easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

totemic

miniversion

toolbuilder

iowacity

minuends

kropp

unvitalized

nullanulla

dispicies

diplomac

canephoros

discoursiveness

rodenbeck

tequilas

lysanias

whaleysville

flashboard

languidness


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: cilicia
cipher variations:
djmjdjb eknkekc flolfld gmpmgme hnqnhnf
ioroiog jpspjph kqtqkqi lrurlrj msvsmsk
ntwtntl ouxuoum pvyvpvn qwzwqwo rxaxrxp
sybysyq tzcztzr uadauas vbebvbt wcfcwcu
xdgdxdv yeheyew zfifzfx agjgagy bhkhbhz

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: cilicia
Cipher: xrorxrz

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: cilicia
Cipher: AAABA ABAAA ABABA ABAAA AAABA ABAAA AAAAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: cilicia
cipher variations:
djmjdjbhzizhzblpeplpbpfafpfbtvwvtvbxlslxlbfrkrfrbjhghjhb
nxcxnxbrnynrnbvdudvdbztqtztbeknkekciajaiacmqfqmqcqgbgqgc
uwxwuwcymtmymcgslsgsckihikicoydyoycsozosocwevewecauruauc
flolfldjbkbjbdnrgrnrdrhchrhdvxyxvxdznunzndhtmthtdljijljd
pzezpzdtpaptpdxfwfxfdbvsvbvdgmpmgmekclckceoshsosesidisie
wyzywyeaovoaoeiunuiuemkjkmkeqafaqaeuqbquqeygxgygecwtwcwe
hnqnhnfldmdldfptitptftjejtjfxzazxzfbpwpbpfjvovjvfnlklnlf
rbgbrbfvrcrvrfzhyhzhfdxuxdxfioroiogmenemegqujuqugukfkukg
yabayagcqxqcqgkwpwkwgomlmomgschcscgwsdswsgaiziaigeyvyeyg
jpspjphnfofnfhrvkvrvhvlglvlhzbcbzbhdryrdrhlxqxlxhpnmnpnh
tdidtdhxtetxthbjajbjhfzwzfzhkqtqkqiogpgogiswlwswiwmhmwmi
acdcacieszsesimyrymyiqonoqoiuejeueiyufuyuickbkckigaxagai
lrurlrjphqhphjtxmxtxjxninxnjbdedbdjftatftjnzsznzjrpoprpj
vfkfvfjzvgvzvjdlcldljhbybhbjmsvsmskqiriqikuynyuykyojoyok
cefecekgubugukoataoaksqpqsqkwglgwgkawhwawkemdmemkiczcick
ntwtntlrjsjrjlvzozvzlzpkpzpldfgfdflhvcvhvlpbubpbltrqrtrl
xhmhxhlbxixbxlfnenfnljdadjdlouxuoumsktkskmwapawamaqlqaqm
eghgegmiwdwiwmqcvcqcmusrsusmyiniyimcyjycymgofogomkebekem
pvyvpvntlultlnxbqbxbnbrmrbrnfhihfhnjxexjxnrdwdrdnvtstvtn
zjojzjndzkzdznhpgphpnlfcflfnqwzwqwoumvmumoycrcycocsnscso
gijigiokyfykyosexeseowutuwuoakpkakoealaeaoiqhqiqomgdgmgo
rxaxrxpvnwnvnpzdsdzdpdtotdtphjkjhjplzgzlzptfyftfpxvuvxvp
blqlblpfbmbfbpjrirjrpnhehnhpsybysyqwoxowoqaeteaeqeupueuq
iklkikqmahamaqugzgugqywvwywqcmrmcmqgcncgcqksjsksqoifioiq
tzcztzrxpypxprbfufbfrfvqvfvrjlmljlrnbibnbrvhahvhrzxwxzxr
dnsndnrhdodhdrltktltrpjgjpjruadauasyqzqyqscgvgcgsgwrwgws
kmnmkmsocjcocswibiwisayxyayseotoeosiepeiesmulumusqkhkqks
vbebvbtzrarzrtdhwhdhthxsxhxtlnonlntpdkdpdtxjcjxjtbzyzbzt
fpupfptjfqfjftnvmvnvtrlilrltwcfcwcuasbsasueixieiuiytyiyu
mopomouqeleqeuykdkykucazacaugqvqgqukgrgkguownwowusmjmsmu
xdgdxdvbtctbtvfjyjfjvjzuzjzvnpqpnpvrfmfrfvzlelzlvdbabdbv
hrwrhrvlhshlhvpxoxpxvtnkntnvyeheyewcuducuwgkzkgkwkavakaw
oqrqoqwsgngsgwamfmamwecbcecwisxsiswmitimiwqypyqywuolouow
zfifzfxdvevdvxhlalhlxlbwblbxprsrprxthohthxbngnbnxfdcdfdx
jtytjtxnjujnjxrzqzrzxvpmpvpxagjgagyewfwewyimbmimymcxcmcy
qstsqsyuipiuiycohocoygedegeykuzukuyokvkokysarasaywqnqwqy
bhkhbhzfxgxfxzjncnjnzndydndzrtutrtzvjqjvjzdpipdpzhfefhfz
lvavlvzplwlplztbsbtbzxrorxrzciliciagyhygyakodokoaoezeoea
suvusuawkrkwkaeqjqeqaigfgigamwbwmwaqmxmqmauctcucayspsysa

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: cilicia
Cipher: pvyvpvn

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: cilicia
Cipher: 31421342314211

Extended Methods:
Method #1

Plaintext: cilicia
method variations:
hoqohofntvtntlsyaysyqxdfdxdv

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
c i l i c i a 
3 4 1 4 3 4 1 
1 2 3 2 1 2 1 
They are then read out in rows:
34143411232121
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: cilicia
Cipher: sqsambb

Read more ...
Method #3

Plaintext: cilicia
method variations:
qbsmqbl bsmqblq smqblqb
mqblqbs qblqbsm blqbsmq
lqbsmqb

