa clcesraas clcesrasa clcesrsaa clcesrsaa clcseraas clcserasa clcseraas clcserasa
clcsersaa clcsersaa clcsearas clcsearsa clcseaars clcseaasr clcseasar clcseasra clcseaars clcseaasr clcsearas
clcsearsa clcseasra clcseasar clcsesaar clcsesara clcsesaar clcsesara clcsesraa clcsesraa clcsreaas clcsreasa
clcsreaas clcsreasa clcsresaa clcsresaa clcsraeas clcsraesa clcsraaes clcsraase clcsrasae clcsrasea clcsraaes
clcsraase clcsraeas clcsraesa clcsrasea clcsrasae clcsrsaae clcsrsaea clcsrsaae clcsrsaea clcsrseaa clcsrseaa
clcsareas clcsaresa clcsaraes clcsarase clcsarsae clcsarsea clcsaeras clcsaersa clcsaears clcsaeasr clcsaesar
clcsaesra clcsaaers clcsaaesr clcsaares clcsaarse clcsaasre clcsaaser clcsasear clcsasera clcsasaer clcsasare
clcsasrae clcsasrea clcsaraes clcsarase clcsareas clcsaresa clcsarsea clcsarsae clcsaares clcsaarse clcsaaers
clcsaaesr clcsaaser clcsaasre clcsaears clcsaeasr clcsaeras clcsaersa clcsaesra clcsaesar clcsasaer clcsasare
clcsasear clcsasera clcsasrea clcsasrae clcssraae clcssraea clcssraae clcssraea clcssreaa clcssreaa clcssarae
clcssarea clcssaare clcssaaer clcssaear clcssaera clcssaare clcssaaer clcssarae clcssarea clcssaera clcssaear
clcsseaar clcsseara clcsseaar clcsseara clcsseraa clcsseraa clcaesras clcaesrsa clcaesars clcaesasr clcaessar
clcaessra clcaersas clcaerssa clcaerass clcaerass clcaersas clcaerssa clcaearss clcaearss clcaeasrs clcaeassr
clcaeassr clcaeasrs clcaesras clcaesrsa clcaesars clcaesasr clcaessar clcaessra clcaseras clcasersa clcasears
clcaseasr clcasesar clcasesra clcasreas clcasresa clcasraes clcasrase clcasrsae clcasrsea clcasares clcasarse
clcasaers clcasaesr clcasaser clcasasre clcassrae clcassrea clcassare clcassaer clcassear clcassera clcarseas
clcarsesa clcarsaes clcarsase clcarssae clcarssea clcaresas clcaressa clcareass clcareass clcaresas clcaressa
clcaraess clcaraess clcarases clcarasse clcarasse clcarases clcarseas clcarsesa clcarsaes clcarsase clcarssae
clcarssea clcaasres clcaasrse clcaasers clcaasesr clcaasser clcaassre clcaarses clcaarsse clcaaress clcaaress
clcaarses clcaarsse clcaaerss clcaaerss clcaaesrs clcaaessr clcaaessr clcaaesrs clcaasres clcaasrse clcaasers
clcaasesr clcaasser clcaassre clcassrae clcassrea clcassare clcassaer clcassear clcassera clcasrsae clcasrsea
clcasrase clcasraes clcasreas clcasresa clcasarse clcasares clcasasre clcasaser clcasaesr clcasaers clcaseras
clcasersa clcasears clcaseasr clcasesar clcasesra clcaesars clcaesasr clcaesras clcaesrsa clcaessra clcaessar
clcaeasrs clcaeassr clcaearss clcaearss clcaeasrs clcaeassr clcaerass clcaerass clcaersas clcaerssa clcaerssa
clcaersas clcaesars clcaesasr clcaesras clcaesrsa clcaessra clcaessar clcasears clcaseasr clcaseras clcasersa
clcasesra clcasesar clcasaers clcasaesr clcasares clcasarse clcasasre clcasaser clcasraes clcasrase clcasreas
clcasresa clcasrsea clcasrsae clcassare clcassaer clcassrae clcassrea clcassera clcassear clcaasers clcaasesr
clcaasres clcaasrse clcaassre clcaasser clcaaesrs clcaaessr clcaaerss clcaaerss clcaaesrs clcaaessr clcaaress
clcaaress clcaarses clcaarsse clcaarsse clcaarses clcaasers clcaasesr clcaasres clcaasrse clcaassre clcaasser
