easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

solidamque

yocco

aillt

ecolpd

snyders

monteclaro

autophonoscope

ushership

dejarnett

gestaque

schurenberg

schaufler

stfeptomyces

tutaminis

maruizio

tetigeritque

impacter

nebulation


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: circumdemurque
cipher variations:
djsdvnefnvsrvf ektewofgowtswg flufxpghpxutxh gmvgyqhiqyvuyi hnwhzrijrzwvzj
ioxiasjksaxwak jpyjbtkltbyxbl kqzkculmuczycm lraldvmnvdazdn msbmewnowebaeo
ntcnfxopxfcbfp oudogypqygdcgq pvephzqrzhedhr qwfqiarsaifeis rxgrjbstbjgfjt
syhskctuckhgku tzitlduvdlihlv uajumevwemjimw vbkvnfwxfnkjnx wclwogxygolkoy
xdmxphyzhpmlpz yenyqizaiqnmqa zfozrjabjronrb agpaskbcksposc bhqbtlcdltqptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: circumdemurque
Cipher: xrixfnwvnfijfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: circumdemurque
Cipher: AAABA ABAAA BAAAA AAABA BAABB ABABB AAABB AABAA ABABB BAABB BAAAA ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: circumdemurque
cipher variations:
djsdvnefnvsrvfhzahjlknljaxjnlpilxjqvjxidxvpfqplhwdhlqjldtvytzfclfzypzlxlgxnditdngvntfrwfpzujzpwhpjjhejdxarxdendr
nxmnrvgzvrmtrzrnurftmhtfuzfhvdcvtrsprtcftpztkzhpyxphklhxektewofgowtswgiabikmlomkbykomqjmykrwkyjeywqgrqmixeimrkme
uwzuagdmgazqamymhyoejueohwougsxgqavkaqxiqkkifkeybsyefoesoynoswhawsnusasovsguniugvagiwedwustqsudguqaulaiqzyqilmiy
flufxpghpxutxhjbcjlnmpnlczlpnrknzlsxlzkfzxrhsrnjyfjnslnfvxavbhenhbarbnznizpfkvfpixpvhtyhrbwlbryjrlljglfzctzfgpft
pzoptxibxtovtbtpwthvojvhwbhjxfexvturtvehvrbvmbjrazrjmnjzgmvgyqhiqyvuyikcdkmonqomdamqosloamtymalgaysitsokzgkotmog
wybwcifoicbscoaojaqglwgqjyqwiuziscxmcszksmmkhmgaduaghqguqapquyjcyupwucuqxuiwpkwixcikygfywuvsuwfiwscwncksbasknoka
hnwhzrijrzwvzjldelnporpnebnrptmpbnuznbmhbztjutplahlpunphxzcxdjgpjdctdpbpkbrhmxhrkzrxjvajtdyndtaltnnlinhbevbhirhv
rbqrvzkdzvqxvdvryvjxqlxjydjlzhgzxvwtvxgjxtdxodltcbtloplbioxiasjksaxwakmefmoqpsqofcosqunqcovaocnicaukvuqmbimqvoqi
yadyekhqkedueqcqlcsinyislasykwbkuezoeubmuoomjoicfwcijsiwscrswaleawrywewszwkyrmykzekmaihaywxuwyhkyueypemudcumpqmc
jpyjbtkltbyxblnfgnprqtrpgdptrvordpwbpdojdbvlwvrncjnrwprjzbezflirlfevfrdrmdtjozjtmbtzlxclvfapfvcnvppnkpjdgxdjktjx
tdstxbmfbxszxfxtaxlzsnzlaflnbjibzxyvxzilzvfzqfnvedvnqrndkqzkculmuczycmoghoqsrusqhequswpseqxcqepkecwmxwsodkosxqsk
acfagmjsmgfwgsesneukpakuncuamydmwgbqgwdowqqolqkehyeklukyuetuycngcytaygyubymatoambgmockjcayzwyajmawgargowfeworsoe
lraldvmnvdazdnphiprtsvtrifrvtxqtfrydrfqlfdxnyxtpelptyrtlbdgbhnktnhgxhtftofvlqblvodvbnzenxhcrhxepxrrpmrlfizflmvlz
vfuvzdohdzubzhzvcznbupbnchnpdlkdbzaxzbknbxhbshpxgfxpstpfmsbmewnowebaeoqijqsutwusjgswuyrugszesgrmgeyozyuqfmquzsum
cehcioluoihyiugupgwmrcmwpewcoafoyidsiyfqyssqnsmgjagmnwmawgvwaepieavcaiawdaocvqcodioqemlecabyaclocyictiqyhgyqtuqg
ntcnfxopxfcbfprjkrtvuxvtkhtxvzsvhtafthsnhfzpazvrgnrvatvndfidjpmvpjizjvhvqhxnsdnxqfxdpbgpzjetjzgrzttrotnhkbhnoxnb
xhwxbfqjfbwdbjbxebpdwrdpejprfnmfdbczbdmpdzjdujrzihzruvrhoudogypqygdcgqsklsuwvywuliuywatwiubguitoigaqbawshoswbuwo
egjekqnwqkjakwiwriyoteoyrgyeqchqakfukahsauuspuoilciopyocyixycgrkgcxeckcyfcqexseqfkqsgongecdacenqeakevksajiasvwsi
pvephzqrzhedhrtlmtvxwzxvmjvzxbuxjvchvjupjhbrcbxtiptxcvxpfhkflroxrlkblxjxsjzpufpzshzfrdirblgvlbitbvvtqvpjmdjpqzpd
zjyzdhslhdyfdldzgdrfytfrglrthpohfdebdforfblfwltbkjbtwxtjqwfqiarsaifeisumnuwyxaywnkwaycvykwdiwkvqkicsdcyujquydwyq
gilgmspysmlcmykytkaqvgqatiagsejscmhwmcjucwwurwqknekqraqeakzaeitmiezgemeahesgzugshmsuiqpigefcegpsgcmgxmuclkcuxyuk
rxgrjbstbjgfjtvnovxzybzxolxbzdwzlxejxlwrljdtedzvkrvzexzrhjmhntqztnmdnzlzulbrwhrbujbhtfktdnixndkvdxxvsxrloflrsbrf
blabfjunjfahfnfbifthavhtintvjrqjhfgdfhqthdnhynvdmldvyzvlsyhskctuckhgkuwopwyazcaypmycaexamyfkymxsmkeufeawlswafyas
ikniourauoneoamavmcsxiscvkciuglueojyoelweyywtysmpgmstcsgcmbcgkvokgbigogcjguibwiujouwksrkighegiruieoizowenmewzawm
tzitlduvdlihlvxpqxzbadbzqnzdbfybnzglznytnlfvgfbxmtxbgzbtjlojpvsbvpofpbnbwndtyjtdwldjvhmvfpkzpfmxfzzxuztnqhntudth
dncdhlwplhcjhphdkhvjcxjvkpvxltsljhifhjsvjfpjapxfonfxabxnuajumevwemjimwyqryacbecaroaecgzcoahmaozuomgwhgcynuychacu
kmpkqwtcwqpgqcocxoeuzkuexmekwinwgqlaqgnygaayvauoriouveuieodeimxqmidkiqieliwkdykwlqwymutmkijgiktwkgqkbqygpogybcyo
vbkvnfwxfnkjnxzrszbdcfdbspbfdhadpbinbpavpnhxihdzovzdibdvlnqlrxudxrqhrdpdypfvalvfynflxjoxhrmbrhozhbbzwbvpsjpvwfvj
fpefjnyrnjeljrjfmjxlezlxmrxznvunljkhjluxlhrlcrzhqphzcdzpwclwogxygolkoyastacedgectqcgeibeqcjocqbwqoiyjieapwaejcew
mormsyveysriseqezqgwbmwgzogmykpyisncsipaiccaxcwqtkqwxgwkgqfgkozsokfmkskgnkymfamynsyaowvomklikmvymismdsairqiadeaq
xdmxphyzhpmlpzbtubdfehfdurdhfjcfrdkpdrcxrpjzkjfbqxbfkdfxnpsntzwfztsjtfrfarhxcnxhaphnzlqzjtodtjqbjddbydxrulrxyhxl
hrghlpatplgnltlholzngbnzotzbpxwpnlmjlnwznjtnetbjsrjbefbryenyqizaiqnmqacuvcegfigevseigkdgselqesdysqkalkgcrycglegy
oqtouaxgautkugsgbsiydoyibqioamrakupeukrckeeczeysvmsyziymishimqbuqmhomumipmaohcoapuacqyxqomnkmoxaokuofucktskcfgcs
zfozrjabjronrbdvwdfhgjhfwtfjhlehtfmrfteztrlbmlhdszdhmfhzprupvbyhbvulvhthctjzepzjcrjpbnsblvqfvlsdlffdafztwntzajzn
jtijnrcvrnipnvnjqnbpidpbqvbdrzyrpnolnpybplvpgvdlutldghdtagpaskbcksposcewxegihkigxugkimfiugnsgufausmcnmietaeingia
qsvqwczicwvmwiuidukafqakdskqcotcmwrgwmtemggebgauxouabkaokujkosdwsojqowokrocqjeqcrwcesazsqopmoqzcqmwqhwemvumehieu
bhqbtlcdltqptdfxyfhjiljhyvhljngjvhothvgbvtndonjfubfjohjbrtwrxdajdxwnxjvjevlbgrbletlrdpudnxshxnufnhhfchbvypvbclbp
lvklptextpkrpxplspdrkfrdsxdftbatrpqnpradrnxrixfnwvnfijfvcircumdemurquegyzgikjmkizwimkohkwipuiwhcwuoepokgvcgkpikc
suxsyebkeyxoykwkfwmchscmfumseqveoytiyovgoiigdicwzqwcdmcqmwlmqufyuqlsqyqmtqeslgsetyegucbusqroqsbesoysjygoxwogjkgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: circumdemurque
Cipher: pvephzqrzhedhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: circumdemurque
Cipher: 3142243154234151235424145451

Extended Methods:
Method #1

Plaintext: circumdemurque
method variations:
howhzrikrzwvzkntbnewopwebaepsygskbtubkgfkuxdmxpgyzgpmlpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
c i r c u m d e m u r q u e 
3 4 2 3 5 2 4 5 2 5 2 1 5 5 
1 2 4 1 4 3 1 1 3 4 4 4 4 1 
They are then read out in rows:
3423524525215512414311344441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: circumdemurque
Cipher: smkywbzfdoastd

Read more ...
Method #3

Plaintext: circumdemurque
method variations:
qgovisvfxidyyl govisvfxidyylq ovisvfxidyylqg
visvfxidyylqgo isvfxidyylqgov svfxidyylqgovi
vfxidyylqgovis fxidyylqgovisv xidyylqgovisvf
idyylqgovisvfx dyylqgovisvfxi yylqgovisvfxid
ylqgovisvfxidy lqgovisvfxidyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: circumdemurque