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: cilicia

all 5040 cipher variations:
cilicia cilicai ciliica ciliiac ciliaic ciliaci cilciia cilciai cilciia cilciai cilcaii
cilcaii cilicia cilicai ciliica ciliiac ciliaic ciliaci cilacii cilacii cilaici cilaiic
cilaiic cilaici ciilcia ciilcai ciilica ciiliac ciilaic ciilaci ciiclia ciiclai ciicila
ciicial ciicail ciicali ciiicla ciiical ciiilca ciiilac ciiialc ciiiacl ciiacil ciiacli
ciiaicl ciiailc ciialic ciialci cicilia cicilai ciciila ciciial ciciail ciciali cicliia
cicliai cicliia cicliai ciclaii ciclaii cicilia cicilai ciciila ciciial ciciail ciciali
cicalii cicalii cicaili cicaiil cicaiil cicaili ciiicla ciiical ciiilca ciiilac ciiialc
ciiiacl ciicila ciicial ciiclia ciiclai ciicali ciicail ciilcia ciilcai ciilica ciiliac
ciilaic ciilaci ciiacli ciiacil ciialci ciialic ciiailc ciiaicl ciaicil ciaicli ciaiicl
ciaiilc ciailic ciailci ciaciil ciacili ciaciil ciacili ciaclii ciaclii ciaicil ciaicli
ciaiicl ciaiilc ciailic ciailci cialcii cialcii cialici cialiic cialiic cialici cliicia
cliicai cliiica cliiiac cliiaic cliiaci cliciia cliciai cliciia cliciai clicaii clicaii
cliicia cliicai cliiica cliiiac cliiaic cliiaci cliacii cliacii cliaici cliaiic cliaiic
cliaici cliicia cliicai cliiica cliiiac cliiaic cliiaci cliciia cliciai cliciia cliciai
clicaii clicaii cliicia cliicai cliiica cliiiac cliiaic cliiaci cliacii cliacii cliaici
cliaiic cliaiic cliaici clciiia clciiai clciiia clciiai clciaii clciaii clciiia clciiai
clciiia clciiai clciaii clciaii clciiia clciiai clciiia clciiai clciaii clciaii clcaiii
clcaiii clcaiii clcaiii clcaiii clcaiii cliicia cliicai cliiica cliiiac cliiaic cliiaci
cliciia cliciai cliciia cliciai clicaii clicaii cliicia cliicai cliiica cliiiac cliiaic
cliiaci cliacii cliacii cliaici cliaiic cliaiic cliaici claicii claicii claiici claiiic
claiiic claiici claciii claciii claciii claciii claciii claciii claicii claicii claiici
claiiic claiiic claiici claicii claicii claiici claiiic claiiic claiici cilicia cilicai
ciliica ciliiac ciliaic ciliaci cilciia cilciai cilciia cilciai cilcaii cilcaii cilicia
cilicai ciliica ciliiac ciliaic ciliaci cilacii cilacii cilaici cilaiic cilaiic cilaici
ciilcia ciilcai ciilica ciiliac ciilaic ciilaci ciiclia ciiclai ciicila ciicial ciicail
ciicali ciiicla ciiical ciiilca ciiilac ciiialc ciiiacl ciiacil ciiacli ciiaicl ciiailc
ciialic ciialci cicilia cicilai ciciila ciciial ciciail ciciali cicliia cicliai cicliia
cicliai ciclaii ciclaii cicilia cicilai ciciila ciciial ciciail ciciali cicalii cicalii
cicaili cicaiil cicaiil cicaili ciiicla ciiical ciiilca ciiilac ciiialc ciiiacl ciicila
ciicial ciiclia ciiclai ciicali ciicail ciilcia ciilcai ciilica ciiliac ciilaic ciilaci
ciiacli ciiacil ciialci ciialic ciiailc ciiaicl ciaicil ciaicli ciaiicl ciaiilc ciailic
ciailci ciaciil ciacili ciaciil ciacili ciaclii ciaclii ciaicil ciaicli ciaiicl ciaiilc
ciailic ciailci cialcii cialcii cialici cialiic cialiic cialici ccliiia ccliiai ccliiia
ccliiai ccliaii ccliaii ccliiia ccliiai ccliiia ccliiai ccliaii ccliaii ccliiia ccliiai
ccliiia ccliiai ccliaii ccliaii cclaiii cclaiii cclaiii cclaiii cclaiii cclaiii cciliia
cciliai cciliia cciliai ccilaii ccilaii cciilia cciilai cciiila cciiial cciiail cciiali
cciiila cciiial cciilia cciilai cciiali cciiail cciaiil cciaili cciaiil cciaili ccialii
ccialii cciilia cciilai cciiila cciiial cciiail cciiali cciliia cciliai cciliia cciliai
ccilaii ccilaii cciilia cciilai cciiila cciiial cciiail cciiali ccialii ccialii cciaili
cciaiil cciaiil cciaili cciiila cciiial cciilia cciilai cciiali cciiail cciiila cciiial
cciilia cciilai cciiali cciiail cciliia cciliai cciliia cciliai ccilaii ccilaii cciaili
cciaiil ccialii ccialii cciaili cciaiil ccaiiil ccaiili ccaiiil ccaiili ccailii ccailii
ccaiiil ccaiili ccaiiil ccaiili ccailii ccailii ccaiiil ccaiili ccaiiil ccaiili ccailii
ccailii ccaliii ccaliii ccaliii ccaliii ccaliii ccaliii cilicia cilicai ciliica ciliiac
ciliaic ciliaci cilciia cilciai cilciia cilciai cilcaii cilcaii cilicia cilicai ciliica
ciliiac ciliaic ciliaci cilacii cilacii cilaici cilaiic cilaiic cilaici ciilcia ciilcai
ciilica ciiliac ciilaic ciilaci ciiclia ciiclai ciicila ciicial ciicail ciicali ciiicla
ciiical ciiilca ciiilac ciiialc ciiiacl ciiacil ciiacli ciiaicl ciiailc ciialic ciialci
cicilia cicilai ciciila ciciial ciciail ciciali cicliia cicliai cicliia cicliai ciclaii
ciclaii cicilia cicilai ciciila ciciial ciciail ciciali cicalii cicalii cicaili cicaiil
cicaiil cicaili ciiicla ciiical ciiilca ciiilac ciiialc ciiiacl ciicila ciicial ciiclia
ciiclai ciicali ciicail ciilcia ciilcai ciilica ciiliac ciilaic ciilaci ciiacli ciiacil
ciialci ciialic ciiailc ciiaicl ciaicil ciaicli ciaiicl ciaiilc ciailic ciailci ciaciil
ciacili ciaciil ciacili ciaclii ciaclii ciaicil ciaicli ciaiicl ciaiilc ciailic ciailci
cialcii cialcii cialici cialiic cialiic cialici calicii calicii caliici caliiic caliiic
caliici calciii calciii calciii calciii calciii calciii calicii calicii caliici caliiic
caliiic caliici calicii calicii caliici caliiic caliiic caliici cailcii cailcii cailici
cailiic cailiic cailici caiclii caiclii caicili caiciil caiciil caicili caiicli caiicil
caiilci caiilic caiiilc caiiicl caiicil caiicli caiiicl caiiilc caiilic caiilci cacilii
cacilii caciili caciiil caciiil caciili cacliii cacliii cacliii cacliii cacliii cacliii
cacilii cacilii caciili caciiil caciiil caciili cacilii cacilii caciili caciiil caciiil
caciili caiicli caiicil caiilci caiilic caiiilc caiiicl caicili caiciil caiclii caiclii
caicili caiciil cailcii cailcii cailici cailiic cailiic cailici caiicli caiicil caiilci
caiilic caiiilc caiiicl caiicil caiicli caiiicl caiiilc caiilic caiilci caiciil caicili
caiciil caicili caiclii caiclii caiicil caiicli caiiicl caiiilc caiilic caiilci cailcii