clcarsaes clcarsase clcarseas clcarsesa clcarssea clcarssae clcarases clcarasse clcaraess clcaraess clcarases
clcarasse clcareass clcareass clcaresas clcaressa clcaressa clcaresas clcarsaes clcarsase clcarseas clcarsesa
clcarssea clcarssae clcassare clcassaer clcassrae clcassrea clcassera clcassear clcasasre clcasaser clcasarse
clcasares clcasaers clcasaesr clcasrase clcasraes clcasrsae clcasrsea clcasresa clcasreas clcasears clcaseasr
clcaseras clcasersa clcasesra clcasesar clcsesaar clcsesara clcsesaar clcsesara clcsesraa clcsesraa clcseasar
clcseasra clcseaasr clcseaars clcsearas clcsearsa clcseaasr clcseaars clcseasar clcseasra clcsearsa clcsearas
clcseraas clcserasa clcseraas clcserasa clcsersaa clcsersaa clcsseaar clcsseara clcsseaar clcsseara clcsseraa
clcsseraa clcssaear clcssaera clcssaaer clcssaare clcssarae clcssarea clcssaaer clcssaare clcssaear clcssaera
clcssarea clcssarae clcssraae clcssraea clcssraae clcssraea clcssreaa clcssreaa clcsasear clcsasera clcsasaer
clcsasare clcsasrae clcsasrea clcsaesar clcsaesra clcsaeasr clcsaears clcsaeras clcsaersa clcsaaesr clcsaaers
clcsaaser clcsaasre clcsaarse clcsaares clcsareas clcsaresa clcsaraes clcsarase clcsarsae clcsarsea clcsasaer
clcsasare clcsasear clcsasera clcsasrea clcsasrae clcsaaser clcsaasre clcsaaesr clcsaaers clcsaares clcsaarse
clcsaeasr clcsaears clcsaesar clcsaesra clcsaersa clcsaeras clcsaraes clcsarase clcsareas clcsaresa clcsarsea
clcsarsae clcsrsaae clcsrsaea clcsrsaae clcsrsaea clcsrseaa clcsrseaa clcsrasae clcsrasea clcsraase clcsraaes
clcsraeas clcsraesa clcsraase clcsraaes clcsrasae clcsrasea clcsraesa clcsraeas clcsreaas clcsreasa clcsreaas
clcsreasa clcsresaa clcsresaa clarescas clarescsa claresacs claresasc claressac claressca clarecsas clarecssa
clarecass clarecass clarecsas clarecssa clareacss clareacss clareascs clareassc clareassc clareascs clarescas
clarescsa claresacs claresasc claressac claressca clarsecas clarsecsa clarseacs clarseasc clarsesac clarsesca
clarsceas clarscesa clarscaes clarscase clarscsae clarscsea clarsaces clarsacse clarsaecs clarsaesc clarsasec
clarsasce clarsscae clarsscea clarssace clarssaec clarsseac clarsseca clarcseas clarcsesa clarcsaes clarcsase
clarcssae clarcssea clarcesas clarcessa clarceass clarceass clarcesas clarcessa clarcaess clarcaess clarcases
clarcasse clarcasse clarcases clarcseas clarcsesa clarcsaes clarcsase clarcssae clarcssea clarasces clarascse
clarasecs clarasesc clarassec clarassce claracses claracsse claracess claracess claracses claracsse claraecss
claraecss claraescs claraessc claraessc claraescs clarasces clarascse clarasecs clarasesc clarassec clarassce
clarsscae clarsscea clarssace clarssaec clarsseac clarsseca clarscsae clarscsea clarscase clarscaes clarsceas
clarscesa clarsacse clarsaces clarsasce clarsasec clarsaesc clarsaecs clarsecas clarsecsa clarseacs clarseasc
clarsesac clarsesca claerscas claerscsa claersacs claersasc claerssac claerssca claercsas claercssa claercass
claercass claercsas claercssa claeracss claeracss claerascs claerassc claerassc claerascs claerscas claerscsa
claersacs claersasc claerssac claerssca claesrcas claesrcsa claesracs claesrasc claesrsac claesrsca claescras
claescrsa claescars claescasr claescsar claescsra claesacrs claesacsr claesarcs claesarsc claesasrc claesascr