first 5040 cipher variations(86661001946 total)
circumdemurque circumdemurqeu circumdemuruqe circumdemurueq circumdemureuq circumdemurequ circumdemuqrue circumdemuqreu
circumdemuqure circumdemuquer circumdemuqeur circumdemuqeru circumdemuuqre circumdemuuqer circumdemuurqe circumdemuureq
circumdemuuerq circumdemuueqr circumdemuequr circumdemueqru circumdemueuqr circumdemueurq circumdemueruq circumdemuerqu
circumdemruque circumdemruqeu circumdemruuqe circumdemruueq circumdemrueuq circumdemruequ circumdemrquue circumdemrqueu
circumdemrquue circumdemrqueu circumdemrqeuu circumdemrqeuu circumdemruque circumdemruqeu circumdemruuqe circumdemruueq
circumdemrueuq circumdemruequ circumdemrequu circumdemrequu circumdemreuqu circumdemreuuq circumdemreuuq circumdemreuqu
circumdemqruue circumdemqrueu circumdemqruue circumdemqrueu circumdemqreuu circumdemqreuu circumdemqurue circumdemqureu
circumdemquure circumdemquuer circumdemqueur circumdemqueru circumdemquure circumdemquuer circumdemqurue circumdemqureu
circumdemqueru circumdemqueur circumdemqeuur circumdemqeuru circumdemqeuur circumdemqeuru circumdemqeruu circumdemqeruu
circumdemurque circumdemurqeu circumdemuruqe circumdemurueq circumdemureuq circumdemurequ circumdemuqrue circumdemuqreu
circumdemuqure circumdemuquer circumdemuqeur circumdemuqeru circumdemuuqre circumdemuuqer circumdemuurqe circumdemuureq
circumdemuuerq circumdemuueqr circumdemuequr circumdemueqru circumdemueuqr circumdemueurq circumdemueruq circumdemuerqu
circumdemerquu circumdemerquu circumdemeruqu circumdemeruuq circumdemeruuq circumdemeruqu circumdemeqruu circumdemeqruu
circumdemequru circumdemequur circumdemequur circumdemequru circumdemeuqru circumdemeuqur circumdemeurqu circumdemeuruq
circumdemeuurq circumdemeuuqr circumdemeuqur circumdemeuqru circumdemeuuqr circumdemeuurq circumdemeuruq circumdemeurqu
circumdeumrque circumdeumrqeu circumdeumruqe circumdeumrueq circumdeumreuq circumdeumrequ circumdeumqrue circumdeumqreu
circumdeumqure circumdeumquer circumdeumqeur circumdeumqeru circumdeumuqre circumdeumuqer circumdeumurqe circumdeumureq
circumdeumuerq circumdeumueqr circumdeumequr circumdeumeqru circumdeumeuqr circumdeumeurq circumdeumeruq circumdeumerqu
circumdeurmque circumdeurmqeu circumdeurmuqe circumdeurmueq circumdeurmeuq circumdeurmequ circumdeurqmue circumdeurqmeu
circumdeurqume circumdeurquem circumdeurqeum circumdeurqemu circumdeuruqme circumdeuruqem circumdeurumqe circumdeurumeq
circumdeuruemq circumdeurueqm circumdeurequm circumdeureqmu circumdeureuqm circumdeureumq circumdeuremuq circumdeuremqu
circumdeuqrmue circumdeuqrmeu circumdeuqrume circumdeuqruem circumdeuqreum circumdeuqremu circumdeuqmrue circumdeuqmreu
circumdeuqmure circumdeuqmuer circumdeuqmeur circumdeuqmeru circumdeuqumre circumdeuqumer circumdeuqurme circumdeuqurem
circumdeuquerm circumdeuquemr circumdeuqemur circumdeuqemru circumdeuqeumr circumdeuqeurm circumdeuqerum circumdeuqermu
circumdeuurqme circumdeuurqem circumdeuurmqe circumdeuurmeq circumdeuuremq circumdeuureqm circumdeuuqrme circumdeuuqrem
circumdeuuqmre circumdeuuqmer circumdeuuqemr circumdeuuqerm circumdeuumqre circumdeuumqer circumdeuumrqe circumdeuumreq
circumdeuumerq circumdeuumeqr circumdeuueqmr circumdeuueqrm circumdeuuemqr circumdeuuemrq circumdeuuermq circumdeuuerqm
circumdeuerqum circumdeuerqmu circumdeueruqm circumdeuerumq circumdeuermuq circumdeuermqu circumdeueqrum circumdeueqrmu
circumdeuequrm circumdeuequmr circumdeueqmur circumdeueqmru circumdeueuqrm circumdeueuqmr circumdeueurqm circumdeueurmq
circumdeueumrq circumdeueumqr circumdeuemqur circumdeuemqru circumdeuemuqr circumdeuemurq circumdeuemruq circumdeuemrqu
circumderumque circumderumqeu circumderumuqe circumderumueq circumderumeuq circumderumequ circumderuqmue circumderuqmeu
circumderuqume circumderuquem circumderuqeum circumderuqemu circumderuuqme circumderuuqem circumderuumqe circumderuumeq
circumderuuemq circumderuueqm circumderuequm circumderueqmu circumderueuqm circumderueumq circumderuemuq circumderuemqu
circumdermuque circumdermuqeu circumdermuuqe circumdermuueq circumdermueuq circumdermuequ circumdermquue circumdermqueu
circumdermquue circumdermqueu circumdermqeuu circumdermqeuu circumdermuque circumdermuqeu circumdermuuqe circumdermuueq
circumdermueuq circumdermuequ circumdermequu circumdermequu circumdermeuqu circumdermeuuq circumdermeuuq circumdermeuqu
circumderqmuue circumderqmueu circumderqmuue circumderqmueu circumderqmeuu circumderqmeuu circumderqumue circumderqumeu
circumderquume circumderquuem circumderqueum circumderquemu circumderquume circumderquuem circumderqumue circumderqumeu
circumderquemu circumderqueum circumderqeuum circumderqeumu circumderqeuum circumderqeumu circumderqemuu circumderqemuu
circumderumque circumderumqeu circumderumuqe circumderumueq circumderumeuq circumderumequ circumderuqmue circumderuqmeu
circumderuqume circumderuquem circumderuqeum circumderuqemu circumderuuqme circumderuuqem circumderuumqe circumderuumeq
circumderuuemq circumderuueqm circumderuequm circumderueqmu circumderueuqm circumderueumq circumderuemuq circumderuemqu
circumderemquu circumderemquu circumderemuqu circumderemuuq circumderemuuq circumderemuqu circumdereqmuu circumdereqmuu
circumderequmu circumderequum circumderequum circumderequmu circumdereuqmu circumdereuqum circumdereumqu circumdereumuq
circumdereuumq circumdereuuqm circumdereuqum circumdereuqmu circumdereuuqm circumdereuumq circumdereumuq circumdereumqu
circumdequrmue circumdequrmeu circumdequrume circumdequruem circumdequreum circumdequremu circumdequmrue circumdequmreu
circumdequmure circumdequmuer circumdequmeur circumdequmeru circumdequumre circumdequumer circumdequurme circumdequurem
circumdequuerm circumdequuemr circumdequemur circumdequemru circumdequeumr circumdequeurm circumdequerum circumdequermu
circumdeqrumue circumdeqrumeu circumdeqruume circumdeqruuem circumdeqrueum circumdeqruemu circumdeqrmuue circumdeqrmueu
circumdeqrmuue circumdeqrmueu circumdeqrmeuu circumdeqrmeuu circumdeqrumue circumdeqrumeu circumdeqruume circumdeqruuem
circumdeqrueum circumdeqruemu circumdeqremuu circumdeqremuu circumdeqreumu circumdeqreuum circumdeqreuum circumdeqreumu
circumdeqmruue circumdeqmrueu circumdeqmruue circumdeqmrueu circumdeqmreuu circumdeqmreuu circumdeqmurue circumdeqmureu
circumdeqmuure circumdeqmuuer circumdeqmueur circumdeqmueru circumdeqmuure circumdeqmuuer circumdeqmurue circumdeqmureu
circumdeqmueru circumdeqmueur circumdeqmeuur circumdeqmeuru circumdeqmeuur circumdeqmeuru circumdeqmeruu circumdeqmeruu
circumdequrmue circumdequrmeu circumdequrume circumdequruem circumdequreum circumdequremu circumdequmrue circumdequmreu
circumdequmure circumdequmuer circumdequmeur circumdequmeru circumdequumre circumdequumer circumdequurme circumdequurem
circumdequuerm circumdequuemr circumdequemur circumdequemru circumdequeumr circumdequeurm circumdequerum circumdequermu
circumdeqermuu circumdeqermuu circumdeqerumu circumdeqeruum circumdeqeruum circumdeqerumu circumdeqemruu circumdeqemruu
circumdeqemuru circumdeqemuur circumdeqemuur circumdeqemuru circumdeqeumru circumdeqeumur circumdeqeurmu circumdeqeurum
circumdeqeuurm circumdeqeuumr circumdeqeumur circumdeqeumru circumdeqeuumr circumdeqeuurm circumdeqeurum circumdeqeurmu
circumdeuurqme circumdeuurqem circumdeuurmqe circumdeuurmeq circumdeuuremq circumdeuureqm circumdeuuqrme circumdeuuqrem
circumdeuuqmre circumdeuuqmer circumdeuuqemr circumdeuuqerm circumdeuumqre circumdeuumqer circumdeuumrqe circumdeuumreq
circumdeuumerq circumdeuumeqr circumdeuueqmr circumdeuueqrm circumdeuuemqr circumdeuuemrq circumdeuuermq circumdeuuerqm
circumdeuruqme circumdeuruqem circumdeurumqe circumdeurumeq circumdeuruemq circumdeurueqm circumdeurqume circumdeurquem
circumdeurqmue circumdeurqmeu circumdeurqemu circumdeurqeum circumdeurmque circumdeurmqeu circumdeurmuqe circumdeurmueq
circumdeurmeuq circumdeurmequ circumdeureqmu circumdeurequm circumdeuremqu circumdeuremuq circumdeureumq circumdeureuqm
circumdeuqrume circumdeuqruem circumdeuqrmue circumdeuqrmeu circumdeuqremu circumdeuqreum circumdeuqurme circumdeuqurem
circumdeuqumre circumdeuqumer circumdeuquemr circumdeuquerm circumdeuqmure circumdeuqmuer circumdeuqmrue circumdeuqmreu
circumdeuqmeru circumdeuqmeur circumdeuqeumr circumdeuqeurm circumdeuqemur circumdeuqemru circumdeuqermu circumdeuqerum
circumdeumrque circumdeumrqeu circumdeumruqe circumdeumrueq circumdeumreuq circumdeumrequ circumdeumqrue circumdeumqreu
circumdeumqure circumdeumquer circumdeumqeur circumdeumqeru circumdeumuqre circumdeumuqer circumdeumurqe circumdeumureq
circumdeumuerq circumdeumueqr circumdeumequr circumdeumeqru circumdeumeuqr circumdeumeurq circumdeumeruq circumdeumerqu
circumdeuerqmu circumdeuerqum circumdeuermqu circumdeuermuq circumdeuerumq circumdeueruqm circumdeueqrmu circumdeueqrum
circumdeueqmru circumdeueqmur circumdeuequmr circumdeuequrm circumdeuemqru circumdeuemqur circumdeuemrqu circumdeuemruq
circumdeuemurq circumdeuemuqr circumdeueuqmr circumdeueuqrm circumdeueumqr circumdeueumrq circumdeueurmq circumdeueurqm
circumdeeurqum circumdeeurqmu circumdeeuruqm circumdeeurumq circumdeeurmuq circumdeeurmqu circumdeeuqrum circumdeeuqrmu
circumdeeuqurm circumdeeuqumr circumdeeuqmur circumdeeuqmru circumdeeuuqrm circumdeeuuqmr circumdeeuurqm circumdeeuurmq
circumdeeuumrq circumdeeuumqr circumdeeumqur circumdeeumqru circumdeeumuqr circumdeeumurq circumdeeumruq circumdeeumrqu
circumdeeruqum circumdeeruqmu circumdeeruuqm circumdeeruumq circumdeerumuq circumdeerumqu circumdeerquum circumdeerqumu
circumdeerquum circumdeerqumu circumdeerqmuu circumdeerqmuu circumdeeruqum circumdeeruqmu circumdeeruuqm circumdeeruumq
circumdeerumuq circumdeerumqu circumdeermquu circumdeermquu circumdeermuqu circumdeermuuq circumdeermuuq circumdeermuqu
circumdeeqruum circumdeeqrumu circumdeeqruum circumdeeqrumu circumdeeqrmuu circumdeeqrmuu circumdeequrum circumdeequrmu
circumdeequurm circumdeequumr circumdeequmur circumdeequmru circumdeequurm circumdeequumr circumdeequrum circumdeequrmu
circumdeequmru circumdeequmur circumdeeqmuur circumdeeqmuru circumdeeqmuur circumdeeqmuru circumdeeqmruu circumdeeqmruu
circumdeeurqum circumdeeurqmu circumdeeuruqm circumdeeurumq circumdeeurmuq circumdeeurmqu circumdeeuqrum circumdeeuqrmu
circumdeeuqurm circumdeeuqumr circumdeeuqmur circumdeeuqmru circumdeeuuqrm circumdeeuuqmr circumdeeuurqm circumdeeuurmq
circumdeeuumrq circumdeeuumqr circumdeeumqur circumdeeumqru circumdeeumuqr circumdeeumurq circumdeeumruq circumdeeumrqu
circumdeemrquu circumdeemrquu circumdeemruqu circumdeemruuq circumdeemruuq circumdeemruqu circumdeemqruu circumdeemqruu
circumdeemquru circumdeemquur circumdeemquur circumdeemquru circumdeemuqru circumdeemuqur circumdeemurqu circumdeemuruq
circumdeemuurq circumdeemuuqr circumdeemuqur circumdeemuqru circumdeemuuqr circumdeemuurq circumdeemuruq circumdeemurqu