cailcii cailici cailiic cailiic cailici iclicia iclicai icliica icliiac icliaic icliaci
iclciia iclciai iclciia iclciai iclcaii iclcaii iclicia iclicai icliica icliiac icliaic
icliaci iclacii iclacii iclaici iclaiic iclaiic iclaici icilcia icilcai icilica iciliac
icilaic icilaci iciclia iciclai icicila icicial icicail icicali iciicla iciical iciilca
iciilac iciialc iciiacl iciacil iciacli iciaicl iciailc icialic icialci iccilia iccilai
icciila icciial icciail icciali iccliia iccliai iccliia iccliai icclaii icclaii iccilia
iccilai icciila icciial icciail icciali iccalii iccalii iccaili iccaiil iccaiil iccaili
iciicla iciical iciilca iciilac iciialc iciiacl icicila icicial iciclia iciclai icicali
icicail icilcia icilcai icilica iciliac icilaic icilaci iciacli iciacil icialci icialic
iciailc iciaicl icaicil icaicli icaiicl icaiilc icailic icailci icaciil icacili icaciil
icacili icaclii icaclii icaicil icaicli icaiicl icaiilc icailic icailci icalcii icalcii
icalici icaliic icaliic icalici ilcicia ilcicai ilciica ilciiac ilciaic ilciaci ilcciia
ilcciai ilcciia ilcciai ilccaii ilccaii ilcicia ilcicai ilciica ilciiac ilciaic ilciaci
ilcacii ilcacii ilcaici ilcaiic ilcaiic ilcaici iliccia iliccai ilicica iliciac ilicaic
ilicaci iliccia iliccai ilicica iliciac ilicaic ilicaci iliicca iliicac iliicca iliicac
iliiacc iliiacc iliacic iliacci iliaicc iliaicc iliacic iliacci ilcicia ilcicai ilciica
ilciiac ilciaic ilciaci ilcciia ilcciai ilcciia ilcciai ilccaii ilccaii ilcicia ilcicai
ilciica ilciiac ilciaic ilciaci ilcacii ilcacii ilcaici ilcaiic ilcaiic ilcaici iliicca
iliicac iliicca iliicac iliiacc iliiacc ilicica iliciac iliccia iliccai ilicaci ilicaic
iliccia iliccai ilicica iliciac ilicaic ilicaci iliacci iliacic iliacci iliacic iliaicc
iliaicc ilaicic ilaicci ilaiicc ilaiicc ilaicic ilaicci ilaciic ilacici ilaciic ilacici
ilaccii ilaccii ilaicic ilaicci ilaiicc ilaiicc ilaicic ilaicci ilaccii ilaccii ilacici
ilaciic ilaciic ilacici iilccia iilccai iilcica iilciac iilcaic iilcaci iilccia iilccai
iilcica iilciac iilcaic iilcaci iilicca iilicac iilicca iilicac iiliacc iiliacc iilacic
iilacci iilaicc iilaicc iilacic iilacci iiclcia iiclcai iiclica iicliac iiclaic iiclaci
iicclia iicclai iiccila iiccial iiccail iiccali iicicla iicical iicilca iicilac iicialc
iiciacl iicacil iicacli iicaicl iicailc iicalic iicalci iicclia iicclai iiccila iiccial
iiccail iiccali iiclcia iiclcai iiclica iicliac iiclaic iiclaci iicilca iicilac iicicla
iicical iiciacl iicialc iicalic iicalci iicailc iicaicl iicacil iicacli iiiccla iiiccal
iiiclca iiiclac iiicalc iiicacl iiiccla iiiccal iiiclca iiiclac iiicalc iiicacl iiilcca
iiilcac iiilcca iiilcac iiilacc iiilacc iiiaclc iiiaccl iiialcc iiialcc iiiaclc iiiaccl
iiaccil iiaccli iiacicl iiacilc iiaclic iiaclci iiaccil iiaccli iiacicl iiacilc iiaclic
iiaclci iiaiccl iiaiclc iiaiccl iiaiclc iiailcc iiailcc iialcic iialcci iialicc iialicc
iialcic iialcci iclicia iclicai icliica icliiac icliaic icliaci iclciia iclciai iclciia
iclciai iclcaii iclcaii iclicia iclicai icliica icliiac icliaic icliaci iclacii iclacii
iclaici iclaiic iclaiic iclaici icilcia icilcai icilica iciliac icilaic icilaci iciclia
iciclai icicila icicial icicail icicali iciicla iciical iciilca iciilac iciialc iciiacl
iciacil iciacli iciaicl iciailc icialic icialci iccilia iccilai icciila icciial icciail
icciali iccliia iccliai iccliia iccliai icclaii icclaii iccilia iccilai icciila icciial
icciail icciali iccalii iccalii iccaili iccaiil iccaiil iccaili iciicla iciical iciilca
iciilac iciialc iciiacl icicila icicial iciclia iciclai icicali icicail icilcia icilcai
icilica iciliac icilaic icilaci iciacli iciacil icialci icialic iciailc iciaicl icaicil
icaicli icaiicl icaiilc icailic icailci icaciil icacili icaciil icacili icaclii icaclii
icaicil icaicli icaiicl icaiilc icailic icailci icalcii icalcii icalici icaliic icaliic
icalici iilicca iilicac iilicca iilicac iiliacc iiliacc iilcica iilciac iilccia iilccai
iilcaci iilcaic iilccia iilccai iilcica iilciac iilcaic iilcaci iilacci iilacic iilacci
iilacic iilaicc iilaicc iiilcca iiilcac iiilcca iiilcac iiilacc iiilacc iiiclca iiiclac
iiiccla iiiccal iiicacl iiicalc iiiccla iiiccal iiiclca iiiclac iiicalc iiicacl iiiaccl
iiiaclc iiiaccl iiiaclc iiialcc iiialcc iicilca iicilac iicicla iicical iiciacl iicialc
iiclica iicliac iiclcia iiclcai iiclaci iiclaic iicclia iicclai iiccila iiccial iiccail
iiccali iicalci iicalic iicacli iicacil iicaicl iicailc iicicla iicical iicilca iicilac
iicialc iiciacl iiccila iiccial iicclia iicclai iiccali iiccail iiclcia iiclcai iiclica
iicliac iiclaic iiclaci iicacli iicacil iicalci iicalic iicailc iicaicl iiaiccl iiaiclc
iiaiccl iiaiclc iiailcc iiailcc iiacicl iiacilc iiaccil iiaccli iiaclci iiaclic iiaccil
iiaccli iiacicl iiacilc iiaclic iiaclci iialcci iialcic iialcci iialcic iialicc iialicc
ialicic ialicci ialiicc ialiicc ialicic ialicci ialciic ialcici ialciic ialcici ialccii
ialccii ialicic ialicci ialiicc ialiicc ialicic ialicci ialccii ialccii ialcici ialciic
ialciic ialcici iailcic iailcci iailicc iailicc iailcic iailcci iaiclic iaiclci iaicilc
iaicicl iaiccil iaiccli iaiiclc iaiiccl iaiilcc iaiilcc iaiiclc iaiiccl iaiccil iaiccli
iaicicl iaicilc iaiclic iaiclci iacilic iacilci iaciilc iaciicl iacicil iacicli iacliic
iaclici iacliic iaclici iaclcii iaclcii iacilic iacilci iaciilc iaciicl iacicil iacicli
iacclii iacclii iaccili iacciil iacciil iaccili iaiiclc iaiiccl iaiilcc iaiilcc iaiiclc
iaiiccl iaicilc iaicicl iaiclic iaiclci iaiccli iaiccil iailcic iailcci iailicc iailicc
iailcic iailcci iaiccli iaiccil iaiclci iaiclic iaicilc iaicicl iacicil iacicli iaciicl
iaciilc iacilic iacilci iacciil iaccili iacciil iaccili iacclii iacclii iacicil iacicli