claesscar claesscra claessacr claessarc claessrac claessrca claecsras claecsrsa claecsars claecsasr claecssar
claecssra claecrsas claecrssa claecrass claecrass claecrsas claecrssa claecarss claecarss claecasrs claecassr
claecassr claecasrs claecsras claecsrsa claecsars claecsasr claecssar claecssra claeascrs claeascsr claeasrcs
claeasrsc claeassrc claeasscr claeacsrs claeacssr claeacrss claeacrss claeacsrs claeacssr claearcss claearcss
claearscs claearssc claearssc claearscs claeascrs claeascsr claeasrcs claeasrsc claeassrc claeasscr claesscar
claesscra claessacr claessarc claessrac claessrca claescsar claescsra claescasr claescars claescras claescrsa
claesacsr claesacrs claesascr claesasrc claesarsc claesarcs claesrcas claesrcsa claesracs claesrasc claesrsac
claesrsca clasercas clasercsa claseracs claserasc clasersac clasersca clasecras clasecrsa clasecars clasecasr
clasecsar clasecsra claseacrs claseacsr clasearcs clasearsc claseasrc claseascr clasescar clasescra clasesacr
clasesarc clasesrac clasesrca clasrecas clasrecsa clasreacs clasreasc clasresac clasresca clasrceas clasrcesa
clasrcaes clasrcase clasrcsae clasrcsea clasraces clasracse clasraecs clasraesc clasrasec clasrasce clasrscae
clasrscea clasrsace clasrsaec clasrseac clasrseca clascreas clascresa clascraes clascrase clascrsae clascrsea
clasceras clascersa clascears clasceasr clascesar clascesra clascaers clascaesr clascares clascarse clascasre
clascaser clascsear clascsera clascsaer clascsare clascsrae clascsrea clasarces clasarcse clasarecs clasaresc
clasarsec clasarsce clasacres clasacrse clasacers clasacesr clasacser clasacsre clasaecrs clasaecsr clasaercs
clasaersc clasaesrc clasaescr clasascer clasascre clasasecr clasaserc clasasrec clasasrce classrcae classrcea
classrace classraec classreac classreca classcrae classcrea classcare classcaer classcear classcera classacre
classacer classarce classarec classaerc classaecr classecar classecra classeacr classearc classerac classerca
clacesras clacesrsa clacesars clacesasr clacessar clacessra clacersas clacerssa clacerass clacerass clacersas
clacerssa clacearss clacearss claceasrs claceassr claceassr claceasrs clacesras clacesrsa clacesars clacesasr
clacessar clacessra clacseras clacsersa clacsears clacseasr clacsesar clacsesra clacsreas clacsresa clacsraes
clacsrase clacsrsae clacsrsea clacsares clacsarse clacsaers clacsaesr clacsaser clacsasre clacssrae clacssrea
clacssare clacssaer clacssear clacssera clacrseas clacrsesa clacrsaes clacrsase clacrssae clacrssea clacresas
clacressa clacreass clacreass clacresas clacressa clacraess clacraess clacrases clacrasse clacrasse clacrases
clacrseas clacrsesa clacrsaes clacrsase clacrssae clacrssea clacasres clacasrse clacasers clacasesr clacasser
clacassre clacarses clacarsse clacaress clacaress clacarses clacarsse clacaerss clacaerss clacaesrs clacaessr
clacaessr clacaesrs clacasres clacasrse clacasers clacasesr clacasser clacassre clacssrae clacssrea clacssare
clacssaer clacssear clacssera clacsrsae clacsrsea clacsrase clacsraes clacsreas clacsresa clacsarse clacsares
clacsasre clacsaser clacsaesr clacsaers clacseras clacsersa clacsears clacseasr clacsesar clacsesra claaescrs