circumdmeurque circumdmeurqeu circumdmeuruqe circumdmeurueq circumdmeureuq circumdmeurequ circumdmeuqrue circumdmeuqreu
circumdmeuqure circumdmeuquer circumdmeuqeur circumdmeuqeru circumdmeuuqre circumdmeuuqer circumdmeuurqe circumdmeuureq
circumdmeuuerq circumdmeuueqr circumdmeuequr circumdmeueqru circumdmeueuqr circumdmeueurq circumdmeueruq circumdmeuerqu
circumdmeruque circumdmeruqeu circumdmeruuqe circumdmeruueq circumdmerueuq circumdmeruequ circumdmerquue circumdmerqueu
circumdmerquue circumdmerqueu circumdmerqeuu circumdmerqeuu circumdmeruque circumdmeruqeu circumdmeruuqe circumdmeruueq
circumdmerueuq circumdmeruequ circumdmerequu circumdmerequu circumdmereuqu circumdmereuuq circumdmereuuq circumdmereuqu
circumdmeqruue circumdmeqrueu circumdmeqruue circumdmeqrueu circumdmeqreuu circumdmeqreuu circumdmequrue circumdmequreu
circumdmequure circumdmequuer circumdmequeur circumdmequeru circumdmequure circumdmequuer circumdmequrue circumdmequreu
circumdmequeru circumdmequeur circumdmeqeuur circumdmeqeuru circumdmeqeuur circumdmeqeuru circumdmeqeruu circumdmeqeruu
circumdmeurque circumdmeurqeu circumdmeuruqe circumdmeurueq circumdmeureuq circumdmeurequ circumdmeuqrue circumdmeuqreu
circumdmeuqure circumdmeuquer circumdmeuqeur circumdmeuqeru circumdmeuuqre circumdmeuuqer circumdmeuurqe circumdmeuureq
circumdmeuuerq circumdmeuueqr circumdmeuequr circumdmeueqru circumdmeueuqr circumdmeueurq circumdmeueruq circumdmeuerqu
circumdmeerquu circumdmeerquu circumdmeeruqu circumdmeeruuq circumdmeeruuq circumdmeeruqu circumdmeeqruu circumdmeeqruu
circumdmeequru circumdmeequur circumdmeequur circumdmeequru circumdmeeuqru circumdmeeuqur circumdmeeurqu circumdmeeuruq
circumdmeeuurq circumdmeeuuqr circumdmeeuqur circumdmeeuqru circumdmeeuuqr circumdmeeuurq circumdmeeuruq circumdmeeurqu
circumdmuerque circumdmuerqeu circumdmueruqe circumdmuerueq circumdmuereuq circumdmuerequ circumdmueqrue circumdmueqreu
circumdmuequre circumdmuequer circumdmueqeur circumdmueqeru circumdmueuqre circumdmueuqer circumdmueurqe circumdmueureq
circumdmueuerq circumdmueueqr circumdmueequr circumdmueeqru circumdmueeuqr circumdmueeurq circumdmueeruq circumdmueerqu
circumdmureque circumdmureqeu circumdmureuqe circumdmureueq circumdmureeuq circumdmureequ circumdmurqeue circumdmurqeeu
circumdmurquee circumdmurquee circumdmurqeue circumdmurqeeu circumdmuruqee circumdmuruqee circumdmurueqe circumdmurueeq
circumdmurueeq circumdmurueqe circumdmureque circumdmureqeu circumdmureuqe circumdmureueq circumdmureeuq circumdmureequ
circumdmuqreue circumdmuqreeu circumdmuqruee circumdmuqruee circumdmuqreue circumdmuqreeu circumdmuqerue circumdmuqereu
circumdmuqeure circumdmuqeuer circumdmuqeeur circumdmuqeeru circumdmuquere circumdmuqueer circumdmuquree circumdmuquree
circumdmuquere circumdmuqueer circumdmuqeeur circumdmuqeeru circumdmuqeuer circumdmuqeure circumdmuqerue circumdmuqereu
circumdmuurqee circumdmuurqee circumdmuureqe circumdmuureeq circumdmuureeq circumdmuureqe circumdmuuqree circumdmuuqree
circumdmuuqere circumdmuuqeer circumdmuuqeer circumdmuuqere circumdmuueqre circumdmuueqer circumdmuuerqe circumdmuuereq
circumdmuueerq circumdmuueeqr circumdmuueqer circumdmuueqre circumdmuueeqr circumdmuueerq circumdmuuereq circumdmuuerqe
circumdmuerque circumdmuerqeu circumdmueruqe circumdmuerueq circumdmuereuq circumdmuerequ circumdmueqrue circumdmueqreu
circumdmuequre circumdmuequer circumdmueqeur circumdmueqeru circumdmueuqre circumdmueuqer circumdmueurqe circumdmueureq
circumdmueuerq circumdmueueqr circumdmueequr circumdmueeqru circumdmueeuqr circumdmueeurq circumdmueeruq circumdmueerqu
circumdmrueque circumdmrueqeu circumdmrueuqe circumdmrueueq circumdmrueeuq circumdmrueequ circumdmruqeue circumdmruqeeu
circumdmruquee circumdmruquee circumdmruqeue circumdmruqeeu circumdmruuqee circumdmruuqee circumdmruueqe circumdmruueeq
circumdmruueeq circumdmruueqe circumdmrueque circumdmrueqeu circumdmrueuqe circumdmrueueq circumdmrueeuq circumdmrueequ
circumdmreuque circumdmreuqeu circumdmreuuqe circumdmreuueq circumdmreueuq circumdmreuequ circumdmrequue circumdmrequeu
circumdmrequue circumdmrequeu circumdmreqeuu circumdmreqeuu circumdmreuque circumdmreuqeu circumdmreuuqe circumdmreuueq
circumdmreueuq circumdmreuequ circumdmreequu circumdmreequu circumdmreeuqu circumdmreeuuq circumdmreeuuq circumdmreeuqu
circumdmrqeuue circumdmrqeueu circumdmrqeuue circumdmrqeueu circumdmrqeeuu circumdmrqeeuu circumdmrqueue circumdmrqueeu
circumdmrquuee circumdmrquuee circumdmrqueue circumdmrqueeu circumdmrquuee circumdmrquuee circumdmrqueue circumdmrqueeu
circumdmrqueeu circumdmrqueue circumdmrqeuue circumdmrqeueu circumdmrqeuue circumdmrqeueu circumdmrqeeuu circumdmrqeeuu
circumdmrueque circumdmrueqeu circumdmrueuqe circumdmrueueq circumdmrueeuq circumdmrueequ circumdmruqeue circumdmruqeeu
circumdmruquee circumdmruquee circumdmruqeue circumdmruqeeu circumdmruuqee circumdmruuqee circumdmruueqe circumdmruueeq
circumdmruueeq circumdmruueqe circumdmrueque circumdmrueqeu circumdmrueuqe circumdmrueueq circumdmrueeuq circumdmrueequ
circumdmreequu circumdmreequu circumdmreeuqu circumdmreeuuq circumdmreeuuq circumdmreeuqu circumdmreqeuu circumdmreqeuu
circumdmrequeu circumdmrequue circumdmrequue circumdmrequeu circumdmreuqeu circumdmreuque circumdmreuequ circumdmreueuq
circumdmreuueq circumdmreuuqe circumdmreuque circumdmreuqeu circumdmreuuqe circumdmreuueq circumdmreueuq circumdmreuequ
circumdmqureue circumdmqureeu circumdmquruee circumdmquruee circumdmqureue circumdmqureeu circumdmquerue circumdmquereu
circumdmqueure circumdmqueuer circumdmqueeur circumdmqueeru circumdmquuere circumdmquueer circumdmquuree circumdmquuree
circumdmquuere circumdmquueer circumdmqueeur circumdmqueeru circumdmqueuer circumdmqueure circumdmquerue circumdmquereu
circumdmqrueue circumdmqrueeu circumdmqruuee circumdmqruuee circumdmqrueue circumdmqrueeu circumdmqreuue circumdmqreueu
circumdmqreuue circumdmqreueu circumdmqreeuu circumdmqreeuu circumdmqrueue circumdmqrueeu circumdmqruuee circumdmqruuee
circumdmqrueue circumdmqrueeu circumdmqreeuu circumdmqreeuu circumdmqreueu circumdmqreuue circumdmqreuue circumdmqreueu
circumdmqeruue circumdmqerueu circumdmqeruue circumdmqerueu circumdmqereuu circumdmqereuu circumdmqeurue circumdmqeureu
circumdmqeuure circumdmqeuuer circumdmqeueur circumdmqeueru circumdmqeuure circumdmqeuuer circumdmqeurue circumdmqeureu
circumdmqeueru circumdmqeueur circumdmqeeuur circumdmqeeuru circumdmqeeuur circumdmqeeuru circumdmqeeruu circumdmqeeruu
circumdmqureue circumdmqureeu circumdmquruee circumdmquruee circumdmqureue circumdmqureeu circumdmquerue circumdmquereu
circumdmqueure circumdmqueuer circumdmqueeur circumdmqueeru circumdmquuere circumdmquueer circumdmquuree circumdmquuree
circumdmquuere circumdmquueer circumdmqueeur circumdmqueeru circumdmqueuer circumdmqueure circumdmquerue circumdmquereu
circumdmqereuu circumdmqereuu circumdmqerueu circumdmqeruue circumdmqeruue circumdmqerueu circumdmqeeruu circumdmqeeruu
circumdmqeeuru circumdmqeeuur circumdmqeeuur circumdmqeeuru circumdmqeueru circumdmqeueur circumdmqeureu circumdmqeurue
circumdmqeuure circumdmqeuuer circumdmqeueur circumdmqeueru circumdmqeuuer circumdmqeuure circumdmqeurue circumdmqeureu
circumdmuurqee circumdmuurqee circumdmuureqe circumdmuureeq circumdmuureeq circumdmuureqe circumdmuuqree circumdmuuqree
circumdmuuqere circumdmuuqeer circumdmuuqeer circumdmuuqere circumdmuueqre circumdmuueqer circumdmuuerqe circumdmuuereq
circumdmuueerq circumdmuueeqr circumdmuueqer circumdmuueqre circumdmuueeqr circumdmuueerq circumdmuuereq circumdmuuerqe
circumdmuruqee circumdmuruqee circumdmurueqe circumdmurueeq circumdmurueeq circumdmurueqe circumdmurquee circumdmurquee
circumdmurqeue circumdmurqeeu circumdmurqeeu circumdmurqeue circumdmureque circumdmureqeu circumdmureuqe circumdmureueq
circumdmureeuq circumdmureequ circumdmureqeu circumdmureque circumdmureequ circumdmureeuq circumdmureueq circumdmureuqe
circumdmuqruee circumdmuqruee circumdmuqreue circumdmuqreeu circumdmuqreeu circumdmuqreue circumdmuquree circumdmuquree
circumdmuquere circumdmuqueer circumdmuqueer circumdmuquere circumdmuqeure circumdmuqeuer circumdmuqerue circumdmuqereu
circumdmuqeeru circumdmuqeeur circumdmuqeuer circumdmuqeure circumdmuqeeur circumdmuqeeru circumdmuqereu circumdmuqerue
circumdmuerque circumdmuerqeu circumdmueruqe circumdmuerueq circumdmuereuq circumdmuerequ circumdmueqrue circumdmueqreu
circumdmuequre circumdmuequer circumdmueqeur circumdmueqeru circumdmueuqre circumdmueuqer circumdmueurqe circumdmueureq
circumdmueuerq circumdmueueqr circumdmueequr circumdmueeqru circumdmueeuqr circumdmueeurq circumdmueeruq circumdmueerqu
circumdmuerqeu circumdmuerque circumdmuerequ circumdmuereuq circumdmuerueq circumdmueruqe circumdmueqreu circumdmueqrue
circumdmueqeru circumdmueqeur circumdmuequer circumdmuequre circumdmueeqru circumdmueequr circumdmueerqu circumdmueeruq
circumdmueeurq circumdmueeuqr circumdmueuqer circumdmueuqre circumdmueueqr circumdmueuerq circumdmueureq circumdmueurqe
circumdmeurque circumdmeurqeu circumdmeuruqe circumdmeurueq circumdmeureuq circumdmeurequ circumdmeuqrue circumdmeuqreu
circumdmeuqure circumdmeuquer circumdmeuqeur circumdmeuqeru circumdmeuuqre circumdmeuuqer circumdmeuurqe circumdmeuureq
circumdmeuuerq circumdmeuueqr circumdmeuequr circumdmeueqru circumdmeueuqr circumdmeueurq circumdmeueruq circumdmeuerqu
circumdmeruque circumdmeruqeu circumdmeruuqe circumdmeruueq circumdmerueuq circumdmeruequ circumdmerquue circumdmerqueu
circumdmerquue circumdmerqueu circumdmerqeuu circumdmerqeuu circumdmeruque circumdmeruqeu circumdmeruuqe circumdmeruueq
circumdmerueuq circumdmeruequ circumdmerequu circumdmerequu circumdmereuqu circumdmereuuq circumdmereuuq circumdmereuqu
circumdmeqruue circumdmeqrueu circumdmeqruue circumdmeqrueu circumdmeqreuu circumdmeqreuu circumdmequrue circumdmequreu
circumdmequure circumdmequuer circumdmequeur circumdmequeru circumdmequure circumdmequuer circumdmequrue circumdmequreu
circumdmequeru circumdmequeur circumdmeqeuur circumdmeqeuru circumdmeqeuur circumdmeqeuru circumdmeqeruu circumdmeqeruu
circumdmeurque circumdmeurqeu circumdmeuruqe circumdmeurueq circumdmeureuq circumdmeurequ circumdmeuqrue circumdmeuqreu
circumdmeuqure circumdmeuquer circumdmeuqeur circumdmeuqeru circumdmeuuqre circumdmeuuqer circumdmeuurqe circumdmeuureq
circumdmeuuerq circumdmeuueqr circumdmeuequr circumdmeueqru circumdmeueuqr circumdmeueurq circumdmeueruq circumdmeuerqu
circumdmeerquu circumdmeerquu circumdmeeruqu circumdmeeruuq circumdmeeruuq circumdmeeruqu circumdmeeqruu circumdmeeqruu
circumdmeequru circumdmeequur circumdmeequur circumdmeequru circumdmeeuqru circumdmeeuqur circumdmeeurqu circumdmeeuruq
circumdmeeuurq circumdmeeuuqr circumdmeeuqur circumdmeeuqru circumdmeeuuqr circumdmeeuurq circumdmeeuruq circumdmeeurqu