iaciicl iaciilc iacilic iacilci iaclcii iaclcii iaclici iacliic iacliic iaclici licicia
licicai liciica liciiac liciaic liciaci licciia licciai licciia licciai liccaii liccaii
licicia licicai liciica liciiac liciaic liciaci licacii licacii licaici licaiic licaiic
licaici liiccia liiccai liicica liiciac liicaic liicaci liiccia liiccai liicica liiciac
liicaic liicaci liiicca liiicac liiicca liiicac liiiacc liiiacc liiacic liiacci liiaicc
liiaicc liiacic liiacci licicia licicai liciica liciiac liciaic liciaci licciia licciai
licciia licciai liccaii liccaii licicia licicai liciica liciiac liciaic liciaci licacii
licacii licaici licaiic licaiic licaici liiicca liiicac liiicca liiicac liiiacc liiiacc
liicica liiciac liiccia liiccai liicaci liicaic liiccia liiccai liicica liiciac liicaic
liicaci liiacci liiacic liiacci liiacic liiaicc liiaicc liaicic liaicci liaiicc liaiicc
liaicic liaicci liaciic liacici liaciic liacici liaccii liaccii liaicic liaicci liaiicc
liaiicc liaicic liaicci liaccii liaccii liacici liaciic liaciic liacici lciicia lciicai
lciiica lciiiac lciiaic lciiaci lciciia lciciai lciciia lciciai lcicaii lcicaii lciicia
lciicai lciiica lciiiac lciiaic lciiaci lciacii lciacii lciaici lciaiic lciaiic lciaici
lciicia lciicai lciiica lciiiac lciiaic lciiaci lciciia lciciai lciciia lciciai lcicaii
lcicaii lciicia lciicai lciiica lciiiac lciiaic lciiaci lciacii lciacii lciaici lciaiic
lciaiic lciaici lcciiia lcciiai lcciiia lcciiai lcciaii lcciaii lcciiia lcciiai lcciiia
lcciiai lcciaii lcciaii lcciiia lcciiai lcciiia lcciiai lcciaii lcciaii lccaiii lccaiii
lccaiii lccaiii lccaiii lccaiii lciicia lciicai lciiica lciiiac lciiaic lciiaci lciciia
lciciai lciciia lciciai lcicaii lcicaii lciicia lciicai lciiica lciiiac lciiaic lciiaci
lciacii lciacii lciaici lciaiic lciaiic lciaici lcaicii lcaicii lcaiici lcaiiic lcaiiic
lcaiici lcaciii lcaciii lcaciii lcaciii lcaciii lcaciii lcaicii lcaicii lcaiici lcaiiic
lcaiiic lcaiici lcaicii lcaicii lcaiici lcaiiic lcaiiic lcaiici licicia licicai liciica
liciiac liciaic liciaci licciia licciai licciia licciai liccaii liccaii licicia licicai
liciica liciiac liciaic liciaci licacii licacii licaici licaiic licaiic licaici liiccia
liiccai liicica liiciac liicaic liicaci liiccia liiccai liicica liiciac liicaic liicaci
liiicca liiicac liiicca liiicac liiiacc liiiacc liiacic liiacci liiaicc liiaicc liiacic
liiacci licicia licicai liciica liciiac liciaic liciaci licciia licciai licciia licciai
liccaii liccaii licicia licicai liciica liciiac liciaic liciaci licacii licacii licaici
licaiic licaiic licaici liiicca liiicac liiicca liiicac liiiacc liiiacc liicica liiciac
liiccia liiccai liicaci liicaic liiccia liiccai liicica liiciac liicaic liicaci liiacci
liiacic liiacci liiacic liiaicc liiaicc liaicic liaicci liaiicc liaiicc liaicic liaicci
liaciic liacici liaciic liacici liaccii liaccii liaicic liaicci liaiicc liaiicc liaicic
liaicci liaccii liaccii liacici liaciic liaciic liacici lcciiia lcciiai lcciiia lcciiai
lcciaii lcciaii lcciiia lcciiai lcciiia lcciiai lcciaii lcciaii lcciiia lcciiai lcciiia
lcciiai lcciaii lcciaii lccaiii lccaiii lccaiii lccaiii lccaiii lccaiii lciciia lciciai
lciciia lciciai lcicaii lcicaii lciicia lciicai lciiica lciiiac lciiaic lciiaci lciiica
lciiiac lciicia lciicai lciiaci lciiaic lciaiic lciaici lciaiic lciaici lciacii lciacii
lciicia lciicai lciiica lciiiac lciiaic lciiaci lciciia lciciai lciciia lciciai lcicaii
lcicaii lciicia lciicai lciiica lciiiac lciiaic lciiaci lciacii lciacii lciaici lciaiic
lciaiic lciaici lciiica lciiiac lciicia lciicai lciiaci lciiaic lciiica lciiiac lciicia
lciicai lciiaci lciiaic lciciia lciciai lciciia lciciai lcicaii lcicaii lciaici lciaiic
lciacii lciacii lciaici lciaiic lcaiiic lcaiici lcaiiic lcaiici lcaicii lcaicii lcaiiic
lcaiici lcaiiic lcaiici lcaicii lcaicii lcaiiic lcaiici lcaiiic lcaiici lcaicii lcaicii
lcaciii lcaciii lcaciii lcaciii lcaciii lcaciii licicia licicai liciica liciiac liciaic
liciaci licciia licciai licciia licciai liccaii liccaii licicia licicai liciica liciiac
liciaic liciaci licacii licacii licaici licaiic licaiic licaici liiccia liiccai liicica
liiciac liicaic liicaci liiccia liiccai liicica liiciac liicaic liicaci liiicca liiicac
liiicca liiicac liiiacc liiiacc liiacic liiacci liiaicc liiaicc liiacic liiacci licicia
licicai liciica liciiac liciaic liciaci licciia licciai licciia licciai liccaii liccaii
licicia licicai liciica liciiac liciaic liciaci licacii licacii licaici licaiic licaiic
licaici liiicca liiicac liiicca liiicac liiiacc liiiacc liicica liiciac liiccia liiccai
liicaci liicaic liiccia liiccai liicica liiciac liicaic liicaci liiacci liiacic liiacci
liiacic liiaicc liiaicc liaicic liaicci liaiicc liaiicc liaicic liaicci liaciic liacici
liaciic liacici liaccii liaccii liaicic liaicci liaiicc liaiicc liaicic liaicci liaccii
liaccii liacici liaciic liaciic liacici lacicii lacicii laciici laciiic laciiic laciici
lacciii lacciii lacciii lacciii lacciii lacciii lacicii lacicii laciici laciiic laciiic
laciici lacicii lacicii laciici laciiic laciiic laciici laiccii laiccii laicici laiciic
laiciic laicici laiccii laiccii laicici laiciic laiciic laicici laiicci laiicic laiicci
laiicic laiiicc laiiicc laiicic laiicci laiiicc laiiicc laiicic laiicci lacicii lacicii
laciici laciiic laciiic laciici lacciii lacciii lacciii lacciii lacciii lacciii lacicii
lacicii laciici laciiic laciiic laciici lacicii lacicii laciici laciiic laciiic laciici
laiicci laiicic laiicci laiicic laiiicc laiiicc laicici laiciic laiccii laiccii laicici
laiciic laiccii laiccii laicici laiciic laiciic laicici laiicci laiicic laiicci laiicic
laiiicc laiiicc laiicic laiicci laiiicc laiiicc laiicic laiicci laiciic laicici laiciic
laicici laiccii laiccii laiicic laiicci laiiicc laiiicc laiicic laiicci laiccii laiccii