claaescsr claaesrcs claaesrsc claaessrc claaesscr claaecsrs claaecssr claaecrss claaecrss claaecsrs claaecssr
claaercss claaercss claaerscs claaerssc claaerssc claaerscs claaescrs claaescsr claaesrcs claaesrsc claaessrc
claaesscr claasecrs claasecsr claasercs claasersc claasesrc claasescr claascers claascesr claascres claascrse
claascsre claascser claasrces claasrcse claasrecs claasresc claasrsec claasrsce claasscre claasscer claassrce
claassrec claasserc claassecr claacsers claacsesr claacsres claacsrse claacssre claacsser claacesrs claacessr
claacerss claacerss claacesrs claacessr claacress claacress claacrses claacrsse claacrsse claacrses claacsers
claacsesr claacsres claacsrse claacssre claacsser claarsces claarscse claarsecs claarsesc claarssec claarssce
claarcses claarcsse claarcess claarcess claarcses claarcsse claarecss claarecss claarescs claaressc claaressc
claarescs claarsces claarscse claarsecs claarsesc claarssec claarssce claasscre claasscer claassrce claassrec
claasserc claassecr claascsre claascser claascrse claascres claascers claascesr claasrcse claasrces claasrsce
claasrsec claasresc claasrecs claasecrs claasecsr claasercs claasersc claasesrc claasescr clasescar clasescra
clasesacr clasesarc clasesrac clasesrca clasecsar clasecsra clasecasr clasecars clasecras clasecrsa claseacsr
claseacrs claseascr claseasrc clasearsc clasearcs clasercas clasercsa claseracs claserasc clasersac clasersca
classecar classecra classeacr classearc classerac classerca classcear classcera classcaer classcare classcrae
classcrea classacer classacre classaecr classaerc classarec classarce classrcae classrcea classrace classraec
classreac classreca clascsear clascsera clascsaer clascsare clascsrae clascsrea clascesar clascesra clasceasr
clascears clasceras clascersa clascaesr clascaers clascaser clascasre clascarse clascares clascreas clascresa
clascraes clascrase clascrsae clascrsea clasascer clasascre clasasecr clasaserc clasasrec clasasrce clasacser
clasacsre clasacesr clasacers clasacres clasacrse clasaecsr clasaecrs clasaescr clasaesrc clasaersc clasaercs
clasarces clasarcse clasarecs clasaresc clasarsec clasarsce clasrscae clasrscea clasrsace clasrsaec clasrseac
clasrseca clasrcsae clasrcsea clasrcase clasrcaes clasrceas clasrcesa clasracse clasraces clasrasce clasrasec
clasraesc clasraecs clasrecas clasrecsa clasreacs clasreasc clasresac clasresca clsrescaa clsrescaa clsresaca
clsresaac clsresaac clsresaca clsrecsaa clsrecsaa clsrecasa clsrecaas clsrecaas clsrecasa clsreacsa clsreacas
clsreasca clsreasac clsreaasc clsreaacs clsreacas clsreacsa clsreaacs clsreaasc clsreasac clsreasca clsrsecaa
clsrsecaa clsrseaca clsrseaac clsrseaac clsrseaca clsrsceaa clsrsceaa clsrscaea clsrscaae clsrscaae clsrscaea
clsrsacea clsrsacae clsrsaeca clsrsaeac clsrsaaec clsrsaace clsrsacae clsrsacea clsrsaace clsrsaaec clsrsaeac
clsrsaeca clsrcseaa clsrcseaa clsrcsaea clsrcsaae clsrcsaae clsrcsaea clsrcesaa clsrcesaa clsrceasa clsrceaas
clsrceaas clsrceasa clsrcaesa clsrcaeas clsrcasea clsrcasae clsrcaase clsrcaaes clsrcaeas clsrcaesa clsrcaaes
clsrcaase clsrcasae clsrcasea clsrascea clsrascae clsraseca clsraseac clsrasaec clsrasace clsracsea clsracsae