circumdumerque circumdumerqeu circumdumeruqe circumdumerueq circumdumereuq circumdumerequ circumdumeqrue circumdumeqreu
circumdumequre circumdumequer circumdumeqeur circumdumeqeru circumdumeuqre circumdumeuqer circumdumeurqe circumdumeureq
circumdumeuerq circumdumeueqr circumdumeequr circumdumeeqru circumdumeeuqr circumdumeeurq circumdumeeruq circumdumeerqu
circumdumreque circumdumreqeu circumdumreuqe circumdumreueq circumdumreeuq circumdumreequ circumdumrqeue circumdumrqeeu
circumdumrquee circumdumrquee circumdumrqeue circumdumrqeeu circumdumruqee circumdumruqee circumdumrueqe circumdumrueeq
circumdumrueeq circumdumrueqe circumdumreque circumdumreqeu circumdumreuqe circumdumreueq circumdumreeuq circumdumreequ
circumdumqreue circumdumqreeu circumdumqruee circumdumqruee circumdumqreue circumdumqreeu circumdumqerue circumdumqereu
circumdumqeure circumdumqeuer circumdumqeeur circumdumqeeru circumdumquere circumdumqueer circumdumquree circumdumquree
circumdumquere circumdumqueer circumdumqeeur circumdumqeeru circumdumqeuer circumdumqeure circumdumqerue circumdumqereu
circumdumurqee circumdumurqee circumdumureqe circumdumureeq circumdumureeq circumdumureqe circumdumuqree circumdumuqree
circumdumuqere circumdumuqeer circumdumuqeer circumdumuqere circumdumueqre circumdumueqer circumdumuerqe circumdumuereq
circumdumueerq circumdumueeqr circumdumueqer circumdumueqre circumdumueeqr circumdumueerq circumdumuereq circumdumuerqe
circumdumerque circumdumerqeu circumdumeruqe circumdumerueq circumdumereuq circumdumerequ circumdumeqrue circumdumeqreu
circumdumequre circumdumequer circumdumeqeur circumdumeqeru circumdumeuqre circumdumeuqer circumdumeurqe circumdumeureq
circumdumeuerq circumdumeueqr circumdumeequr circumdumeeqru circumdumeeuqr circumdumeeurq circumdumeeruq circumdumeerqu
circumduemrque circumduemrqeu circumduemruqe circumduemrueq circumduemreuq circumduemrequ circumduemqrue circumduemqreu
circumduemqure circumduemquer circumduemqeur circumduemqeru circumduemuqre circumduemuqer circumduemurqe circumduemureq
circumduemuerq circumduemueqr circumduemequr circumduemeqru circumduemeuqr circumduemeurq circumduemeruq circumduemerqu
circumduermque circumduermqeu circumduermuqe circumduermueq circumduermeuq circumduermequ circumduerqmue circumduerqmeu
circumduerqume circumduerquem circumduerqeum circumduerqemu circumdueruqme circumdueruqem circumduerumqe circumduerumeq
circumdueruemq circumduerueqm circumduerequm circumduereqmu circumduereuqm circumduereumq circumdueremuq circumdueremqu
circumdueqrmue circumdueqrmeu circumdueqrume circumdueqruem circumdueqreum circumdueqremu circumdueqmrue circumdueqmreu
circumdueqmure circumdueqmuer circumdueqmeur circumdueqmeru circumduequmre circumduequmer circumduequrme circumduequrem
circumduequerm circumduequemr circumdueqemur circumdueqemru circumdueqeumr circumdueqeurm circumdueqerum circumdueqermu
circumdueurqme circumdueurqem circumdueurmqe circumdueurmeq circumdueuremq circumdueureqm circumdueuqrme circumdueuqrem
circumdueuqmre circumdueuqmer circumdueuqemr circumdueuqerm circumdueumqre circumdueumqer circumdueumrqe circumdueumreq
circumdueumerq circumdueumeqr circumdueueqmr circumdueueqrm circumdueuemqr circumdueuemrq circumdueuermq circumdueuerqm
circumdueerqum circumdueerqmu circumdueeruqm circumdueerumq circumdueermuq circumdueermqu circumdueeqrum circumdueeqrmu
circumdueequrm circumdueequmr circumdueeqmur circumdueeqmru circumdueeuqrm circumdueeuqmr circumdueeurqm circumdueeurmq
circumdueeumrq circumdueeumqr circumdueemqur circumdueemqru circumdueemuqr circumdueemurq circumdueemruq circumdueemrqu
circumduremque circumduremqeu circumduremuqe circumduremueq circumduremeuq circumduremequ circumdureqmue circumdureqmeu
circumdurequme circumdurequem circumdureqeum circumdureqemu circumdureuqme circumdureuqem circumdureumqe circumdureumeq
circumdureuemq circumdureueqm circumdureequm circumdureeqmu circumdureeuqm circumdureeumq circumdureemuq circumdureemqu
circumdurmeque circumdurmeqeu circumdurmeuqe circumdurmeueq circumdurmeeuq circumdurmeequ circumdurmqeue circumdurmqeeu
circumdurmquee circumdurmquee circumdurmqeue circumdurmqeeu circumdurmuqee circumdurmuqee circumdurmueqe circumdurmueeq
circumdurmueeq circumdurmueqe circumdurmeque circumdurmeqeu circumdurmeuqe circumdurmeueq circumdurmeeuq circumdurmeequ
circumdurqmeue circumdurqmeeu circumdurqmuee circumdurqmuee circumdurqmeue circumdurqmeeu circumdurqemue circumdurqemeu
circumdurqeume circumdurqeuem circumdurqeeum circumdurqeemu circumdurqueme circumdurqueem circumdurqumee circumdurqumee
circumdurqueme circumdurqueem circumdurqeeum circumdurqeemu circumdurqeuem circumdurqeume circumdurqemue circumdurqemeu
circumdurumqee circumdurumqee circumdurumeqe circumdurumeeq circumdurumeeq circumdurumeqe circumduruqmee circumduruqmee
circumduruqeme circumduruqeem circumduruqeem circumduruqeme circumdurueqme circumdurueqem circumduruemqe circumduruemeq
circumdurueemq circumdurueeqm circumdurueqem circumdurueqme circumdurueeqm circumdurueemq circumduruemeq circumduruemqe
circumduremque circumduremqeu circumduremuqe circumduremueq circumduremeuq circumduremequ circumdureqmue circumdureqmeu
circumdurequme circumdurequem circumdureqeum circumdureqemu circumdureuqme circumdureuqem circumdureumqe circumdureumeq
circumdureuemq circumdureueqm circumdureequm circumdureeqmu circumdureeuqm circumdureeumq circumdureemuq circumdureemqu
circumduqermue circumduqermeu circumduqerume circumduqeruem circumduqereum circumduqeremu circumduqemrue circumduqemreu
circumduqemure circumduqemuer circumduqemeur circumduqemeru circumduqeumre circumduqeumer circumduqeurme circumduqeurem
circumduqeuerm circumduqeuemr circumduqeemur circumduqeemru circumduqeeumr circumduqeeurm circumduqeerum circumduqeermu
circumduqremue circumduqremeu circumduqreume circumduqreuem circumduqreeum circumduqreemu circumduqrmeue circumduqrmeeu
circumduqrmuee circumduqrmuee circumduqrmeue circumduqrmeeu circumduqrumee circumduqrumee circumduqrueme circumduqrueem
circumduqrueem circumduqrueme circumduqremue circumduqremeu circumduqreume circumduqreuem circumduqreeum circumduqreemu
circumduqmreue circumduqmreeu circumduqmruee circumduqmruee circumduqmreue circumduqmreeu circumduqmerue circumduqmereu
circumduqmeure circumduqmeuer circumduqmeeur circumduqmeeru circumduqmuere circumduqmueer circumduqmuree circumduqmuree
circumduqmuere circumduqmueer circumduqmeeur circumduqmeeru circumduqmeuer circumduqmeure circumduqmerue circumduqmereu
circumduqurmee circumduqurmee circumduqureme circumduqureem circumduqureem circumduqureme circumduqumree circumduqumree
circumduqumere circumduqumeer circumduqumeer circumduqumere circumduquemre circumduquemer circumduquerme circumduquerem
circumduqueerm circumduqueemr circumduquemer circumduquemre circumduqueemr circumduqueerm circumduquerem circumduquerme
circumduqermue circumduqermeu circumduqerume circumduqeruem circumduqereum circumduqeremu circumduqemrue circumduqemreu
circumduqemure circumduqemuer circumduqemeur circumduqemeru circumduqeumre circumduqeumer circumduqeurme circumduqeurem
circumduqeuerm circumduqeuemr circumduqeemur circumduqeemru circumduqeeumr circumduqeeurm circumduqeerum circumduqeermu
circumduuerqme circumduuerqem circumduuermqe circumduuermeq circumduueremq circumduuereqm circumduueqrme circumduueqrem
circumduueqmre circumduueqmer circumduueqemr circumduueqerm circumduuemqre circumduuemqer circumduuemrqe circumduuemreq
circumduuemerq circumduuemeqr circumduueeqmr circumduueeqrm circumduueemqr circumduueemrq circumduueermq circumduueerqm
circumduureqme circumduureqem circumduuremqe circumduuremeq circumduureemq circumduureeqm circumduurqeme circumduurqeem
circumduurqmee circumduurqmee circumduurqeme circumduurqeem circumduurmqee circumduurmqee circumduurmeqe circumduurmeeq
circumduurmeeq circumduurmeqe circumduureqme circumduureqem circumduuremqe circumduuremeq circumduureemq circumduureeqm
circumduuqreme circumduuqreem circumduuqrmee circumduuqrmee circumduuqreme circumduuqreem circumduuqerme circumduuqerem
circumduuqemre circumduuqemer circumduuqeemr circumduuqeerm circumduuqmere circumduuqmeer circumduuqmree circumduuqmree
circumduuqmere circumduuqmeer circumduuqeemr circumduuqeerm circumduuqemer circumduuqemre circumduuqerme circumduuqerem
circumduumrqee circumduumrqee circumduumreqe circumduumreeq circumduumreeq circumduumreqe circumduumqree circumduumqree
circumduumqere circumduumqeer circumduumqeer circumduumqere circumduumeqre circumduumeqer circumduumerqe circumduumereq
circumduumeerq circumduumeeqr circumduumeqer circumduumeqre circumduumeeqr circumduumeerq circumduumereq circumduumerqe
circumduuerqme circumduuerqem circumduuermqe circumduuermeq circumduueremq circumduuereqm circumduueqrme circumduueqrem
circumduueqmre circumduueqmer circumduueqemr circumduueqerm circumduuemqre circumduuemqer circumduuemrqe circumduuemreq
circumduuemerq circumduuemeqr circumduueeqmr circumduueeqrm circumduueemqr circumduueemrq circumduueermq circumduueerqm
circumdueerqum circumdueerqmu circumdueeruqm circumdueerumq circumdueermuq circumdueermqu circumdueeqrum circumdueeqrmu
circumdueequrm circumdueequmr circumdueeqmur circumdueeqmru circumdueeuqrm circumdueeuqmr circumdueeurqm circumdueeurmq
circumdueeumrq circumdueeumqr circumdueemqur circumdueemqru circumdueemuqr circumdueemurq circumdueemruq circumdueemrqu
circumduerequm circumduereqmu circumduereuqm circumduereumq circumdueremuq circumdueremqu circumduerqeum circumduerqemu
circumduerquem circumduerqume circumduerqmue circumduerqmeu circumdueruqem circumdueruqme circumduerueqm circumdueruemq
circumduerumeq circumduerumqe circumduermque circumduermqeu circumduermuqe circumduermueq circumduermeuq circumduermequ
circumdueqreum circumdueqremu circumdueqruem circumdueqrume circumdueqrmue circumdueqrmeu circumdueqerum circumdueqermu
circumdueqeurm circumdueqeumr circumdueqemur circumdueqemru circumduequerm circumduequemr circumduequrem circumduequrme
circumduequmre circumduequmer circumdueqmeur circumdueqmeru circumdueqmuer circumdueqmure circumdueqmrue circumdueqmreu
circumdueurqem circumdueurqme circumdueureqm circumdueuremq circumdueurmeq circumdueurmqe circumdueuqrem circumdueuqrme
circumdueuqerm circumdueuqemr circumdueuqmer circumdueuqmre circumdueueqrm circumdueueqmr circumdueuerqm circumdueuermq
circumdueuemrq circumdueuemqr circumdueumqer circumdueumqre circumdueumeqr circumdueumerq circumdueumreq circumdueumrqe
circumduemrque circumduemrqeu circumduemruqe circumduemrueq circumduemreuq circumduemrequ circumduemqrue circumduemqreu
circumduemqure circumduemquer circumduemqeur circumduemqeru circumduemuqre circumduemuqer circumduemurqe circumduemureq
circumduemuerq circumduemueqr circumduemequr circumduemeqru circumduemeuqr circumduemeurq circumduemeruq circumduemerqu