laicici laiciic laiciic laicici iilccia iilccai iilcica iilciac iilcaic iilcaci iilccia
iilccai iilcica iilciac iilcaic iilcaci iilicca iilicac iilicca iilicac iiliacc iiliacc
iilacic iilacci iilaicc iilaicc iilacic iilacci iiclcia iiclcai iiclica iicliac iiclaic
iiclaci iicclia iicclai iiccila iiccial iiccail iiccali iicicla iicical iicilca iicilac
iicialc iiciacl iicacil iicacli iicaicl iicailc iicalic iicalci iicclia iicclai iiccila
iiccial iiccail iiccali iiclcia iiclcai iiclica iicliac iiclaic iiclaci iicilca iicilac
iicicla iicical iiciacl iicialc iicalic iicalci iicailc iicaicl iicacil iicacli iiiccla
iiiccal iiiclca iiiclac iiicalc iiicacl iiiccla iiiccal iiiclca iiiclac iiicalc iiicacl
iiilcca iiilcac iiilcca iiilcac iiilacc iiilacc iiiaclc iiiaccl iiialcc iiialcc iiiaclc
iiiaccl iiaccil iiaccli iiacicl iiacilc iiaclic iiaclci iiaccil iiaccli iiacicl iiacilc
iiaclic iiaclci iiaiccl iiaiclc iiaiccl iiaiclc iiailcc iiailcc iialcic iialcci iialicc
iialicc iialcic iialcci iliccia iliccai ilicica iliciac ilicaic ilicaci iliccia iliccai
ilicica iliciac ilicaic ilicaci iliicca iliicac iliicca iliicac iliiacc iliiacc iliacic
iliacci iliaicc iliaicc iliacic iliacci ilcicia ilcicai ilciica ilciiac ilciaic ilciaci
ilcciia ilcciai ilcciia ilcciai ilccaii ilccaii ilcicia ilcicai ilciica ilciiac ilciaic
ilciaci ilcacii ilcacii ilcaici ilcaiic ilcaiic ilcaici ilcciia ilcciai ilcciia ilcciai
ilccaii ilccaii ilcicia ilcicai ilciica ilciiac ilciaic ilciaci ilciica ilciiac ilcicia
ilcicai ilciaci ilciaic ilcaiic ilcaici ilcaiic ilcaici ilcacii ilcacii iliccia iliccai
ilicica iliciac ilicaic ilicaci iliccia iliccai ilicica iliciac ilicaic ilicaci iliicca
iliicac iliicca iliicac iliiacc iliiacc iliacic iliacci iliaicc iliaicc iliacic iliacci
ilaccii ilaccii ilacici ilaciic ilaciic ilacici ilaccii ilaccii ilacici ilaciic ilaciic
ilacici ilaicci ilaicic ilaicci ilaicic ilaiicc ilaiicc ilaicic ilaicci ilaiicc ilaiicc
ilaicic ilaicci iclicia iclicai icliica icliiac icliaic icliaci iclciia iclciai iclciia
iclciai iclcaii iclcaii iclicia iclicai icliica icliiac icliaic icliaci iclacii iclacii
iclaici iclaiic iclaiic iclaici icilcia icilcai icilica iciliac icilaic icilaci iciclia
iciclai icicila icicial icicail icicali iciicla iciical iciilca iciilac iciialc iciiacl
iciacil iciacli iciaicl iciailc icialic icialci iccilia iccilai icciila icciial icciail
icciali iccliia iccliai iccliia iccliai icclaii icclaii iccilia iccilai icciila icciial
icciail icciali iccalii iccalii iccaili iccaiil iccaiil iccaili iciicla iciical iciilca
iciilac iciialc iciiacl icicila icicial iciclia iciclai icicali icicail icilcia icilcai
icilica iciliac icilaic icilaci iciacli iciacil icialci icialic iciailc iciaicl icaicil
icaicli icaiicl icaiilc icailic icailci icaciil icacili icaciil icacili icaclii icaclii
icaicil icaicli icaiicl icaiilc icailic icailci icalcii icalcii icalici icaliic icaliic
icalici iclciia iclciai iclciia iclciai iclcaii iclcaii iclicia iclicai icliica icliiac
icliaic icliaci icliica icliiac iclicia iclicai icliaci icliaic iclaiic iclaici iclaiic
iclaici iclacii iclacii iccliia iccliai iccliia iccliai icclaii icclaii iccilia iccilai
icciila icciial icciail icciali icciila icciial iccilia iccilai icciali icciail iccaiil
iccaili iccaiil iccaili iccalii iccalii iciclia iciclai icicila icicial icicail icicali
icilcia icilcai icilica iciliac icilaic icilaci iciilca iciilac iciicla iciical iciiacl
iciialc icialic icialci iciailc iciaicl iciacil iciacli icicila icicial iciclia iciclai
icicali icicail iciicla iciical iciilca iciilac iciialc iciiacl icilica iciliac icilcia
icilcai icilaci icilaic iciailc iciaicl icialic icialci iciacli iciacil icaciil icacili
icaciil icacili icaclii icaclii icaicil icaicli icaiicl icaiilc icailic icailci icaiicl
icaiilc icaicil icaicli icailci icailic icaliic icalici icaliic icalici icalcii icalcii
iilccia iilccai iilcica iilciac iilcaic iilcaci iilccia iilccai iilcica iilciac iilcaic
iilcaci iilicca iilicac iilicca iilicac iiliacc iiliacc iilacic iilacci iilaicc iilaicc
iilacic iilacci iiclcia iiclcai iiclica iicliac iiclaic iiclaci iicclia iicclai iiccila
iiccial iiccail iiccali iicicla iicical iicilca iicilac iicialc iiciacl iicacil iicacli
iicaicl iicailc iicalic iicalci iicclia iicclai iiccila iiccial iiccail iiccali iiclcia
iiclcai iiclica iicliac iiclaic iiclaci iicilca iicilac iicicla iicical iiciacl iicialc
iicalic iicalci iicailc iicaicl iicacil iicacli iiiccla iiiccal iiiclca iiiclac iiicalc
iiicacl iiiccla iiiccal iiiclca iiiclac iiicalc iiicacl iiilcca iiilcac iiilcca iiilcac
iiilacc iiilacc iiiaclc iiiaccl iiialcc iiialcc iiiaclc iiiaccl iiaccil iiaccli iiacicl
iiacilc iiaclic iiaclci iiaccil iiaccli iiacicl iiacilc iiaclic iiaclci iiaiccl iiaiclc
iiaiccl iiaiclc iiailcc iiailcc iialcic iialcci iialicc iialicc iialcic iialcci ialccii
ialccii ialcici ialciic ialciic ialcici ialccii ialccii ialcici ialciic ialciic ialcici
ialicci ialicic ialicci ialicic ialiicc ialiicc ialicic ialicci ialiicc ialiicc ialicic
ialicci iaclcii iaclcii iaclici iacliic iacliic iaclici iacclii iacclii iaccili iacciil
iacciil iaccili iacicli iacicil iacilci iacilic iaciilc iaciicl iacicil iacicli iaciicl
iaciilc iacilic iacilci iacclii iacclii iaccili iacciil iacciil iaccili iaclcii iaclcii
iaclici iacliic iacliic iaclici iacilci iacilic iacicli iacicil iaciicl iaciilc iacilic
iacilci iaciilc iaciicl iacicil iacicli iaiccli iaiccil iaiclci iaiclic iaicilc iaicicl
iaiccli iaiccil iaiclci iaiclic iaicilc iaicicl iailcci iailcic iailcci iailcic iailicc
iailicc iaiiclc iaiiccl iaiilcc iaiilcc iaiiclc iaiiccl iaiccil iaiccli iaicicl iaicilc
iaiclic iaiclci iaiccil iaiccli iaicicl iaicilc iaiclic iaiclci iaiiccl iaiiclc iaiiccl
iaiiclc iaiilcc iaiilcc iailcic iailcci iailicc iailicc iailcic iailcci cilicia cilicai