clsracesa clsraceas clsracaes clsracase clsraecsa clsraecas clsraesca clsraesac clsraeasc clsraeacs clsraaces
clsraacse clsraaecs clsraaesc clsraasec clsraasce clsrascae clsrascea clsrasace clsrasaec clsraseac clsraseca
clsracsae clsracsea clsracase clsracaes clsraceas clsracesa clsraacse clsraaces clsraasce clsraasec clsraaesc
clsraaecs clsraecas clsraecsa clsraeacs clsraeasc clsraesac clsraesca clserscaa clserscaa clsersaca clsersaac
clsersaac clsersaca clsercsaa clsercsaa clsercasa clsercaas clsercaas clsercasa clseracsa clseracas clserasca
clserasac clseraasc clseraacs clseracas clseracsa clseraacs clseraasc clserasac clserasca clsesrcaa clsesrcaa
clsesraca clsesraac clsesraac clsesraca clsescraa clsescraa clsescara clsescaar clsescaar clsescara clsesacra
clsesacar clsesarca clsesarac clsesaarc clsesaacr clsesacar clsesacra clsesaacr clsesaarc clsesarac clsesarca
clsecsraa clsecsraa clsecsara clsecsaar clsecsaar clsecsara clsecrsaa clsecrsaa clsecrasa clsecraas clsecraas
clsecrasa clsecarsa clsecaras clsecasra clsecasar clsecaasr clsecaars clsecaras clsecarsa clsecaars clsecaasr
clsecasar clsecasra clseascra clseascar clseasrca clseasrac clseasarc clseasacr clseacsra clseacsar clseacrsa
clseacras clseacars clseacasr clsearcsa clsearcas clsearsca clsearsac clsearasc clsearacs clseaacrs clseaacsr
clseaarcs clseaarsc clseaasrc clseaascr clseascar clseascra clseasacr clseasarc clseasrac clseasrca clseacsar
clseacsra clseacasr clseacars clseacras clseacrsa clseaacsr clseaacrs clseaascr clseaasrc clseaarsc clseaarcs
clsearcas clsearcsa clsearacs clsearasc clsearsac clsearsca clssercaa clssercaa clsseraca clsseraac clsseraac
clsseraca clssecraa clssecraa clssecara clssecaar clssecaar clssecara clsseacra clsseacar clssearca clssearac
clsseaarc clsseaacr clsseacar clsseacra clsseaacr clsseaarc clssearac clssearca clssrecaa clssrecaa clssreaca
clssreaac clssreaac clssreaca clssrceaa clssrceaa clssrcaea clssrcaae clssrcaae clssrcaea clssracea clssracae
clssraeca clssraeac clssraaec clssraace clssracae clssracea clssraace clssraaec clssraeac clssraeca clsscreaa
clsscreaa clsscraea clsscraae clsscraae clsscraea clssceraa clssceraa clssceara clssceaar clssceaar clssceara
clsscaera clsscaear clsscarea clsscarae clsscaare clsscaaer clsscaear clsscaera clsscaaer clsscaare clsscarae
clsscarea clssarcea clssarcae clssareca clssareac clssaraec clssarace clssacrea clssacrae clssacera clssacear
clssacaer clssacare clssaecra clssaecar clssaerca clssaerac clssaearc clssaeacr clssaacer clssaacre clssaaecr
clssaaerc clssaarec clssaarce clssarcae clssarcea clssarace clssaraec clssareac clssareca clssacrae clssacrea
clssacare clssacaer clssacear clssacera clssaacre clssaacer clssaarce clssaarec clssaaerc clssaaecr clssaecar
clssaecra clssaeacr clssaearc clssaerac clssaerca clscesraa clscesraa clscesara clscesaar clscesaar clscesara
clscersaa clscersaa clscerasa clsceraas clsceraas clscerasa clscearsa clscearas clsceasra clsceasar clsceaasr
clsceaars clscearas clscearsa clsceaars clsceaasr clsceasar clsceasra clscseraa clscseraa clscseara clscseaar
clscseaar clscseara clscsreaa clscsreaa clscsraea clscsraae clscsraae clscsraea clscsarea clscsarae clscsaera