circumdrmueque circumdrmueqeu circumdrmueuqe circumdrmueueq circumdrmueeuq circumdrmueequ circumdrmuqeue circumdrmuqeeu
circumdrmuquee circumdrmuquee circumdrmuqeue circumdrmuqeeu circumdrmuuqee circumdrmuuqee circumdrmuueqe circumdrmuueeq
circumdrmuueeq circumdrmuueqe circumdrmueque circumdrmueqeu circumdrmueuqe circumdrmueueq circumdrmueeuq circumdrmueequ
circumdrmeuque circumdrmeuqeu circumdrmeuuqe circumdrmeuueq circumdrmeueuq circumdrmeuequ circumdrmequue circumdrmequeu
circumdrmequue circumdrmequeu circumdrmeqeuu circumdrmeqeuu circumdrmeuque circumdrmeuqeu circumdrmeuuqe circumdrmeuueq
circumdrmeueuq circumdrmeuequ circumdrmeequu circumdrmeequu circumdrmeeuqu circumdrmeeuuq circumdrmeeuuq circumdrmeeuqu
circumdrmqeuue circumdrmqeueu circumdrmqeuue circumdrmqeueu circumdrmqeeuu circumdrmqeeuu circumdrmqueue circumdrmqueeu
circumdrmquuee circumdrmquuee circumdrmqueue circumdrmqueeu circumdrmquuee circumdrmquuee circumdrmqueue circumdrmqueeu
circumdrmqueeu circumdrmqueue circumdrmqeuue circumdrmqeueu circumdrmqeuue circumdrmqeueu circumdrmqeeuu circumdrmqeeuu
circumdrmueque circumdrmueqeu circumdrmueuqe circumdrmueueq circumdrmueeuq circumdrmueequ circumdrmuqeue circumdrmuqeeu
circumdrmuquee circumdrmuquee circumdrmuqeue circumdrmuqeeu circumdrmuuqee circumdrmuuqee circumdrmuueqe circumdrmuueeq
circumdrmuueeq circumdrmuueqe circumdrmueque circumdrmueqeu circumdrmueuqe circumdrmueueq circumdrmueeuq circumdrmueequ
circumdrmeequu circumdrmeequu circumdrmeeuqu circumdrmeeuuq circumdrmeeuuq circumdrmeeuqu circumdrmeqeuu circumdrmeqeuu
circumdrmequeu circumdrmequue circumdrmequue circumdrmequeu circumdrmeuqeu circumdrmeuque circumdrmeuequ circumdrmeueuq
circumdrmeuueq circumdrmeuuqe circumdrmeuque circumdrmeuqeu circumdrmeuuqe circumdrmeuueq circumdrmeueuq circumdrmeuequ
circumdrumeque circumdrumeqeu circumdrumeuqe circumdrumeueq circumdrumeeuq circumdrumeequ circumdrumqeue circumdrumqeeu
circumdrumquee circumdrumquee circumdrumqeue circumdrumqeeu circumdrumuqee circumdrumuqee circumdrumueqe circumdrumueeq
circumdrumueeq circumdrumueqe circumdrumeque circumdrumeqeu circumdrumeuqe circumdrumeueq circumdrumeeuq circumdrumeequ
circumdruemque circumdruemqeu circumdruemuqe circumdruemueq circumdruemeuq circumdruemequ circumdrueqmue circumdrueqmeu
circumdruequme circumdruequem circumdrueqeum circumdrueqemu circumdrueuqme circumdrueuqem circumdrueumqe circumdrueumeq
circumdrueuemq circumdrueueqm circumdrueequm circumdrueeqmu circumdrueeuqm circumdrueeumq circumdrueemuq circumdrueemqu
circumdruqemue circumdruqemeu circumdruqeume circumdruqeuem circumdruqeeum circumdruqeemu circumdruqmeue circumdruqmeeu
circumdruqmuee circumdruqmuee circumdruqmeue circumdruqmeeu circumdruqumee circumdruqumee circumdruqueme circumdruqueem
circumdruqueem circumdruqueme circumdruqemue circumdruqemeu circumdruqeume circumdruqeuem circumdruqeeum circumdruqeemu
circumdruueqme circumdruueqem circumdruuemqe circumdruuemeq circumdruueemq circumdruueeqm circumdruuqeme circumdruuqeem
circumdruuqmee circumdruuqmee circumdruuqeme circumdruuqeem circumdruumqee circumdruumqee circumdruumeqe circumdruumeeq
circumdruumeeq circumdruumeqe circumdruueqme circumdruueqem circumdruuemqe circumdruuemeq circumdruueemq circumdruueeqm
circumdrueequm circumdrueeqmu circumdrueeuqm circumdrueeumq circumdrueemuq circumdrueemqu circumdrueqeum circumdrueqemu
circumdruequem circumdruequme circumdrueqmue circumdrueqmeu circumdrueuqem circumdrueuqme circumdrueueqm circumdrueuemq
circumdrueumeq circumdrueumqe circumdruemque circumdruemqeu circumdruemuqe circumdruemueq circumdruemeuq circumdruemequ
circumdreumque circumdreumqeu circumdreumuqe circumdreumueq circumdreumeuq circumdreumequ circumdreuqmue circumdreuqmeu
circumdreuqume circumdreuquem circumdreuqeum circumdreuqemu circumdreuuqme circumdreuuqem circumdreuumqe circumdreuumeq
circumdreuuemq circumdreuueqm circumdreuequm circumdreueqmu circumdreueuqm circumdreueumq circumdreuemuq circumdreuemqu
circumdremuque circumdremuqeu circumdremuuqe circumdremuueq circumdremueuq circumdremuequ circumdremquue circumdremqueu
circumdremquue circumdremqueu circumdremqeuu circumdremqeuu circumdremuque circumdremuqeu circumdremuuqe circumdremuueq
circumdremueuq circumdremuequ circumdremequu circumdremequu circumdremeuqu circumdremeuuq circumdremeuuq circumdremeuqu
circumdreqmuue circumdreqmueu circumdreqmuue circumdreqmueu circumdreqmeuu circumdreqmeuu circumdrequmue circumdrequmeu
circumdrequume circumdrequuem circumdrequeum circumdrequemu circumdrequume circumdrequuem circumdrequmue circumdrequmeu
circumdrequemu circumdrequeum circumdreqeuum circumdreqeumu circumdreqeuum circumdreqeumu circumdreqemuu circumdreqemuu
circumdreumque circumdreumqeu circumdreumuqe circumdreumueq circumdreumeuq circumdreumequ circumdreuqmue circumdreuqmeu
circumdreuqume circumdreuquem circumdreuqeum circumdreuqemu circumdreuuqme circumdreuuqem circumdreuumqe circumdreuumeq
circumdreuuemq circumdreuueqm circumdreuequm circumdreueqmu circumdreueuqm circumdreueumq circumdreuemuq circumdreuemqu
circumdreemquu circumdreemquu circumdreemuqu circumdreemuuq circumdreemuuq circumdreemuqu circumdreeqmuu circumdreeqmuu
circumdreequmu circumdreequum circumdreequum circumdreequmu circumdreeuqmu circumdreeuqum circumdreeumqu circumdreeumuq
circumdreeuumq circumdreeuuqm circumdreeuqum circumdreeuqmu circumdreeuuqm circumdreeuumq circumdreeumuq circumdreeumqu
circumdrquemue circumdrquemeu circumdrqueume circumdrqueuem circumdrqueeum circumdrqueemu circumdrqumeue circumdrqumeeu
circumdrqumuee circumdrqumuee circumdrqumeue circumdrqumeeu circumdrquumee circumdrquumee circumdrquueme circumdrquueem
circumdrquueem circumdrquueme circumdrquemue circumdrquemeu circumdrqueume circumdrqueuem circumdrqueeum circumdrqueemu
circumdrqeumue circumdrqeumeu circumdrqeuume circumdrqeuuem circumdrqeueum circumdrqeuemu circumdrqemuue circumdrqemueu
circumdrqemuue circumdrqemueu circumdrqemeuu circumdrqemeuu circumdrqeumue circumdrqeumeu circumdrqeuume circumdrqeuuem
circumdrqeueum circumdrqeuemu circumdrqeemuu circumdrqeemuu circumdrqeeumu circumdrqeeuum circumdrqeeuum circumdrqeeumu
circumdrqmeuue circumdrqmeueu circumdrqmeuue circumdrqmeueu circumdrqmeeuu circumdrqmeeuu circumdrqmueue circumdrqmueeu
circumdrqmuuee circumdrqmuuee circumdrqmueue circumdrqmueeu circumdrqmuuee circumdrqmuuee circumdrqmueue circumdrqmueeu
circumdrqmueeu circumdrqmueue circumdrqmeuue circumdrqmeueu circumdrqmeuue circumdrqmeueu circumdrqmeeuu circumdrqmeeuu
circumdrquemue circumdrquemeu circumdrqueume circumdrqueuem circumdrqueeum circumdrqueemu circumdrqumeue circumdrqumeeu
circumdrqumuee circumdrqumuee circumdrqumeue circumdrqumeeu circumdrquumee circumdrquumee circumdrquueme circumdrquueem
circumdrquueem circumdrquueme circumdrquemue circumdrquemeu circumdrqueume circumdrqueuem circumdrqueeum circumdrqueemu
circumdrqeemuu circumdrqeemuu circumdrqeeumu circumdrqeeuum circumdrqeeuum circumdrqeeumu circumdrqemeuu circumdrqemeuu
circumdrqemueu circumdrqemuue circumdrqemuue circumdrqemueu circumdrqeumeu circumdrqeumue circumdrqeuemu circumdrqeueum
circumdrqeuuem circumdrqeuume circumdrqeumue circumdrqeumeu circumdrqeuume circumdrqeuuem circumdrqeueum circumdrqeuemu
circumdruueqme circumdruueqem circumdruuemqe circumdruuemeq circumdruueemq circumdruueeqm circumdruuqeme circumdruuqeem
circumdruuqmee circumdruuqmee circumdruuqeme circumdruuqeem circumdruumqee circumdruumqee circumdruumeqe circumdruumeeq
circumdruumeeq circumdruumeqe circumdruueqme circumdruueqem circumdruuemqe circumdruuemeq circumdruueemq circumdruueeqm
circumdrueuqme circumdrueuqem circumdrueumqe circumdrueumeq circumdrueuemq circumdrueueqm circumdruequme circumdruequem
circumdrueqmue circumdrueqmeu circumdrueqemu circumdrueqeum circumdruemque circumdruemqeu circumdruemuqe circumdruemueq
circumdruemeuq circumdruemequ circumdrueeqmu circumdrueequm circumdrueemqu circumdrueemuq circumdrueeumq circumdrueeuqm
circumdruqeume circumdruqeuem circumdruqemue circumdruqemeu circumdruqeemu circumdruqeeum circumdruqueme circumdruqueem
circumdruqumee circumdruqumee circumdruqueme circumdruqueem circumdruqmuee circumdruqmuee circumdruqmeue circumdruqmeeu
circumdruqmeeu circumdruqmeue circumdruqeume circumdruqeuem circumdruqemue circumdruqemeu circumdruqeemu circumdruqeeum
circumdrumeque circumdrumeqeu circumdrumeuqe circumdrumeueq circumdrumeeuq circumdrumeequ circumdrumqeue circumdrumqeeu
circumdrumquee circumdrumquee circumdrumqeue circumdrumqeeu circumdrumuqee circumdrumuqee circumdrumueqe circumdrumueeq
circumdrumueeq circumdrumueqe circumdrumeque circumdrumeqeu circumdrumeuqe circumdrumeueq circumdrumeeuq circumdrumeequ
circumdrueeqmu circumdrueequm circumdrueemqu circumdrueemuq circumdrueeumq circumdrueeuqm circumdrueqemu circumdrueqeum
circumdrueqmeu circumdrueqmue circumdruequme circumdruequem circumdruemqeu circumdruemque circumdruemequ circumdruemeuq
circumdruemueq circumdruemuqe circumdrueuqme circumdrueuqem circumdrueumqe circumdrueumeq circumdrueuemq circumdrueueqm
circumdreuequm circumdreueqmu circumdreueuqm circumdreueumq circumdreuemuq circumdreuemqu circumdreuqeum circumdreuqemu
circumdreuquem circumdreuqume circumdreuqmue circumdreuqmeu circumdreuuqem circumdreuuqme circumdreuueqm circumdreuuemq
circumdreuumeq circumdreuumqe circumdreumque circumdreumqeu circumdreumuqe circumdreumueq circumdreumeuq circumdreumequ
circumdreeuqum circumdreeuqmu circumdreeuuqm circumdreeuumq circumdreeumuq circumdreeumqu circumdreequum circumdreequmu
circumdreequum circumdreequmu circumdreeqmuu circumdreeqmuu circumdreeuqum circumdreeuqmu circumdreeuuqm circumdreeuumq
circumdreeumuq circumdreeumqu circumdreemquu circumdreemquu circumdreemuqu circumdreemuuq circumdreemuuq circumdreemuqu
circumdreqeuum circumdreqeumu circumdreqeuum circumdreqeumu circumdreqemuu circumdreqemuu circumdrequeum circumdrequemu
circumdrequuem circumdrequume circumdrequmue circumdrequmeu circumdrequuem circumdrequume circumdrequeum circumdrequemu
circumdrequmeu circumdrequmue circumdreqmuue circumdreqmueu circumdreqmuue circumdreqmueu circumdreqmeuu circumdreqmeuu
circumdreuequm circumdreueqmu circumdreueuqm circumdreueumq circumdreuemuq circumdreuemqu circumdreuqeum circumdreuqemu
circumdreuquem circumdreuqume circumdreuqmue circumdreuqmeu circumdreuuqem circumdreuuqme circumdreuueqm circumdreuuemq
circumdreuumeq circumdreuumqe circumdreumque circumdreumqeu circumdreumuqe circumdreumueq circumdreumeuq circumdreumequ
circumdremequu circumdremequu circumdremeuqu circumdremeuuq circumdremeuuq circumdremeuqu circumdremqeuu circumdremqeuu
circumdremqueu circumdremquue circumdremquue circumdremqueu circumdremuqeu circumdremuque circumdremuequ circumdremueuq
circumdremuueq circumdremuuqe circumdremuque circumdremuqeu circumdremuuqe circumdremuueq circumdremueuq circumdremuequ