ciliica ciliiac ciliaic ciliaci cilciia cilciai cilciia cilciai cilcaii cilcaii cilicia
cilicai ciliica ciliiac ciliaic ciliaci cilacii cilacii cilaici cilaiic cilaiic cilaici
ciilcia ciilcai ciilica ciiliac ciilaic ciilaci ciiclia ciiclai ciicila ciicial ciicail
ciicali ciiicla ciiical ciiilca ciiilac ciiialc ciiiacl ciiacil ciiacli ciiaicl ciiailc
ciialic ciialci cicilia cicilai ciciila ciciial ciciail ciciali cicliia cicliai cicliia
cicliai ciclaii ciclaii cicilia cicilai ciciila ciciial ciciail ciciali cicalii cicalii
cicaili cicaiil cicaiil cicaili ciiicla ciiical ciiilca ciiilac ciiialc ciiiacl ciicila
ciicial ciiclia ciiclai ciicali ciicail ciilcia ciilcai ciilica ciiliac ciilaic ciilaci
ciiacli ciiacil ciialci ciialic ciiailc ciiaicl ciaicil ciaicli ciaiicl ciaiilc ciailic
ciailci ciaciil ciacili ciaciil ciacili ciaclii ciaclii ciaicil ciaicli ciaiicl ciaiilc
ciailic ciailci cialcii cialcii cialici cialiic cialiic cialici cliicia cliicai cliiica
cliiiac cliiaic cliiaci cliciia cliciai cliciia cliciai clicaii clicaii cliicia cliicai
cliiica cliiiac cliiaic cliiaci cliacii cliacii cliaici cliaiic cliaiic cliaici cliicia
cliicai cliiica cliiiac cliiaic cliiaci cliciia cliciai cliciia cliciai clicaii clicaii
cliicia cliicai cliiica cliiiac cliiaic cliiaci cliacii cliacii cliaici cliaiic cliaiic
cliaici clciiia clciiai clciiia clciiai clciaii clciaii clciiia clciiai clciiia clciiai
clciaii clciaii clciiia clciiai clciiia clciiai clciaii clciaii clcaiii clcaiii clcaiii
clcaiii clcaiii clcaiii cliicia cliicai cliiica cliiiac cliiaic cliiaci cliciia cliciai
cliciia cliciai clicaii clicaii cliicia cliicai cliiica cliiiac cliiaic cliiaci cliacii
cliacii cliaici cliaiic cliaiic cliaici claicii claicii claiici claiiic claiiic claiici
claciii claciii claciii claciii claciii claciii claicii claicii claiici claiiic claiiic
claiici claicii claicii claiici claiiic claiiic claiici cilicia cilicai ciliica ciliiac
ciliaic ciliaci cilciia cilciai cilciia cilciai cilcaii cilcaii cilicia cilicai ciliica
ciliiac ciliaic ciliaci cilacii cilacii cilaici cilaiic cilaiic cilaici ciilcia ciilcai
ciilica ciiliac ciilaic ciilaci ciiclia ciiclai ciicila ciicial ciicail ciicali ciiicla
ciiical ciiilca ciiilac ciiialc ciiiacl ciiacil ciiacli ciiaicl ciiailc ciialic ciialci
cicilia cicilai ciciila ciciial ciciail ciciali cicliia cicliai cicliia cicliai ciclaii
ciclaii cicilia cicilai ciciila ciciial ciciail ciciali cicalii cicalii cicaili cicaiil
cicaiil cicaili ciiicla ciiical ciiilca ciiilac ciiialc ciiiacl ciicila ciicial ciiclia
ciiclai ciicali ciicail ciilcia ciilcai ciilica ciiliac ciilaic ciilaci ciiacli ciiacil
ciialci ciialic ciiailc ciiaicl ciaicil ciaicli ciaiicl ciaiilc ciailic ciailci ciaciil
ciacili ciaciil ciacili ciaclii ciaclii ciaicil ciaicli ciaiicl ciaiilc ciailic ciailci
cialcii cialcii cialici cialiic cialiic cialici ccliiia ccliiai ccliiia ccliiai ccliaii
ccliaii ccliiia ccliiai ccliiia ccliiai ccliaii ccliaii ccliiia ccliiai ccliiia ccliiai
ccliaii ccliaii cclaiii cclaiii cclaiii cclaiii cclaiii cclaiii cciliia cciliai cciliia
cciliai ccilaii ccilaii cciilia cciilai cciiila cciiial cciiail cciiali cciiila cciiial
cciilia cciilai cciiali cciiail cciaiil cciaili cciaiil cciaili ccialii ccialii cciilia
cciilai cciiila cciiial cciiail cciiali cciliia cciliai cciliia cciliai ccilaii ccilaii
cciilia cciilai cciiila cciiial cciiail cciiali ccialii ccialii cciaili cciaiil cciaiil
cciaili cciiila cciiial cciilia cciilai cciiali cciiail cciiila cciiial cciilia cciilai
cciiali cciiail cciliia cciliai cciliia cciliai ccilaii ccilaii cciaili cciaiil ccialii
ccialii cciaili cciaiil ccaiiil ccaiili ccaiiil ccaiili ccailii ccailii ccaiiil ccaiili
ccaiiil ccaiili ccailii ccailii ccaiiil ccaiili ccaiiil ccaiili ccailii ccailii ccaliii
ccaliii ccaliii ccaliii ccaliii ccaliii cilicia cilicai ciliica ciliiac ciliaic ciliaci
cilciia cilciai cilciia cilciai cilcaii cilcaii cilicia cilicai ciliica ciliiac ciliaic
ciliaci cilacii cilacii cilaici cilaiic cilaiic cilaici ciilcia ciilcai ciilica ciiliac
ciilaic ciilaci ciiclia ciiclai ciicila ciicial ciicail ciicali ciiicla ciiical ciiilca
ciiilac ciiialc ciiiacl ciiacil ciiacli ciiaicl ciiailc ciialic ciialci cicilia cicilai
ciciila ciciial ciciail ciciali cicliia cicliai cicliia cicliai ciclaii ciclaii cicilia
cicilai ciciila ciciial ciciail ciciali cicalii cicalii cicaili cicaiil cicaiil cicaili
ciiicla ciiical ciiilca ciiilac ciiialc ciiiacl ciicila ciicial ciiclia ciiclai ciicali
ciicail ciilcia ciilcai ciilica ciiliac ciilaic ciilaci ciiacli ciiacil ciialci ciialic
ciiailc ciiaicl ciaicil ciaicli ciaiicl ciaiilc ciailic ciailci ciaciil ciacili ciaciil
ciacili ciaclii ciaclii ciaicil ciaicli ciaiicl ciaiilc ciailic ciailci cialcii cialcii
cialici cialiic cialiic cialici calicii calicii caliici caliiic caliiic caliici calciii
calciii calciii calciii calciii calciii calicii calicii caliici caliiic caliiic caliici
calicii calicii caliici caliiic caliiic caliici cailcii cailcii cailici cailiic cailiic
cailici caiclii caiclii caicili caiciil caiciil caicili caiicli caiicil caiilci caiilic
caiiilc caiiicl caiicil caiicli caiiicl caiiilc caiilic caiilci cacilii cacilii caciili
caciiil caciiil caciili cacliii cacliii cacliii cacliii cacliii cacliii cacilii cacilii
caciili caciiil caciiil caciili cacilii cacilii caciili caciiil caciiil caciili caiicli
caiicil caiilci caiilic caiiilc caiiicl caicili caiciil caiclii caiclii caicili caiciil
cailcii cailcii cailici cailiic cailiic cailici caiicli caiicil caiilci caiilic caiiilc
caiiicl caiicil caiicli caiiicl caiiilc caiilic caiilci caiciil caicili caiciil caicili
caiclii caiclii caiicil caiicli caiiicl caiiilc caiilic caiilci cailcii cailcii cailici