clscsaear clscsaaer clscsaare clscsarae clscsarea clscsaare clscsaaer clscsaear clscsaera clscrseaa clscrseaa
clscrsaea clscrsaae clscrsaae clscrsaea clscresaa clscresaa clscreasa clscreaas clscreaas clscreasa clscraesa
clscraeas clscrasea clscrasae clscraase clscraaes clscraeas clscraesa clscraaes clscraase clscrasae clscrasea
clscasrea clscasrae clscasera clscasear clscasaer clscasare clscarsea clscarsae clscaresa clscareas clscaraes
clscarase clscaersa clscaeras clscaesra clscaesar clscaeasr clscaears clscaares clscaarse clscaaers clscaaesr
clscaaser clscaasre clscasrae clscasrea clscasare clscasaer clscasear clscasera clscarsae clscarsea clscarase
clscaraes clscareas clscaresa clscaarse clscaares clscaasre clscaaser clscaaesr clscaaers clscaeras clscaersa
clscaears clscaeasr clscaesar clscaesra clsaescra clsaescar clsaesrca clsaesrac clsaesarc clsaesacr clsaecsra
clsaecsar clsaecrsa clsaecras clsaecars clsaecasr clsaercsa clsaercas clsaersca clsaersac clsaerasc clsaeracs
clsaeacrs clsaeacsr clsaearcs clsaearsc clsaeasrc clsaeascr clsasecra clsasecar clsaserca clsaserac clsasearc
clsaseacr clsascera clsascear clsascrea clsascrae clsascare clsascaer clsasrcea clsasrcae clsasreca clsasreac
clsasraec clsasrace clsasacre clsasacer clsasarce clsasarec clsasaerc clsasaecr clsacsera clsacsear clsacsrea
clsacsrae clsacsare clsacsaer clsacesra clsacesar clsacersa clsaceras clsacears clsaceasr clsacresa clsacreas
clsacrsea clsacrsae clsacrase clsacraes clsacaers clsacaesr clsacares clsacarse clsacasre clsacaser clsarscea
clsarscae clsarseca clsarseac clsarsaec clsarsace clsarcsea clsarcsae clsarcesa clsarceas clsarcaes clsarcase
clsarecsa clsarecas clsaresca clsaresac clsareasc clsareacs clsaraces clsaracse clsaraecs clsaraesc clsarasec
clsarasce clsaascre clsaascer clsaasrce clsaasrec clsaaserc clsaasecr clsaacsre clsaacser clsaacrse clsaacres
clsaacers clsaacesr clsaarcse clsaarces clsaarsce clsaarsec clsaaresc clsaarecs clsaaecrs clsaaecsr clsaaercs
clsaaersc clsaaesrc clsaaescr clsaescar clsaescra clsaesacr clsaesarc clsaesrac clsaesrca clsaecsar clsaecsra
clsaecasr clsaecars clsaecras clsaecrsa clsaeacsr clsaeacrs clsaeascr clsaeasrc clsaearsc clsaearcs clsaercas
clsaercsa clsaeracs clsaerasc clsaersac clsaersca clsasecar clsasecra clsaseacr clsasearc clsaserac clsaserca
clsascear clsascera clsascaer clsascare clsascrae clsascrea clsasacer clsasacre clsasaecr clsasaerc clsasarec
clsasarce clsasrcae clsasrcea clsasrace clsasraec clsasreac clsasreca clsacsear clsacsera clsacsaer clsacsare
clsacsrae clsacsrea clsacesar clsacesra clsaceasr clsacears clsaceras clsacersa clsacaesr clsacaers clsacaser
clsacasre clsacarse clsacares clsacreas clsacresa clsacraes clsacrase clsacrsae clsacrsea clsaascer clsaascre
clsaasecr clsaaserc clsaasrec clsaasrce clsaacser clsaacsre clsaacesr clsaacers clsaacres clsaacrse clsaaecsr
clsaaecrs clsaaescr clsaaesrc clsaaersc clsaaercs clsaarces clsaarcse clsaarecs clsaaresc clsaarsec clsaarsce
clsarscae clsarscea clsarsace clsarsaec clsarseac clsarseca clsarcsae clsarcsea clsarcase clsarcaes clsarceas
clsarcesa clsaracse clsaraces clsarasce clsarasec clsaraesc clsaraecs clsarecas clsarecsa clsareacs clsareasc
clsaresac clsaresca

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us