circumdqmureue circumdqmureeu circumdqmuruee circumdqmuruee circumdqmureue circumdqmureeu circumdqmuerue circumdqmuereu
circumdqmueure circumdqmueuer circumdqmueeur circumdqmueeru circumdqmuuere circumdqmuueer circumdqmuuree circumdqmuuree
circumdqmuuere circumdqmuueer circumdqmueeur circumdqmueeru circumdqmueuer circumdqmueure circumdqmuerue circumdqmuereu
circumdqmrueue circumdqmrueeu circumdqmruuee circumdqmruuee circumdqmrueue circumdqmrueeu circumdqmreuue circumdqmreueu
circumdqmreuue circumdqmreueu circumdqmreeuu circumdqmreeuu circumdqmrueue circumdqmrueeu circumdqmruuee circumdqmruuee
circumdqmrueue circumdqmrueeu circumdqmreeuu circumdqmreeuu circumdqmreueu circumdqmreuue circumdqmreuue circumdqmreueu
circumdqmeruue circumdqmerueu circumdqmeruue circumdqmerueu circumdqmereuu circumdqmereuu circumdqmeurue circumdqmeureu
circumdqmeuure circumdqmeuuer circumdqmeueur circumdqmeueru circumdqmeuure circumdqmeuuer circumdqmeurue circumdqmeureu
circumdqmeueru circumdqmeueur circumdqmeeuur circumdqmeeuru circumdqmeeuur circumdqmeeuru circumdqmeeruu circumdqmeeruu
circumdqmureue circumdqmureeu circumdqmuruee circumdqmuruee circumdqmureue circumdqmureeu circumdqmuerue circumdqmuereu
circumdqmueure circumdqmueuer circumdqmueeur circumdqmueeru circumdqmuuere circumdqmuueer circumdqmuuree circumdqmuuree
circumdqmuuere circumdqmuueer circumdqmueeur circumdqmueeru circumdqmueuer circumdqmueure circumdqmuerue circumdqmuereu
circumdqmereuu circumdqmereuu circumdqmerueu circumdqmeruue circumdqmeruue circumdqmerueu circumdqmeeruu circumdqmeeruu
circumdqmeeuru circumdqmeeuur circumdqmeeuur circumdqmeeuru circumdqmeueru circumdqmeueur circumdqmeureu circumdqmeurue
circumdqmeuure circumdqmeuuer circumdqmeueur circumdqmeueru circumdqmeuuer circumdqmeuure circumdqmeurue circumdqmeureu
circumdqumreue circumdqumreeu circumdqumruee circumdqumruee circumdqumreue circumdqumreeu circumdqumerue circumdqumereu
circumdqumeure circumdqumeuer circumdqumeeur circumdqumeeru circumdqumuere circumdqumueer circumdqumuree circumdqumuree
circumdqumuere circumdqumueer circumdqumeeur circumdqumeeru circumdqumeuer circumdqumeure circumdqumerue circumdqumereu
circumdqurmeue circumdqurmeeu circumdqurmuee circumdqurmuee circumdqurmeue circumdqurmeeu circumdquremue circumdquremeu
circumdqureume circumdqureuem circumdqureeum circumdqureemu circumdqurueme circumdqurueem circumdqurumee circumdqurumee
circumdqurueme circumdqurueem circumdqureeum circumdqureemu circumdqureuem circumdqureume circumdquremue circumdquremeu
circumdquermue circumdquermeu circumdquerume circumdqueruem circumdquereum circumdqueremu circumdquemrue circumdquemreu
circumdquemure circumdquemuer circumdquemeur circumdquemeru circumdqueumre circumdqueumer circumdqueurme circumdqueurem
circumdqueuerm circumdqueuemr circumdqueemur circumdqueemru circumdqueeumr circumdqueeurm circumdqueerum circumdqueermu
circumdquureme circumdquureem circumdquurmee circumdquurmee circumdquureme circumdquureem circumdquuerme circumdquuerem
circumdquuemre circumdquuemer circumdquueemr circumdquueerm circumdquumere circumdquumeer circumdquumree circumdquumree
circumdquumere circumdquumeer circumdquueemr circumdquueerm circumdquuemer circumdquuemre circumdquuerme circumdquuerem
circumdquereum circumdqueremu circumdqueruem circumdquerume circumdquermue circumdquermeu circumdqueerum circumdqueermu
circumdqueeurm circumdqueeumr circumdqueemur circumdqueemru circumdqueuerm circumdqueuemr circumdqueurem circumdqueurme
circumdqueumre circumdqueumer circumdquemeur circumdquemeru circumdquemuer circumdquemure circumdquemrue circumdquemreu
circumdqrumeue circumdqrumeeu circumdqrumuee circumdqrumuee circumdqrumeue circumdqrumeeu circumdqruemue circumdqruemeu
circumdqrueume circumdqrueuem circumdqrueeum circumdqrueemu circumdqruueme circumdqruueem circumdqruumee circumdqruumee
circumdqruueme circumdqruueem circumdqrueeum circumdqrueemu circumdqrueuem circumdqrueume circumdqruemue circumdqruemeu
circumdqrmueue circumdqrmueeu circumdqrmuuee circumdqrmuuee circumdqrmueue circumdqrmueeu circumdqrmeuue circumdqrmeueu
circumdqrmeuue circumdqrmeueu circumdqrmeeuu circumdqrmeeuu circumdqrmueue circumdqrmueeu circumdqrmuuee circumdqrmuuee
circumdqrmueue circumdqrmueeu circumdqrmeeuu circumdqrmeeuu circumdqrmeueu circumdqrmeuue circumdqrmeuue circumdqrmeueu
circumdqremuue circumdqremueu circumdqremuue circumdqremueu circumdqremeuu circumdqremeuu circumdqreumue circumdqreumeu
circumdqreuume circumdqreuuem circumdqreueum circumdqreuemu circumdqreuume circumdqreuuem circumdqreumue circumdqreumeu
circumdqreuemu circumdqreueum circumdqreeuum circumdqreeumu circumdqreeuum circumdqreeumu circumdqreemuu circumdqreemuu
circumdqrumeue circumdqrumeeu circumdqrumuee circumdqrumuee circumdqrumeue circumdqrumeeu circumdqruemue circumdqruemeu
circumdqrueume circumdqrueuem circumdqrueeum circumdqrueemu circumdqruueme circumdqruueem circumdqruumee circumdqruumee
circumdqruueme circumdqruueem circumdqrueeum circumdqrueemu circumdqrueuem circumdqrueume circumdqruemue circumdqruemeu
circumdqremeuu circumdqremeuu circumdqremueu circumdqremuue circumdqremuue circumdqremueu circumdqreemuu circumdqreemuu
circumdqreeumu circumdqreeuum circumdqreeuum circumdqreeumu circumdqreuemu circumdqreueum circumdqreumeu circumdqreumue
circumdqreuume circumdqreuuem circumdqreueum circumdqreuemu circumdqreuuem circumdqreuume circumdqreumue circumdqreumeu
circumdqeurmue circumdqeurmeu circumdqeurume circumdqeuruem circumdqeureum circumdqeuremu circumdqeumrue circumdqeumreu
circumdqeumure circumdqeumuer circumdqeumeur circumdqeumeru circumdqeuumre circumdqeuumer circumdqeuurme circumdqeuurem
circumdqeuuerm circumdqeuuemr circumdqeuemur circumdqeuemru circumdqeueumr circumdqeueurm circumdqeuerum circumdqeuermu
circumdqerumue circumdqerumeu circumdqeruume circumdqeruuem circumdqerueum circumdqeruemu circumdqermuue circumdqermueu
circumdqermuue circumdqermueu circumdqermeuu circumdqermeuu circumdqerumue circumdqerumeu circumdqeruume circumdqeruuem
circumdqerueum circumdqeruemu circumdqeremuu circumdqeremuu circumdqereumu circumdqereuum circumdqereuum circumdqereumu
circumdqemruue circumdqemrueu circumdqemruue circumdqemrueu circumdqemreuu circumdqemreuu circumdqemurue circumdqemureu
circumdqemuure circumdqemuuer circumdqemueur circumdqemueru circumdqemuure circumdqemuuer circumdqemurue circumdqemureu
circumdqemueru circumdqemueur circumdqemeuur circumdqemeuru circumdqemeuur circumdqemeuru circumdqemeruu circumdqemeruu
circumdqeurmue circumdqeurmeu circumdqeurume circumdqeuruem circumdqeureum circumdqeuremu circumdqeumrue circumdqeumreu
circumdqeumure circumdqeumuer circumdqeumeur circumdqeumeru circumdqeuumre circumdqeuumer circumdqeuurme circumdqeuurem
circumdqeuuerm circumdqeuuemr circumdqeuemur circumdqeuemru circumdqeueumr circumdqeueurm circumdqeuerum circumdqeuermu
circumdqeermuu circumdqeermuu circumdqeerumu circumdqeeruum circumdqeeruum circumdqeerumu circumdqeemruu circumdqeemruu
circumdqeemuru circumdqeemuur circumdqeemuur circumdqeemuru circumdqeeumru circumdqeeumur circumdqeeurmu circumdqeeurum
circumdqeeuurm circumdqeeuumr circumdqeeumur circumdqeeumru circumdqeeuumr circumdqeeuurm circumdqeeurum circumdqeeurmu
circumdquureme circumdquureem circumdquurmee circumdquurmee circumdquureme circumdquureem circumdquuerme circumdquuerem
circumdquuemre circumdquuemer circumdquueemr circumdquueerm circumdquumere circumdquumeer circumdquumree circumdquumree
circumdquumere circumdquumeer circumdquueemr circumdquueerm circumdquuemer circumdquuemre circumdquuerme circumdquuerem
circumdqurueme circumdqurueem circumdqurumee circumdqurumee circumdqurueme circumdqurueem circumdqureume circumdqureuem
circumdquremue circumdquremeu circumdqureemu circumdqureeum circumdqurmeue circumdqurmeeu circumdqurmuee circumdqurmuee
circumdqurmeue circumdqurmeeu circumdqureemu circumdqureeum circumdquremeu circumdquremue circumdqureume circumdqureuem
circumdquerume circumdqueruem circumdquermue circumdquermeu circumdqueremu circumdquereum circumdqueurme circumdqueurem
circumdqueumre circumdqueumer circumdqueuemr circumdqueuerm circumdquemure circumdquemuer circumdquemrue circumdquemreu
circumdquemeru circumdquemeur circumdqueeumr circumdqueeurm circumdqueemur circumdqueemru circumdqueermu circumdqueerum
circumdqumreue circumdqumreeu circumdqumruee circumdqumruee circumdqumreue circumdqumreeu circumdqumerue circumdqumereu
circumdqumeure circumdqumeuer circumdqumeeur circumdqumeeru circumdqumuere circumdqumueer circumdqumuree circumdqumuree
circumdqumuere circumdqumueer circumdqumeeur circumdqumeeru circumdqumeuer circumdqumeure circumdqumerue circumdqumereu
circumdqueremu circumdquereum circumdquermeu circumdquermue circumdquerume circumdqueruem circumdqueermu circumdqueerum
circumdqueemru circumdqueemur circumdqueeumr circumdqueeurm circumdquemeru circumdquemeur circumdquemreu circumdquemrue
circumdquemure circumdquemuer circumdqueuemr circumdqueuerm circumdqueumer circumdqueumre circumdqueurme circumdqueurem
circumdqeureum circumdqeuremu circumdqeuruem circumdqeurume circumdqeurmue circumdqeurmeu circumdqeuerum circumdqeuermu
circumdqeueurm circumdqeueumr circumdqeuemur circumdqeuemru circumdqeuuerm circumdqeuuemr circumdqeuurem circumdqeuurme
circumdqeuumre circumdqeuumer circumdqeumeur circumdqeumeru circumdqeumuer circumdqeumure circumdqeumrue circumdqeumreu
circumdqerueum circumdqeruemu circumdqeruuem circumdqeruume circumdqerumue circumdqerumeu circumdqereuum circumdqereumu
circumdqereuum circumdqereumu circumdqeremuu circumdqeremuu circumdqerueum circumdqeruemu circumdqeruuem circumdqeruume
circumdqerumue circumdqerumeu circumdqermeuu circumdqermeuu circumdqermueu circumdqermuue circumdqermuue circumdqermueu
circumdqeeruum circumdqeerumu circumdqeeruum circumdqeerumu circumdqeermuu circumdqeermuu circumdqeeurum circumdqeeurmu
circumdqeeuurm circumdqeeuumr circumdqeeumur circumdqeeumru circumdqeeuurm circumdqeeuumr circumdqeeurum circumdqeeurmu
circumdqeeumru circumdqeeumur circumdqeemuur circumdqeemuru circumdqeemuur circumdqeemuru circumdqeemruu circumdqeemruu
circumdqeureum circumdqeuremu circumdqeuruem circumdqeurume circumdqeurmue circumdqeurmeu circumdqeuerum circumdqeuermu
circumdqeueurm circumdqeueumr circumdqeuemur circumdqeuemru circumdqeuuerm circumdqeuuemr circumdqeuurem circumdqeuurme
circumdqeuumre circumdqeuumer circumdqeumeur circumdqeumeru circumdqeumuer circumdqeumure circumdqeumrue circumdqeumreu
circumdqemreuu circumdqemreuu circumdqemrueu circumdqemruue circumdqemruue circumdqemrueu circumdqemeruu circumdqemeruu
circumdqemeuru circumdqemeuur circumdqemeuur circumdqemeuru circumdqemueru circumdqemueur circumdqemureu circumdqemurue
circumdqemuure circumdqemuuer circumdqemueur circumdqemueru circumdqemuuer circumdqemuure circumdqemurue circumdqemureu