cailiic cailiic cailici iilicca iilicac iilicca iilicac iiliacc iiliacc iilcica iilciac
iilccia iilccai iilcaci iilcaic iilccia iilccai iilcica iilciac iilcaic iilcaci iilacci
iilacic iilacci iilacic iilaicc iilaicc iiilcca iiilcac iiilcca iiilcac iiilacc iiilacc
iiiclca iiiclac iiiccla iiiccal iiicacl iiicalc iiiccla iiiccal iiiclca iiiclac iiicalc
iiicacl iiiaccl iiiaclc iiiaccl iiiaclc iiialcc iiialcc iicilca iicilac iicicla iicical
iiciacl iicialc iiclica iicliac iiclcia iiclcai iiclaci iiclaic iicclia iicclai iiccila
iiccial iiccail iiccali iicalci iicalic iicacli iicacil iicaicl iicailc iicicla iicical
iicilca iicilac iicialc iiciacl iiccila iiccial iicclia iicclai iiccali iiccail iiclcia
iiclcai iiclica iicliac iiclaic iiclaci iicacli iicacil iicalci iicalic iicailc iicaicl
iiaiccl iiaiclc iiaiccl iiaiclc iiailcc iiailcc iiacicl iiacilc iiaccil iiaccli iiaclci
iiaclic iiaccil iiaccli iiacicl iiacilc iiaclic iiaclci iialcci iialcic iialcci iialcic
iialicc iialicc iliicca iliicac iliicca iliicac iliiacc iliiacc ilicica iliciac iliccia
iliccai ilicaci ilicaic iliccia iliccai ilicica iliciac ilicaic ilicaci iliacci iliacic
iliacci iliacic iliaicc iliaicc iliicca iliicac iliicca iliicac iliiacc iliiacc ilicica
iliciac iliccia iliccai ilicaci ilicaic iliccia iliccai ilicica iliciac ilicaic ilicaci
iliacci iliacic iliacci iliacic iliaicc iliaicc ilciica ilciiac ilcicia ilcicai ilciaci
ilciaic ilciica ilciiac ilcicia ilcicai ilciaci ilciaic ilcciia ilcciai ilcciia ilcciai
ilccaii ilccaii ilcaici ilcaiic ilcacii ilcacii ilcaici ilcaiic ilcicia ilcicai ilciica
ilciiac ilciaic ilciaci ilcciia ilcciai ilcciia ilcciai ilccaii ilccaii ilcicia ilcicai
ilciica ilciiac ilciaic ilciaci ilcacii ilcacii ilcaici ilcaiic ilcaiic ilcaici ilaicci
ilaicic ilaicci ilaicic ilaiicc ilaiicc ilacici ilaciic ilaccii ilaccii ilacici ilaciic
ilaccii ilaccii ilacici ilaciic ilaciic ilacici ilaicci ilaicic ilaicci ilaicic ilaiicc
ilaiicc iilicca iilicac iilicca iilicac iiliacc iiliacc iilcica iilciac iilccia iilccai
iilcaci iilcaic iilccia iilccai iilcica iilciac iilcaic iilcaci iilacci iilacic iilacci
iilacic iilaicc iilaicc iiilcca iiilcac iiilcca iiilcac iiilacc iiilacc iiiclca iiiclac
iiiccla iiiccal iiicacl iiicalc iiiccla iiiccal iiiclca iiiclac iiicalc iiicacl iiiaccl
iiiaclc iiiaccl iiiaclc iiialcc iiialcc iicilca iicilac iicicla iicical iiciacl iicialc
iiclica iicliac iiclcia iiclcai iiclaci iiclaic iicclia iicclai iiccila iiccial iiccail
iiccali iicalci iicalic iicacli iicacil iicaicl iicailc iicicla iicical iicilca iicilac
iicialc iiciacl iiccila iiccial iicclia iicclai iiccali iiccail iiclcia iiclcai iiclica
iicliac iiclaic iiclaci iicacli iicacil iicalci iicalic iicailc iicaicl iiaiccl iiaiclc
iiaiccl iiaiclc iiailcc iiailcc iiacicl iiacilc iiaccil iiaccli iiaclci iiaclic iiaccil
iiaccli iiacicl iiacilc iiaclic iiaclci iialcci iialcic iialcci iialcic iialicc iialicc
icliica icliiac iclicia iclicai icliaci icliaic icliica icliiac iclicia iclicai icliaci
icliaic iclciia iclciai iclciia iclciai iclcaii iclcaii iclaici iclaiic iclacii iclacii
iclaici iclaiic icilica iciliac icilcia icilcai icilaci icilaic iciilca iciilac iciicla
iciical iciiacl iciialc icicila icicial iciclia iciclai icicali icicail iciaicl iciailc
iciacil iciacli icialci icialic iciilca iciilac iciicla iciical iciiacl iciialc icilica
iciliac icilcia icilcai icilaci icilaic iciclia iciclai icicila icicial icicail icicali
icialci icialic iciacli iciacil iciaicl iciailc icciila icciial iccilia iccilai icciali
icciail icciila icciial iccilia iccilai icciali icciail iccliia iccliai iccliia iccliai
icclaii icclaii iccaili iccaiil iccalii iccalii iccaili iccaiil icaiicl icaiilc icaicil
icaicli icailci icailic icaiicl icaiilc icaicil icaicli icailci icailic icaciil icacili
icaciil icacili icaclii icaclii icalici icaliic icalcii icalcii icalici icaliic iclicia
iclicai icliica icliiac icliaic icliaci iclciia iclciai iclciia iclciai iclcaii iclcaii
iclicia iclicai icliica icliiac icliaic icliaci iclacii iclacii iclaici iclaiic iclaiic
iclaici icilcia icilcai icilica iciliac icilaic icilaci iciclia iciclai icicila icicial
icicail icicali iciicla iciical iciilca iciilac iciialc iciiacl iciacil iciacli iciaicl
iciailc icialic icialci iccilia iccilai icciila icciial icciail icciali iccliia iccliai
iccliia iccliai icclaii icclaii iccilia iccilai icciila icciial icciail icciali iccalii
iccalii iccaili iccaiil iccaiil iccaili iciicla iciical iciilca iciilac iciialc iciiacl
icicila icicial iciclia iciclai icicali icicail icilcia icilcai icilica iciliac icilaic
icilaci iciacli iciacil icialci icialic iciailc iciaicl icaicil icaicli icaiicl icaiilc
icailic icailci icaciil icacili icaciil icacili icaclii icaclii icaicil icaicli icaiicl
icaiilc icailic icailci icalcii icalcii icalici icaliic icaliic icalici ialicci ialicic
ialicci ialicic ialiicc ialiicc ialcici ialciic ialccii ialccii ialcici ialciic ialccii
ialccii ialcici ialciic ialciic ialcici ialicci ialicic ialicci ialicic ialiicc ialiicc
iailcci iailcic iailcci iailcic iailicc iailicc iaiclci iaiclic iaiccli iaiccil iaicicl
iaicilc iaiccli iaiccil iaiclci iaiclic iaicilc iaicicl iaiiccl iaiiclc iaiiccl iaiiclc
iaiilcc iaiilcc iacilci iacilic iacicli iacicil iaciicl iaciilc iaclici iacliic iaclcii
iaclcii iaclici iacliic iacclii iacclii iaccili iacciil iacciil iaccili iacilci iacilic
iacicli iacicil iaciicl iaciilc iacicli iacicil iacilci iacilic iaciilc iaciicl iaccili
iacciil iacclii iacclii iaccili iacciil iaclcii iaclcii iaclici iacliic iacliic iaclici
iacicli iacicil iacilci iacilic iaciilc iaciicl iaiiccl iaiiclc iaiiccl iaiiclc iaiilcc
iaiilcc iaicicl iaicilc iaiccil iaiccli iaiclci iaiclic iaiccil iaiccli iaicicl iaicilc
iaiclic iaiclci iailcci iailcic iailcci iailcic iailicc iailicc ailicic ailicci ailiicc