circumdumurqee circumdumurqee circumdumureqe circumdumureeq circumdumureeq circumdumureqe circumdumuqree circumdumuqree
circumdumuqere circumdumuqeer circumdumuqeer circumdumuqere circumdumueqre circumdumueqer circumdumuerqe circumdumuereq
circumdumueerq circumdumueeqr circumdumueqer circumdumueqre circumdumueeqr circumdumueerq circumdumuereq circumdumuerqe
circumdumruqee circumdumruqee circumdumrueqe circumdumrueeq circumdumrueeq circumdumrueqe circumdumrquee circumdumrquee
circumdumrqeue circumdumrqeeu circumdumrqeeu circumdumrqeue circumdumreque circumdumreqeu circumdumreuqe circumdumreueq
circumdumreeuq circumdumreequ circumdumreqeu circumdumreque circumdumreequ circumdumreeuq circumdumreueq circumdumreuqe
circumdumqruee circumdumqruee circumdumqreue circumdumqreeu circumdumqreeu circumdumqreue circumdumquree circumdumquree
circumdumquere circumdumqueer circumdumqueer circumdumquere circumdumqeure circumdumqeuer circumdumqerue circumdumqereu
circumdumqeeru circumdumqeeur circumdumqeuer circumdumqeure circumdumqeeur circumdumqeeru circumdumqereu circumdumqerue
circumdumerque circumdumerqeu circumdumeruqe circumdumerueq circumdumereuq circumdumerequ circumdumeqrue circumdumeqreu
circumdumequre circumdumequer circumdumeqeur circumdumeqeru circumdumeuqre circumdumeuqer circumdumeurqe circumdumeureq
circumdumeuerq circumdumeueqr circumdumeequr circumdumeeqru circumdumeeuqr circumdumeeurq circumdumeeruq circumdumeerqu
circumdumerqeu circumdumerque circumdumerequ circumdumereuq circumdumerueq circumdumeruqe circumdumeqreu circumdumeqrue
circumdumeqeru circumdumeqeur circumdumequer circumdumequre circumdumeeqru circumdumeequr circumdumeerqu circumdumeeruq
circumdumeeurq circumdumeeuqr circumdumeuqer circumdumeuqre circumdumeueqr circumdumeuerq circumdumeureq circumdumeurqe
circumduumrqee circumduumrqee circumduumreqe circumduumreeq circumduumreeq circumduumreqe circumduumqree circumduumqree
circumduumqere circumduumqeer circumduumqeer circumduumqere circumduumeqre circumduumeqer circumduumerqe circumduumereq
circumduumeerq circumduumeeqr circumduumeqer circumduumeqre circumduumeeqr circumduumeerq circumduumereq circumduumerqe
circumduurmqee circumduurmqee circumduurmeqe circumduurmeeq circumduurmeeq circumduurmeqe circumduurqmee circumduurqmee
circumduurqeme circumduurqeem circumduurqeem circumduurqeme circumduureqme circumduureqem circumduuremqe circumduuremeq
circumduureemq circumduureeqm circumduureqem circumduureqme circumduureeqm circumduureemq circumduuremeq circumduuremqe
circumduuqrmee circumduuqrmee circumduuqreme circumduuqreem circumduuqreem circumduuqreme circumduuqmree circumduuqmree
circumduuqmere circumduuqmeer circumduuqmeer circumduuqmere circumduuqemre circumduuqemer circumduuqerme circumduuqerem
circumduuqeerm circumduuqeemr circumduuqemer circumduuqemre circumduuqeemr circumduuqeerm circumduuqerem circumduuqerme
circumduuerqme circumduuerqem circumduuermqe circumduuermeq circumduueremq circumduuereqm circumduueqrme circumduueqrem
circumduueqmre circumduueqmer circumduueqemr circumduueqerm circumduuemqre circumduuemqer circumduuemrqe circumduuemreq
circumduuemerq circumduuemeqr circumduueeqmr circumduueeqrm circumduueemqr circumduueemrq circumduueermq circumduueerqm
circumduuerqem circumduuerqme circumduuereqm circumduueremq circumduuermeq circumduuermqe circumduueqrem circumduueqrme
circumduueqerm circumduueqemr circumduueqmer circumduueqmre circumduueeqrm circumduueeqmr circumduueerqm circumduueermq
circumduueemrq circumduueemqr circumduuemqer circumduuemqre circumduuemeqr circumduuemerq circumduuemreq circumduuemrqe
circumdurumqee circumdurumqee circumdurumeqe circumdurumeeq circumdurumeeq circumdurumeqe circumduruqmee circumduruqmee
circumduruqeme circumduruqeem circumduruqeem circumduruqeme circumdurueqme circumdurueqem circumduruemqe circumduruemeq
circumdurueemq circumdurueeqm circumdurueqem circumdurueqme circumdurueeqm circumdurueemq circumduruemeq circumduruemqe
circumdurmuqee circumdurmuqee circumdurmueqe circumdurmueeq circumdurmueeq circumdurmueqe circumdurmquee circumdurmquee
circumdurmqeue circumdurmqeeu circumdurmqeeu circumdurmqeue circumdurmeque circumdurmeqeu circumdurmeuqe circumdurmeueq
circumdurmeeuq circumdurmeequ circumdurmeqeu circumdurmeque circumdurmeequ circumdurmeeuq circumdurmeueq circumdurmeuqe
circumdurqmuee circumdurqmuee circumdurqmeue circumdurqmeeu circumdurqmeeu circumdurqmeue circumdurqumee circumdurqumee
circumdurqueme circumdurqueem circumdurqueem circumdurqueme circumdurqeume circumdurqeuem circumdurqemue circumdurqemeu
circumdurqeemu circumdurqeeum circumdurqeuem circumdurqeume circumdurqeeum circumdurqeemu circumdurqemeu circumdurqemue
circumduremque circumduremqeu circumduremuqe circumduremueq circumduremeuq circumduremequ circumdureqmue circumdureqmeu
circumdurequme circumdurequem circumdureqeum circumdureqemu circumdureuqme circumdureuqem circumdureumqe circumdureumeq
circumdureuemq circumdureueqm circumdureequm circumdureeqmu circumdureeuqm circumdureeumq circumdureemuq circumdureemqu
circumduremqeu circumduremque circumduremequ circumduremeuq circumduremueq circumduremuqe circumdureqmeu circumdureqmue
circumdureqemu circumdureqeum circumdurequem circumdurequme circumdureeqmu circumdureequm circumdureemqu circumdureemuq
circumdureeumq circumdureeuqm circumdureuqem circumdureuqme circumdureueqm circumdureuemq circumdureumeq circumdureumqe
circumduqurmee circumduqurmee circumduqureme circumduqureem circumduqureem circumduqureme circumduqumree circumduqumree
circumduqumere circumduqumeer circumduqumeer circumduqumere circumduquemre circumduquemer circumduquerme circumduquerem
circumduqueerm circumduqueemr circumduquemer circumduquemre circumduqueemr circumduqueerm circumduquerem circumduquerme
circumduqrumee circumduqrumee circumduqrueme circumduqrueem circumduqrueem circumduqrueme circumduqrmuee circumduqrmuee
circumduqrmeue circumduqrmeeu circumduqrmeeu circumduqrmeue circumduqremue circumduqremeu circumduqreume circumduqreuem
circumduqreeum circumduqreemu circumduqremeu circumduqremue circumduqreemu circumduqreeum circumduqreuem circumduqreume
circumduqmruee circumduqmruee circumduqmreue circumduqmreeu circumduqmreeu circumduqmreue circumduqmuree circumduqmuree
circumduqmuere circumduqmueer circumduqmueer circumduqmuere circumduqmeure circumduqmeuer circumduqmerue circumduqmereu
circumduqmeeru circumduqmeeur circumduqmeuer circumduqmeure circumduqmeeur circumduqmeeru circumduqmereu circumduqmerue
circumduqermue circumduqermeu circumduqerume circumduqeruem circumduqereum circumduqeremu circumduqemrue circumduqemreu
circumduqemure circumduqemuer circumduqemeur circumduqemeru circumduqeumre circumduqeumer circumduqeurme circumduqeurem
circumduqeuerm circumduqeuemr circumduqeemur circumduqeemru circumduqeeumr circumduqeeurm circumduqeerum circumduqeermu
circumduqermeu circumduqermue circumduqeremu circumduqereum circumduqeruem circumduqerume circumduqemreu circumduqemrue
circumduqemeru circumduqemeur circumduqemuer circumduqemure circumduqeemru circumduqeemur circumduqeermu circumduqeerum
circumduqeeurm circumduqeeumr circumduqeumer circumduqeumre circumduqeuemr circumduqeuerm circumduqeurem circumduqeurme
circumdueurqme circumdueurqem circumdueurmqe circumdueurmeq circumdueuremq circumdueureqm circumdueuqrme circumdueuqrem
circumdueuqmre circumdueuqmer circumdueuqemr circumdueuqerm circumdueumqre circumdueumqer circumdueumrqe circumdueumreq
circumdueumerq circumdueumeqr circumdueueqmr circumdueueqrm circumdueuemqr circumdueuemrq circumdueuermq circumdueuerqm
circumdueruqme circumdueruqem circumduerumqe circumduerumeq circumdueruemq circumduerueqm circumduerqume circumduerquem
circumduerqmue circumduerqmeu circumduerqemu circumduerqeum circumduermque circumduermqeu circumduermuqe circumduermueq
circumduermeuq circumduermequ circumduereqmu circumduerequm circumdueremqu circumdueremuq circumduereumq circumduereuqm
circumdueqrume circumdueqruem circumdueqrmue circumdueqrmeu circumdueqremu circumdueqreum circumduequrme circumduequrem
circumduequmre circumduequmer circumduequemr circumduequerm circumdueqmure circumdueqmuer circumdueqmrue circumdueqmreu
circumdueqmeru circumdueqmeur circumdueqeumr circumdueqeurm circumdueqemur circumdueqemru circumdueqermu circumdueqerum
circumduemrque circumduemrqeu circumduemruqe circumduemrueq circumduemreuq circumduemrequ circumduemqrue circumduemqreu
circumduemqure circumduemquer circumduemqeur circumduemqeru circumduemuqre circumduemuqer circumduemurqe circumduemureq
circumduemuerq circumduemueqr circumduemequr circumduemeqru circumduemeuqr circumduemeurq circumduemeruq circumduemerqu
circumdueerqmu circumdueerqum circumdueermqu circumdueermuq circumdueerumq circumdueeruqm circumdueeqrmu circumdueeqrum
circumdueeqmru circumdueeqmur circumdueequmr circumdueequrm circumdueemqru circumdueemqur circumdueemrqu circumdueemruq
circumdueemurq circumdueemuqr circumdueeuqmr circumdueeuqrm circumdueeumqr circumdueeumrq circumdueeurmq circumdueeurqm
circumdueurqem circumdueurqme circumdueureqm circumdueuremq circumdueurmeq circumdueurmqe circumdueuqrem circumdueuqrme
circumdueuqerm circumdueuqemr circumdueuqmer circumdueuqmre circumdueueqrm circumdueueqmr circumdueuerqm circumdueuermq
circumdueuemrq circumdueuemqr circumdueumqer circumdueumqre circumdueumeqr circumdueumerq circumdueumreq circumdueumrqe
circumdueruqem circumdueruqme circumduerueqm circumdueruemq circumduerumeq circumduerumqe circumduerquem circumduerqume
circumduerqeum circumduerqemu circumduerqmeu circumduerqmue circumduerequm circumduereqmu circumduereuqm circumduereumq
circumdueremuq circumdueremqu circumduermqeu circumduermque circumduermequ circumduermeuq circumduermueq circumduermuqe
circumdueqruem circumdueqrume circumdueqreum circumdueqremu circumdueqrmeu circumdueqrmue circumduequrem circumduequrme
circumduequerm circumduequemr circumduequmer circumduequmre circumdueqeurm circumdueqeumr circumdueqerum circumdueqermu
circumdueqemru circumdueqemur circumdueqmuer circumdueqmure circumdueqmeur circumdueqmeru circumdueqmreu circumdueqmrue
circumdueerqum circumdueerqmu circumdueeruqm circumdueerumq circumdueermuq circumdueermqu circumdueeqrum circumdueeqrmu
circumdueequrm circumdueequmr circumdueeqmur circumdueeqmru circumdueeuqrm circumdueeuqmr circumdueeurqm circumdueeurmq
circumdueeumrq circumdueeumqr circumdueemqur circumdueemqru circumdueemuqr circumdueemurq circumdueemruq circumdueemrqu
circumduemrqeu circumduemrque circumduemrequ circumduemreuq circumduemrueq circumduemruqe circumduemqreu circumduemqrue
circumduemqeru circumduemqeur circumduemquer circumduemqure circumduemeqru circumduemequr circumduemerqu circumduemeruq
circumduemeurq circumduemeuqr circumduemuqer circumduemuqre circumduemueqr circumduemuerq circumduemureq circumduemurqe
circumdemurque circumdemurqeu circumdemuruqe circumdemurueq circumdemureuq circumdemurequ circumdemuqrue circumdemuqreu
circumdemuqure circumdemuquer circumdemuqeur circumdemuqeru circumdemuuqre circumdemuuqer circumdemuurqe circumdemuureq
circumdemuuerq circumdemuueqr circumdemuequr circumdemueqru circumdemueuqr circumdemueurq circumdemueruq circumdemuerqu
circumdemruque circumdemruqeu circumdemruuqe circumdemruueq circumdemrueuq circumdemruequ circumdemrquue circumdemrqueu
circumdemrquue circumdemrqueu circumdemrqeuu circumdemrqeuu circumdemruque circumdemruqeu circumdemruuqe circumdemruueq
circumdemrueuq circumdemruequ circumdemrequu circumdemrequu circumdemreuqu circumdemreuuq circumdemreuuq circumdemreuqu
circumdemqruue circumdemqrueu circumdemqruue circumdemqrueu circumdemqreuu circumdemqreuu circumdemqurue circumdemqureu
circumdemquure circumdemquuer circumdemqueur circumdemqueru circumdemquure circumdemquuer circumdemqurue circumdemqureu
circumdemqueru circumdemqueur circumdemqeuur circumdemqeuru circumdemqeuur circumdemqeuru circumdemqeruu circumdemqeruu
circumdemurque circumdemurqeu circumdemuruqe circumdemurueq circumdemureuq circumdemurequ circumdemuqrue circumdemuqreu
circumdemuqure circumdemuquer circumdemuqeur circumdemuqeru circumdemuuqre circumdemuuqer circumdemuurqe circumdemuureq
circumdemuuerq circumdemuueqr circumdemuequr circumdemueqru circumdemueuqr circumdemueurq circumdemueruq circumdemuerqu
circumdemerquu circumdemerquu circumdemeruqu circumdemeruuq circumdemeruuq circumdemeruqu circumdemeqruu circumdemeqruu
circumdemequru circumdemequur circumdemequur circumdemequru circumdemeuqru circumdemeuqur circumdemeurqu circumdemeuruq
circumdemeuurq circumdemeuuqr circumdemeuqur circumdemeuqru circumdemeuuqr circumdemeuurq circumdemeuruq circumdemeurqu
circumdeumrque circumdeumrqeu circumdeumruqe circumdeumrueq circumdeumreuq circumdeumrequ circumdeumqrue circumdeumqreu
circumdeumqure circumdeumquer circumdeumqeur circumdeumqeru circumdeumuqre circumdeumuqer circumdeumurqe circumdeumureq
circumdeumuerq circumdeumueqr circumdeumequr circumdeumeqru circumdeumeuqr circumdeumeurq circumdeumeruq circumdeumerqu
circumdeurmque circumdeurmqeu circumdeurmuqe circumdeurmueq circumdeurmeuq circumdeurmequ circumdeurqmue circumdeurqmeu
circumdeurqume circumdeurquem circumdeurqeum circumdeurqemu circumdeuruqme circumdeuruqem circumdeurumqe circumdeurumeq
circumdeuruemq circumdeurueqm circumdeurequm circumdeureqmu circumdeureuqm circumdeureumq circumdeuremuq circumdeuremqu
circumdeuqrmue circumdeuqrmeu circumdeuqrume circumdeuqruem circumdeuqreum circumdeuqremu circumdeuqmrue circumdeuqmreu
circumdeuqmure circumdeuqmuer circumdeuqmeur circumdeuqmeru circumdeuqumre circumdeuqumer circumdeuqurme circumdeuqurem
circumdeuquerm circumdeuquemr circumdeuqemur circumdeuqemru circumdeuqeumr circumdeuqeurm circumdeuqerum circumdeuqermu
circumdeuurqme circumdeuurqem circumdeuurmqe circumdeuurmeq circumdeuuremq circumdeuureqm circumdeuuqrme circumdeuuqrem
circumdeuuqmre circumdeuuqmer circumdeuuqemr circumdeuuqerm circumdeuumqre circumdeuumqer circumdeuumrqe circumdeuumreq
circumdeuumerq circumdeuumeqr circumdeuueqmr circumdeuueqrm circumdeuuemqr circumdeuuemrq circumdeuuermq circumdeuuerqm
circumdeuerqum circumdeuerqmu circumdeueruqm circumdeuerumq circumdeuermuq circumdeuermqu circumdeueqrum circumdeueqrmu
circumdeuequrm circumdeuequmr circumdeueqmur circumdeueqmru circumdeueuqrm circumdeueuqmr circumdeueurqm circumdeueurmq
circumdeueumrq circumdeueumqr circumdeuemqur circumdeuemqru circumdeuemuqr circumdeuemurq circumdeuemruq circumdeuemrqu
circumderumque circumderumqeu circumderumuqe circumderumueq circumderumeuq circumderumequ circumderuqmue circumderuqmeu
circumderuqume circumderuquem circumderuqeum circumderuqemu circumderuuqme circumderuuqem circumderuumqe circumderuumeq
circumderuuemq circumderuueqm circumderuequm circumderueqmu circumderueuqm circumderueumq circumderuemuq circumderuemqu
circumdermuque circumdermuqeu circumdermuuqe circumdermuueq circumdermueuq circumdermuequ circumdermquue circumdermqueu
circumdermquue circumdermqueu circumdermqeuu circumdermqeuu circumdermuque circumdermuqeu circumdermuuqe circumdermuueq
circumdermueuq circumdermuequ circumdermequu circumdermequu circumdermeuqu circumdermeuuq circumdermeuuq circumdermeuqu
circumderqmuue circumderqmueu circumderqmuue circumderqmueu circumderqmeuu circumderqmeuu circumderqumue circumderqumeu
circumderquume circumderquuem circumderqueum circumderquemu circumderquume circumderquuem circumderqumue circumderqumeu
circumderquemu circumderqueum circumderqeuum circumderqeumu circumderqeuum circumderqeumu circumderqemuu circumderqemuu
circumderumque circumderumqeu circumderumuqe circumderumueq circumderumeuq circumderumequ circumderuqmue circumderuqmeu
circumderuqume circumderuquem circumderuqeum circumderuqemu circumderuuqme circumderuuqem circumderuumqe circumderuumeq
circumderuuemq circumderuueqm circumderuequm circumderueqmu circumderueuqm circumderueumq circumderuemuq circumderuemqu
circumderemquu circumderemquu circumderemuqu circumderemuuq circumderemuuq circumderemuqu circumdereqmuu circumdereqmuu
circumderequmu circumderequum circumderequum circumderequmu circumdereuqmu circumdereuqum circumdereumqu circumdereumuq
circumdereuumq circumdereuuqm circumdereuqum circumdereuqmu circumdereuuqm circumdereuumq circumdereumuq circumdereumqu
circumdequrmue circumdequrmeu circumdequrume circumdequruem circumdequreum circumdequremu circumdequmrue circumdequmreu
circumdequmure circumdequmuer circumdequmeur circumdequmeru circumdequumre circumdequumer circumdequurme circumdequurem
circumdequuerm circumdequuemr circumdequemur circumdequemru circumdequeumr circumdequeurm circumdequerum circumdequermu
circumdeqrumue circumdeqrumeu circumdeqruume circumdeqruuem circumdeqrueum circumdeqruemu circumdeqrmuue circumdeqrmueu
circumdeqrmuue circumdeqrmueu circumdeqrmeuu circumdeqrmeuu circumdeqrumue circumdeqrumeu circumdeqruume circumdeqruuem
circumdeqrueum circumdeqruemu circumdeqremuu circumdeqremuu circumdeqreumu circumdeqreuum circumdeqreuum circumdeqreumu
circumdeqmruue circumdeqmrueu circumdeqmruue circumdeqmrueu circumdeqmreuu circumdeqmreuu circumdeqmurue circumdeqmureu
circumdeqmuure circumdeqmuuer circumdeqmueur circumdeqmueru circumdeqmuure circumdeqmuuer circumdeqmurue circumdeqmureu
circumdeqmueru circumdeqmueur circumdeqmeuur circumdeqmeuru circumdeqmeuur circumdeqmeuru circumdeqmeruu circumdeqmeruu
circumdequrmue circumdequrmeu circumdequrume circumdequruem circumdequreum circumdequremu circumdequmrue circumdequmreu
circumdequmure circumdequmuer circumdequmeur circumdequmeru circumdequumre circumdequumer circumdequurme circumdequurem
circumdequuerm circumdequuemr circumdequemur circumdequemru circumdequeumr circumdequeurm circumdequerum circumdequermu
circumdeqermuu circumdeqermuu circumdeqerumu circumdeqeruum circumdeqeruum circumdeqerumu circumdeqemruu circumdeqemruu
circumdeqemuru circumdeqemuur circumdeqemuur circumdeqemuru circumdeqeumru circumdeqeumur circumdeqeurmu circumdeqeurum
circumdeqeuurm circumdeqeuumr circumdeqeumur circumdeqeumru circumdeqeuumr circumdeqeuurm circumdeqeurum circumdeqeurmu
circumdeuurqme circumdeuurqem circumdeuurmqe circumdeuurmeq circumdeuuremq circumdeuureqm circumdeuuqrme circumdeuuqrem
circumdeuuqmre circumdeuuqmer circumdeuuqemr circumdeuuqerm circumdeuumqre circumdeuumqer circumdeuumrqe circumdeuumreq
circumdeuumerq circumdeuumeqr circumdeuueqmr circumdeuueqrm circumdeuuemqr circumdeuuemrq circumdeuuermq circumdeuuerqm
circumdeuruqme circumdeuruqem circumdeurumqe circumdeurumeq circumdeuruemq circumdeurueqm circumdeurqume circumdeurquem
circumdeurqmue circumdeurqmeu circumdeurqemu circumdeurqeum circumdeurmque circumdeurmqeu circumdeurmuqe circumdeurmueq
circumdeurmeuq circumdeurmequ circumdeureqmu circumdeurequm circumdeuremqu circumdeuremuq circumdeureumq circumdeureuqm
circumdeuqrume circumdeuqruem circumdeuqrmue circumdeuqrmeu circumdeuqremu circumdeuqreum circumdeuqurme circumdeuqurem
circumdeuqumre circumdeuqumer circumdeuquemr circumdeuquerm circumdeuqmure circumdeuqmuer circumdeuqmrue circumdeuqmreu
circumdeuqmeru circumdeuqmeur circumdeuqeumr circumdeuqeurm circumdeuqemur circumdeuqemru circumdeuqermu circumdeuqerum
circumdeumrque circumdeumrqeu circumdeumruqe circumdeumrueq circumdeumreuq circumdeumrequ circumdeumqrue circumdeumqreu
circumdeumqure circumdeumquer circumdeumqeur circumdeumqeru circumdeumuqre circumdeumuqer circumdeumurqe circumdeumureq
circumdeumuerq circumdeumueqr circumdeumequr circumdeumeqru circumdeumeuqr circumdeumeurq circumdeumeruq circumdeumerqu
circumdeuerqmu circumdeuerqum circumdeuermqu circumdeuermuq circumdeuerumq circumdeueruqm circumdeueqrmu circumdeueqrum
circumdeueqmru circumdeueqmur circumdeuequmr circumdeuequrm circumdeuemqru circumdeuemqur circumdeuemrqu circumdeuemruq
circumdeuemurq circumdeuemuqr circumdeueuqmr circumdeueuqrm circumdeueumqr circumdeueumrq circumdeueurmq circumdeueurqm
circumdeeurqum circumdeeurqmu circumdeeuruqm circumdeeurumq circumdeeurmuq circumdeeurmqu circumdeeuqrum circumdeeuqrmu
circumdeeuqurm circumdeeuqumr circumdeeuqmur circumdeeuqmru circumdeeuuqrm circumdeeuuqmr circumdeeuurqm circumdeeuurmq
circumdeeuumrq circumdeeuumqr circumdeeumqur circumdeeumqru circumdeeumuqr circumdeeumurq circumdeeumruq circumdeeumrqu
circumdeeruqum circumdeeruqmu circumdeeruuqm circumdeeruumq circumdeerumuq circumdeerumqu circumdeerquum circumdeerqumu
circumdeerquum circumdeerqumu circumdeerqmuu circumdeerqmuu circumdeeruqum circumdeeruqmu circumdeeruuqm circumdeeruumq
circumdeerumuq circumdeerumqu circumdeermquu circumdeermquu circumdeermuqu circumdeermuuq circumdeermuuq circumdeermuqu
circumdeeqruum circumdeeqrumu circumdeeqruum circumdeeqrumu circumdeeqrmuu circumdeeqrmuu circumdeequrum circumdeequrmu
circumdeequurm circumdeequumr circumdeequmur circumdeequmru circumdeequurm circumdeequumr circumdeequrum circumdeequrmu
circumdeequmru circumdeequmur circumdeeqmuur circumdeeqmuru circumdeeqmuur circumdeeqmuru circumdeeqmruu circumdeeqmruu
circumdeeurqum circumdeeurqmu circumdeeuruqm circumdeeurumq circumdeeurmuq circumdeeurmqu circumdeeuqrum circumdeeuqrmu
circumdeeuqurm circumdeeuqumr circumdeeuqmur circumdeeuqmru circumdeeuuqrm circumdeeuuqmr circumdeeuurqm circumdeeuurmq
circumdeeuumrq circumdeeuumqr circumdeeumqur circumdeeumqru circumdeeumuqr circumdeeumurq circumdeeumruq circumdeeumrqu
circumdeemrquu circumdeemrquu circumdeemruqu circumdeemruuq circumdeemruuq circumdeemruqu circumdeemqruu circumdeemqruu
circumdeemquru circumdeemquur circumdeemquur circumdeemquru circumdeemuqru circumdeemuqur circumdeemurqu circumdeemuruq
circumdeemuurq circumdeemuuqr circumdeemuqur circumdeemuqru circumdeemuuqr circumdeemuurq circumdeemuruq circumdeemurqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us