ailiicc ailicic ailicci ailciic ailcici ailciic ailcici ailccii ailccii ailicic ailicci
ailiicc ailiicc ailicic ailicci ailccii ailccii ailcici ailciic ailciic ailcici aiilcic
aiilcci aiilicc aiilicc aiilcic aiilcci aiiclic aiiclci aiicilc aiicicl aiiccil aiiccli
aiiiclc aiiiccl aiiilcc aiiilcc aiiiclc aiiiccl aiiccil aiiccli aiicicl aiicilc aiiclic
aiiclci aicilic aicilci aiciilc aiciicl aicicil aicicli aicliic aiclici aicliic aiclici
aiclcii aiclcii aicilic aicilci aiciilc aiciicl aicicil aicicli aicclii aicclii aiccili
aicciil aicciil aiccili aiiiclc aiiiccl aiiilcc aiiilcc aiiiclc aiiiccl aiicilc aiicicl
aiiclic aiiclci aiiccli aiiccil aiilcic aiilcci aiilicc aiilicc aiilcic aiilcci aiiccli
aiiccil aiiclci aiiclic aiicilc aiicicl aicicil aicicli aiciicl aiciilc aicilic aicilci
aicciil aiccili aicciil aiccili aicclii aicclii aicicil aicicli aiciicl aiciilc aicilic
aicilci aiclcii aiclcii aiclici aicliic aicliic aiclici aliicic aliicci aliiicc aliiicc
aliicic aliicci aliciic alicici aliciic alicici aliccii aliccii aliicic aliicci aliiicc
aliiicc aliicic aliicci aliccii aliccii alicici aliciic aliciic alicici aliicic aliicci
aliiicc aliiicc aliicic aliicci aliciic alicici aliciic alicici aliccii aliccii aliicic
aliicci aliiicc aliiicc aliicic aliicci aliccii aliccii alicici aliciic aliciic alicici
alciiic alciici alciiic alciici alcicii alcicii alciiic alciici alciiic alciici alcicii
alcicii alciiic alciici alciiic alciici alcicii alcicii alcciii alcciii alcciii alcciii
alcciii alcciii aliicic aliicci aliiicc aliiicc aliicic aliicci aliciic alicici aliciic
alicici aliccii aliccii aliicic aliicci aliiicc aliiicc aliicic aliicci aliccii aliccii
alicici aliciic aliciic alicici alcicii alcicii alciici alciiic alciiic alciici alcciii
alcciii alcciii alcciii alcciii alcciii alcicii alcicii alciici alciiic alciiic alciici
alcicii alcicii alciici alciiic alciiic alciici ailicic ailicci ailiicc ailiicc ailicic
ailicci ailciic ailcici ailciic ailcici ailccii ailccii ailicic ailicci ailiicc ailiicc
ailicic ailicci ailccii ailccii ailcici ailciic ailciic ailcici aiilcic aiilcci aiilicc
aiilicc aiilcic aiilcci aiiclic aiiclci aiicilc aiicicl aiiccil aiiccli aiiiclc aiiiccl
aiiilcc aiiilcc aiiiclc aiiiccl aiiccil aiiccli aiicicl aiicilc aiiclic aiiclci aicilic
aicilci aiciilc aiciicl aicicil aicicli aicliic aiclici aicliic aiclici aiclcii aiclcii
aicilic aicilci aiciilc aiciicl aicicil aicicli aicclii aicclii aiccili aicciil aicciil
aiccili aiiiclc aiiiccl aiiilcc aiiilcc aiiiclc aiiiccl aiicilc aiicicl aiiclic aiiclci
aiiccli aiiccil aiilcic aiilcci aiilicc aiilicc aiilcic aiilcci aiiccli aiiccil aiiclci
aiiclic aiicilc aiicicl aicicil aicicli aiciicl aiciilc aicilic aicilci aicciil aiccili
aicciil aiccili aicclii aicclii aicicil aicicli aiciicl aiciilc aicilic aicilci aiclcii
aiclcii aiclici aicliic aicliic aiclici acliiic acliici acliiic acliici aclicii aclicii
acliiic acliici acliiic acliici aclicii aclicii acliiic acliici acliiic acliici aclicii
aclicii aclciii aclciii aclciii aclciii aclciii aclciii aciliic acilici aciliic acilici
acilcii acilcii aciilic aciilci aciiilc aciiicl aciicil aciicli aciiilc aciiicl aciilic
aciilci aciicli aciicil aciciil acicili aciciil acicili aciclii aciclii aciilic aciilci
aciiilc aciiicl aciicil aciicli aciliic acilici aciliic acilici acilcii acilcii aciilic
aciilci aciiilc aciiicl aciicil aciicli aciclii aciclii acicili aciciil aciciil acicili
aciiilc aciiicl aciilic aciilci aciicli aciicil aciiilc aciiicl aciilic aciilci aciicli
aciicil aciliic acilici aciliic acilici acilcii acilcii acicili aciciil aciclii aciclii
acicili aciciil acciiil acciili acciiil acciili accilii accilii acciiil acciili acciiil
acciili accilii accilii acciiil acciili acciiil acciili accilii accilii accliii accliii
accliii accliii accliii accliii ailicic ailicci ailiicc ailiicc ailicic ailicci ailciic
ailcici ailciic ailcici ailccii ailccii ailicic ailicci ailiicc ailiicc ailicic ailicci
ailccii ailccii ailcici ailciic ailciic ailcici aiilcic aiilcci aiilicc aiilicc aiilcic
aiilcci aiiclic aiiclci aiicilc aiicicl aiiccil aiiccli aiiiclc aiiiccl aiiilcc aiiilcc
aiiiclc aiiiccl aiiccil aiiccli aiicicl aiicilc aiiclic aiiclci aicilic aicilci aiciilc
aiciicl aicicil aicicli aicliic aiclici aicliic aiclici aiclcii aiclcii aicilic aicilci
aiciilc aiciicl aicicil aicicli aicclii aicclii aiccili aicciil aicciil aiccili aiiiclc
aiiiccl aiiilcc aiiilcc aiiiclc aiiiccl aiicilc aiicicl aiiclic aiiclci aiiccli aiiccil
aiilcic aiilcci aiilicc aiilicc aiilcic aiilcci aiiccli aiiccil aiiclci aiiclic aiicilc
aiicicl aicicil aicicli aiciicl aiciilc aicilic aicilci aicciil aiccili aicciil aiccili
aicclii aicclii aicicil aicicli aiciicl aiciilc aicilic aicilci aiclcii aiclcii aiclici
aicliic aicliic aiclici aclicii aclicii acliici acliiic acliiic acliici aclciii aclciii
aclciii aclciii aclciii aclciii aclicii aclicii acliici acliiic acliiic acliici aclicii
aclicii acliici acliiic acliiic acliici acilcii acilcii acilici aciliic aciliic acilici
aciclii aciclii acicili aciciil aciciil acicili aciicli aciicil aciilci aciilic aciiilc
aciiicl aciicil aciicli aciiicl aciiilc aciilic aciilci accilii accilii acciili acciiil
acciiil acciili accliii accliii accliii accliii accliii accliii accilii accilii acciili
acciiil acciiil acciili accilii accilii acciili acciiil acciiil acciili aciicli aciicil
aciilci aciilic aciiilc aciiicl acicili aciciil aciclii aciclii acicili aciciil acilcii
acilcii acilici aciliic aciliic acilici aciicli aciicil aciilci aciilic aciiilc aciiicl
aciicil aciicli aciiicl aciiilc aciilic aciilci aciciil acicili aciciil acicili aciclii
aciclii aciicil aciicli aciiicl aciiilc aciilic aciilci acilcii acilcii acilici aciliic
aciliic acilici

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us